BYKdb

Dataset for cluster orphancd of phylum candidatus-schekmanbacteria

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bykdb|A0A1F7RIE5 [Bacteria] Bacterial tyrosine kinase [Candidatus Schekmanbacteria][Candidatus Schekmanbacteria bacterium RBG_13_48_7] (length=248 residues).
MNQLVVKPGGRSLISEAYRSLRTNIQFANPIYFSKEILFTSVGPNEGKSTTVANLSATLALMGNQVVMVDCDLRKPVLHK
IFGCSQSSGITNILADSHSIDENFLKTCIQETRIPNLHLLASGSIPPNPSELLGIKRFDQIMEILRNLYDYVIVDTTPVI
GITDSCVLASRIHRVMLIIDLKSTSKDMVLRSKKLLENVGAKINGVVVTKLKRNNFNSGYYNYYKYYYHEKGNGKPKTPN
RLENKHAM
>gnl|bykdb|A0A1F7RIF5 [Bacteria] Bacterial tyrosine kinase [Candidatus Schekmanbacteria][Candidatus Schekmanbacteria bacterium GWA2_38_11] (length=234 residues).
MSEECNECLVTLLDPRSPVAEQYRSLKTHLMGEAETRLISTFLVTSTIRGEGKTTTACNLGVTLANNPQHSVLIIDGDMR
IPSVHKMFGIKYEKGLIEYLRGEADLDSLLVPTHLDNLFVLPAGEPCSNPSELLASPRMRDLIKNEEAKGKGHYLIIDSP
PIISTTDSRILSGYVGGVILVVQSRKTPIDIINHGLSLLKNAQILGVVLNNISGISPYYSYIYSYAYGYAEYSK
>gnl|bykdb|A0A1F7S3V5 [Bacteria] Bacterial tyrosine kinase [Candidatus Schekmanbacteria][Candidatus Schekmanbacteria bacterium RBG_16_38_10] (length=234 residues).
MSEECNECLVTLLDPRSPAAEQYRSLKAHLMGEAETRLINTFLVTSTIRGEGKTTTACNIGVTLANNPQHSVLIIDGDMR
IPSVHKMFGIKYEKGLIEYLRGEADLDSLLVPTHLDNLFILPAGEPCSNPSELLASPRMRDLIKNEEAKGKGHYLIIDSP
PIISTTDSRILSGYAGGVILVVQSGKTPIDIINHGLSLLKNAQILGVVLNNISGISPYYPYNYSYAYGYAEYSK
>gnl|bykdb|A0A1F7SPN8 [Bacteria] Bacterial tyrosine kinase [Candidatus Schekmanbacteria][Candidatus Schekmanbacteria bacterium RIFCSPLOWO2_12_FULL_38_15] (length=224 residues).
MFLDPRSPVIEQYRSLRTHLLAESGNKSINTFLVTSSIRGEGKSITSCNLGIILAHNRQNSVLLVDGDMRIPSIHKIFGI
RGNRGLVDYLKGESELDSLIVPTKIDNLFILPAGEPQTSPSELLATSKMTDFLRMEESKGKNHYVIIDSPPIISTTDPRI
IATYVGGVLLVVQAGRTPRDVISHGLSLLKNVNILGIILNNISGISPYYPYRYSYAYGYVEYSK
© 1998-2019