BYKdb

Dataset for cluster tadcd of phylum candidatus-rokubacteria

[Download (right click)] [Alignment] [Repertoires]

12 sequence(s)

>gnl|bykdb|A0A1F7LDJ8 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium GWC2_70_16] (length=704 residues).
MSQGRAGGATHRFSSFADYLDVLRKRRRLVLAVTLLVVAVVAIATAMQEPVYLASARVLVDRYRIDPLQQIEIDRPDMTN
FYETQFELIRSRPVIQRAIDGLQLATRRPGLAGAPDPAKAVLGGVKVEVVRGTRLVDIRVEDGDPVFAADLANAIANGFV
RHVSDLRLEGSRNAYEYLTNEVKNMKDSLNRAEMALGRYKEEHQLILLPQRANAAASKMSDFHAAYVDAQTRRLELEAQL
RTVREGGPNSAALEAKSEALAGLRAQEAAAQTELNNLLKTYKDKHPAVVRARAQLDDIRARLKTEHGRVFQALEGQYKIQ
KAREAAMLQAFERYKKETQDLARKEVQFNVLQREATVGRDMLDFLIKRLRETGLSSELNTNTVRVAEAATVPTFPIRPRR
LQNLLMGLLAGLVGGLVIAFVLEFAEDSVQNPDDVAQLLGAPLLGTVPVLQAVSPSALKDAPDKARHRLVETDGADTRAV
ESLNLIGVALRSDSNGSLPRRILVTSATPQEGKSTIAANLAVTLARLGTRVLLVDTDLRHPTLDRFFGVRTPSDIGEAAR
RGTPLGEAVRPTAVPGLSLLPVGRVTGSPLALIKSAYFSAQLDALAEEFDLILFDSPPITLVADSMALAPLTEGIVLVVR
HGHGSQWRLRKMVGQLDRIRVPVLGFVYDGYTPRDDKHYSYYYGAPRKRTSRGRAGNQTVGRGS
>gnl|bykdb|A0A1F7MHS2 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium RBG_16_73_20] (length=683 residues).
MLRKRRRLVLAVTLLVVAVVAIATAMQEPVYLASARVLVDRYRIDPLQQIEIDRPDMTNFYETQFELIRSRPVIQRAIDG
LQLATRRPGLAGAPDPAKAVLGGVKVEVVRGTRLVDIRVEDGDPVFAADLANAIANGFVRHVSDLRLEGSRNAYEYLTNE
VKNMKDSLNRAEMALGRYKEEHQLILLPQRANAAASKMSDFHAAYVDAQTRRLELEAQLRTVREGGPNSAALEAKSEALA
GLRAQEAAAQTELNNLLKTYKDKHPAVVRARAQLDDIRARLKTEHGRVFQALEGQYKIQKAREAAMLQAFERYKKETQDL
ARKEVQFNVLQREATVGRDMLDFLIKRLRETGLSSELNTNTVRVAEAATVPTFPIRPRRLQNLLMGLLAGLVGGLVIAFV
LEFAEDSVQNPDDVAQLLGAPLLGTVPVLQAVSPSALKDAPDKARHRLVETDGADTRAVESLNLIGVALRSDSNGSLPRR
ILVTSATPQEGKSTIAANLAVTLARLGTRVLLVDTDLRHPTLDRFFGVRTPSDIGEAARRGTPLGEAVRPTAVPGLSLLP
VGRVTGSPLALIKSAYFSAQLDALAEEFDLILFDSPPITLVADSMALAPLTEGIVLVVRHGHGSQWRLRKMVGQLDRIRV
PVLGFVYDGYTPRDDKHYSYYYGAPRKRTSRGRAGNQTVGRGS
>gnl|bykdb|A0A1Q7D2L3 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium 13_1_40CM_68_15] (length=781 residues).
MNTFNDPTRDPRALPPARAGLELVQGRVPMLPEPQTLYGVPVEKETHFWDYWQVVSRRRWTILCVFLGTLLAATLYTFTI
RPVFTGTVSLRIEKEPPRVVKFEEVVKEADNQQDYYQTQYKILQSRSLANRVIGLLQLDQHQEFEQDQDGWVARGESWLR
EQLVRWIPVPPPAAPEATDDLMVASPLTDTFLKRVTIEPVRNARLVYVSFDSHYPDLAARVANTLADAFIAQQMDRMVEA
TRYATQFLAKQLEEARGKLGESETHLSNYLNSHGILFVTADRLGQPQDIITQQLTLMSEAFLRARADRMAKESLLTQASV
QDAFTLPAVLQSPLIAQLKTDGAALEGEYRRFSQTFKPDYPRMLALKEKIDENRRQLRTEIDRTLASLKSDFESSVRSEK
ALEASLAKQSTLARGLAENMAEYNLLRREVDTSRDLYASLLGRLRETQVSAALLTSNISVVDPAEIPIGPSRPRKMLNLL
IACVAGIAGGIGLAFLFEYLDTNIKDTKEVESLLRVPALGVVPSRAAFERMLARRKAVESGPTAETPFALVSHSELPSVF
AEAFRNLRTSILYSTPERPPKTLMMTSLQPEDGKTSLVTNLAITLSQLGGSPVILVDADMRRPMVHRVLNIEQTPGLSTY
LTGQADLEQVIVPSGIPNLFVIPAGRIPVNPAELLASARLREMIEALGQRFAYIVFDIGPMFGVSDAMILAGQLEGTVLV
LRHGRASRDAAQRAVRSLTAVRARLLGVILNDVDIHANGYGYGYYGYYGYSSNESTVARRN
>gnl|bykdb|A0A1Q7GC33 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium 13_1_40CM_4_69_5] (length=836 residues).
MTISNLPTPLAPSPAVAPVTPYPGIAELDSPDAEGGVDWRRISSALLRFKWLIAAVTFVGTVAGVGATRFLKPEYAAQAK
IWIDVAGRRGPDRGPTPIRPGQLLDPESWVDLLESYVVLDQVVRDERLFLSPSSLADALALETFRVADQYRPGAYRFSVG
RSGQDYALATMDGIEIERGTLGDSVARRLGFQWAPAPGTVAPGRTVEFTLTTLRDAATRLSEGLDARMDPDGNFLRVELR
GPNPERITAIVNAVAQRYVQVEADLKRKKLTELTKILGDQVQHSQENLRRAEDALQRYREETITLPSERPTVGAAVTGPP
GSAPVAGLGGTGGVGAAGAVGGAGRDPVLGGFFEMQMSREEARRDRSALGRLLAQAGDSGLSGDALSVVGSVQENPELSE
ALKELTTKQAELRGLRYKYQDDYPPVQRLVGEIATLERQTIPALARALAGQLAAREGELSRRLDADSRSLRRIPERAITE
ARLRRDATLSENLYASLQQQYDEARLAEVSTVSDVRVLDSAVVPRRPVKNTAPRLILLAFLGSFGLAVMGAILIDRADPR
VRYPEQVSREMGLTILGAVPYVRVRPQARPGHNGGPRQPEDAAMVVEALRGVCLNLSYAQRAAAPLLVTITSPGAGDGKS
FLVANLGHTFAEAGHRTLLIDGDIRRGVLHRRLSARRRPGLTDFLRGEVPVEAIVQATPYPSLSLIGCGTRASNAPELLG
SQVMAQLVTTLRPSYDVILVDSPPLGAGVDPLILGTLAGHLAVVLRTGYSHRDMAAAKLDVVQRLPVRLLGAILNAVPAG
AAYGYYSYYSYYLSGYEAVDEENERSNGSKGQPLVT
>gnl|bykdb|A0A1Q7U8C0 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium 13_1_20CM_4_68_9] (length=784 residues).
MSEQLRSEPPAPSRRLADRADPEAFVHTVGLEELLSTLRRHVWLVLGVAAVAVAATGFVAYTTGPVYRAVAVIRLSDPRR
ALTGGVVEDPAPSADERFADPLLSQVELLTSGTVAGAVVDSVPMLRVLTRKFSPSLLGGVAVAPDSAAHSFQLTFGRDDF
VVEGPAGQQRRAAYGRVVDLGVIRFAVLHRPSAKQGFLQVLDQESAISYLIAKVRVRPRLRTDIVDVAYSAPDPARAQEV
VNRVVDVFRAASADAAQRQSKLRREFLEAQLKVNDSLLADARQALTEFQRRARPYGSGGSSAREQSELPGLELERQQLMA
ERRTDEALLAALRDSSTSRKAIQTALAAPGMGASPALSQLSAQLFQYEMARDSLASRSARHPDLPRLNLLVSSTEAKLLR
AVQAGVQGSIASLDGRIAAIDDLRAHWAGGLQQDAEEARLKERVDNARKVADELRVEYQKAGIAEAITVGQVEIVDHAAL
PAKPAGIGLPEQIALGLLVGLMLGSAGAFLAERLGSTIAQRVQVERLGMSVFGVITHWDRDAREKGVKNPDAVVEAFRGL
RLTLVNEYGAPGPIVVTVTSPGSGDGKSFVSSNLALAFAYAKQRTLLVDADLRRGALHRLLNLRRQPGLTDFLIGDVSRA
PALQTTAYPFLDFLPSGTRRRDAPELMGSAAMVDLVTSLRSTYDVIVLDTAPLGAGVDALALAKLAGNLLMVLRLGRTDR
ELAEAKLEILRRLPLRLLGAVLNDVRDESEYRAYAYYMDGYALTNEPPFRPLGGKQGASSHAAG
>gnl|bykdb|A0A2V6R309 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=790 residues).
MSDDVDPRRDLRSLPSGEDGPQLVQSHAPTIIAPVEPARAYPYVVDDAAPHFWDYWRVLARHRWTVVSFFLVTVTVAMIW
TFTTKPIYTGTATLRIESEEPRVLKFEEVVKDADSRQDYYQTQYKILQSRTLADRVIGLLQLDQHAEFAQPEGGLVASLE
AWGKRELVRWIPVPPPPAPEGAEDLVLESPLAEAFQEHLSVEPVRNSRLVKVSFDSHYPDLAARVANTIADAFIAQQLDQ
KVEGTRYATQFLANQLDETRDKLREAEEQLNKFLAANDILLVSADKNGQPQDLLTQQLSLVSEAYLKARADRIAKGSLLA
PASGPDLDSLPVVLQSRLIVQLKQDLATQEAEYKKLGQVFKPHYPRMQQLAQKIAEGRRQLQAELGRTVASLQADYQAAA
RTEQEMESALVRHRGLARRLSARTAEYNLLRREVDTSRDLYTALLARLRETQISSALLTSNIYVVDRAEVPNHPSKPKKA
LNLLLACVVGLLGGVGAAFFFEYLDTSIKDAKEVEAVLRVPTLGLVPSRRALERRARRRREFVHGDDLPFALVCHADMSS
VFSEAFRNLRTSLLYSAPDHPPRTLLVTSLHPEDGKTSLVTNLAITLAQLGAGEVLLIDADMRRPSLHEILGVAQAPGLS
TFLTGQAALTDVIKPTGIPHLSSIPSGRIPLNPAELLASTRLRQALTTLEVGFAYVVFDTGPLFGISDAMVLAAQVEGVV
LVLRHGRATRDAAQRAVRSLLSVRARLLGVVLNDVDLSGQGSYGYYGYYGYGARSAEGAAKEVSSQGSRA
>gnl|bykdb|A0A2V6RFZ8 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=773 residues).
MSGPQEFAEDARPPSPGAPTVELVPSEPPRPAATARARLYTYPGEEEGVHFWDFWHVLNCRRWTVISSCVVTVIAVTIWT
FTTPPVYTGTATLRIEKEDPHVVKFDEVVKDADSQQDYYQTQYKLLQSRTLANRVIGLLQLDQHPDFQRPERERGWLTQA
EIRFRQWLVRWAPVPPPPAPQETEDLALASPLTSAVLSRLSIEPVRSSRLVRISFESHFPDLAARVPNALADAFIAQQLD
QKVEATRYASQFLAKQLDETRDRLGEAEGKLNRFLKANNILFITGGDKTSQAQDLITQQLTLLSDGWLKARSERIAKESL
LAQGNTQDVGTLPAVLQNPLVSKLREDLAALESEYEKLSQVFKPGYPHMRQLAEKIAESRRQLRTEIDRAAQAVQADYQA
ALRTEQELEGALAQQRLQAGGLADNMAKYNLLRREVDTSRDLYSSLLARLRETQISAALFTSNISIVDRAEISGMPSRPK
RSTNLLVGCIAGLLGGVVLALVFEYLDTNIKDAKDVESVLRVPILGMVPSWALRRRREPADGRPFALAAQSTTASDFAEA
FRNLRTSLLYSSPDHPPKTILVTSLQPEDGKTSLATNLAISLVQLGRVEVLMIDADMRRPNLHNVLSVRQAPGLSTFLTG
QAELADVIVPTSVRNLSIIPSGRIPLNPAELLTSTRLPQALEGLGGRFAHIVVDTGPIFGVSDAMIVAAQVEGVVLVLRH
GRASRDAAQRAIRNLMSVGAKLLGVILNDVDVRAEGYYGYYSNYGYEAEKETA
>gnl|bykdb|A0A2V6UHF5 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=753 residues).
MVEESTTSPDVDYLRLLRRIANRWRLIALISLAIVLPVTAYAVVFVPKMYEAVAKIFFEDPRRLQAGMMRDWMPASDASF
QLAILKSRSLAEAVVENLPRETTEELLARAMHRDYLLEGRNLFRRAMGQDSIIYSPQQRAVTELQSARVTFTPLPSGEVE
IRAVAYAPRVAMDLANTYVEVLQTRSRSNIRDEARTSREFIETLLNQTKTSLQQSEEQLAKVARGRSLRMPERNAIEAAQ
LSQLENSLAEIQGSKEIAKVRLAQLKGKDASGRPVPQAAQQQVTRRLLQLQEKLAGLRERYTDSHPLVKATQAEIKDAQD
MLTAGPQGLPERVAAPQFGAAERAASAKQIADLEQEVSALETREEILKQRLARTSQGLSNLGAEELEVAKLRQSVESQRN
LVTTLSEKLGTVRIQEQGEDRGLRLIDLAALPQRPSSVPAMRVILLGMVGGLGLGIGLAGLLEYFKQPMETEEDITAATG
LPVLGWLPTIQGSGRPDKGPEREPMSFIDVFAPNTLPIEACRSIRVSLLSMYRAEDVRTIMLASAGPGEGKSTVALNLSY
VFSQAGRRLLMVDGDLRRPSLNRPLRLPVKPGLVDVLASHLPLAAALQPIKDGFQLLAAGTTDGADPGVLLSADNISRLF
DLAKGHADLVVFDSAPVLAVADNLALASMVDAVILVVRAGVTQRRDLVRAKAMLDKVRAPVVGAVLNRVSSRETRRYYRS
YSGYYGVGEGTSVRRRFRSAQSWWPIRRSEKVG
>gnl|bykdb|A0A2V6UWS7 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=786 residues).
MSALWRPERETRMLPAGDPVEITRAEHVAYGYPAEETSHFWDYWRVIRRRRWTIITCFLVTVTAVTVLSFTARPVYRASA
TLRIEKDQPRIVKFEEVVKEDSQQDYYQTQYRILQSRSLANRVIGLPQLDQHPEFAAAPKSLNERTEDTVREWLVRWIPV
PPPPAPEAVEDLVVTSPLTSAFLGRLTVEPIRSSRLVKVAFDSGHPDLAARAANTVAEAFMAQQLDQKIEATRYATQFLA
KQLEEARGKLEESEGKLTKFLNGHDILFVTADRGGQQQDLISQQLALLSDALLKVRGERIAKESLMTLASTRDVDSLPAV
LQSSMIAGRKQELAGLESEYRKLAQTFKTDYPRMQQLAEKIAETRHQLRVEIDRAVAALQADYQAAVRTEREIEVALTQQ
RKLARGLSDSMAEYSLLRREVDTSRELYASLLGRLRETQISAALFTSNISVVDRAEVPSTPYKPNKAQNLLLACLVGLVG
GVGLAFLFEYLDTNIKDTKEVESVLRVPALGLVPSRHLGQGRRARRALAAGDSAPFALLAHSQMGSVFSEAFRNLRTSLL
YSTPDHPPKTILVTSPHPEDGKTSLVTNLAITLAQLGSGEILVIDADMRRPNLHEILELPKAPGLSTYLTGQAELADVVV
ASAIPNLSVIPAGLVPLNPSELLASARFKQALDTLGQRFAYIIVDTGPLFGVSDGMILAGQVEGVVLVLRQGRASRDAAQ
RAIRSLLAVRARLLGVILNDVEVGGTRYYGYYDYYGNGGSNGHAAGEGHRNGTAHEPVADDSRRAS
>gnl|bykdb|A0A2V6WUL2 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=788 residues).
MSDVDPRHDPRPLPSGDEGHELVPGPASATLAPLEPVRAYPYGVDEDAPHFWDYWRVLARHRWTVISFFLVTVIAVMIWT
FTTKPVYTGTATLRIENEEPKVLKFEEVVKGADSQQDYYQTQYKILQSRTLANRVIGLLQLDQHPEFSQLERDGGLAAWV
RRQLVSWIPVPPPPAPEGAEDLVLESPLAETFLEHLSVEPVRNSRLVKVSFDSHYPDLAARVANTTADAFIAQQLDQKVE
GTRSATQFLAKQLDETRDKLREAEEKLNAFLTANNILFVNVDKNGQPQDLLTQQLSLVSEAFLKARADRIAKESLLAQAN
GQDNGSLPVVLQSRLIVQLKQDLTTQEADYQRLGQIFKPQYPRMQQLAQKIAEGRRQLQAELRRAVESLRADYQAAARTE
QEMEASLVQYRGMARRLSDRMAEYNLLRREVDTSRELYTSLLGRLRETQISSALLTSNIYVVDRAEIPSRPSRPKRALNF
VLACVVGLVGGVGVAFFFEYLDTSIKDAKEVEALLRVPTLGLVPSRRALERRGRRRRELVQGDRLGPFALVSHADMSSVF
SEAFRNLRTSLLYSAPDHPPKTLLVTSLYPEDGKTSLVSNLAITLAQLGAGEVLLIDADMRRPSLHEVLRLAQAPGLSTF
LTGQAELNDVIKPTRIPNLSAIPSGRIPLNPAELLASSRLRQALTALEARYAYVVFDTGPLFGISDAMVLAAQVEGVVLV
LRHGRATRDASQRAIRSLLSVRARLLGVVLNDVDVSGQGSYGYYGYYGYDARAAEGAAKEVRSHGSST
>gnl|bykdb|A0A2V7HN10 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=786 residues).
MSALWRPERETRMLPAGDPVEITRAEHVAYGYPAEETSHFWDYWRVIRRRRWTIITCFLVTVTAVTVLSFTARPVYRASA
TLRIEKDQPRIVKFEEVVKEDSQQDYYQTQYRILQSRSLANRVIGLLQLDQHPEFAAAPKSLNERTEATVREWLVRWIPV
PPPPAPEAVEDLVVTSPLTSAFLGRLTVEPIRSSRLVKVAFDSGHPDLAARAANTVAEAFMAQQLDQKIEATRYATQFLA
KQLEEARGKLEESEGKLTKFLNGHDILFVTADRGGQQQDLISQQLALLSDALLKVRGERIAKESLMTLASTRDVDSLPAV
LQSSMIAGRKQELAGLESEYRKLAQTFKTDYPRMQQLAEKIAETRHQLRVEIDRAVAALQADYQAAVRTEREIEVALTQQ
RKLARGLSDSMAEYSLLRREVDTSRELYASLLGRLRETQISAALFTSNISVVDRAEVPSTPYKPNKAQNLLLACLVGLVG
GVGLAFLFEYLDTNIKDTKEVESVLRVPALGLVPSRHLGQGRRARRALAAGDSAPFALLAHSQMGSVFSEAFRNLRTSLL
YSTPDHPPKTILVTSPHPEDGKTSLVTNLAITLAQLGSGEILVIDADMRRPNLHEILELPKAPGLSTYLTGQAELADVVV
ASAIPNLSVIPAGLVPLNPSELLASARFKQALDTLGQRFAYIIVDTGPLFGVSDGMILAGQVEGVVLVLRQGRASRDAAQ
RAIRSLLAVRARLLGVILNDVEVGGTRYYGYYDYYGNGGSNGHAAGEGHRNGTAHEPVADDSRRAS
>gnl|bykdb|A0A353V8C8 [Bacteria] Bacterial tyrosine kinase [Candidatus Rokubacteria][Candidatus Rokubacteria bacterium] (length=704 residues).
MSQGRAGGATHRFSSFADYLDVLRKRRRLVLAVTLLVVAVVAIATAMQEPVYLASARVLVDRYRIDPLQQIEIDRPDMTN
FYETQFELIRSRPVIQRAIDGLQLATRRPGLAGAPDPAKAVLGGVKVEVVRGTRLVDIRVEDGDPVFAADLANAIANGFV
RHVSDLRLEGSRNAYEYLTNEVKNMKDSLNRAEMALGRYKEEHQLILLPQRANAAASKMSDFHAAYVDAQTRRLELEAQL
RTVREGGPNSAALEAKSEALAGLRAQEAAAQTELNNLLKTYKDKHPAVVRARAQLDDIRARLKTEHGRVFQALEGQYKIQ
KAREAAMLQAFERYKKETQDLARKEVQFNVLQREATVGRDMLDFLIKRLRETGLSSELNTNTVRVAEAATVPTFPIRPRR
LQNLLMGLLAGLVGGLVIAFVLEFAEDSVQNPDDVAQLLGAPLLGTVPVLQAVSPSALKDAPDKARHRLVETDGADTRAV
ESLNLIGVALRSDSNGSLPRRILVTSATPQEGKSTIAANLAVTLARLGTRVLLVDTDLRHPTLDRFFGVRTPSDIGEAAR
RGTPLGEAVRPTAVPGLSLLPVGRVTGSPLALIKSAYFSAQLDALAEEFDLILFDSPPITLVADSMALAPLTEGIVLVVR
HGHGSQWRLRKMVGQLDRIRVPVLGFVYDGYTPRDDKHYSYYYGAPRKRTSRGRAGNQTVGRGS
© 1998-2019