BYKdb

Dataset for cluster tadcd of phylum candidatus-schekmanbacteria

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bykdb|A0A1F7RAT1 [Bacteria] Bacterial tyrosine kinase [Candidatus Schekmanbacteria][Candidatus Schekmanbacteria bacterium GWA2_38_11] (length=696 residues).
MEKKIEIKPHLRDYIYILKKRAWTVFLVFTFLLLTVTIATFKQVKIYVAVAQIMIEYSPTQIVAFPDISQVSGYREYFET
QFKIITSRSVALEVINRLYPGKNFTEDERLSLADFIRERITVDPIKKTNLADLRVKGPDPVESTNLVNTIAEIYIEKSLE
SKVNDYKTASGWLDDQITSVILKMKKAEFDLQKYREDKKIISPKIEDRQGSVIEELTRVNGELIQLKLKKVELEIALSQI
KTMGDKGIDINETSLPGTFNESGIQAMRQKIYNLKEELAKLEKTYMPKHPRMIRLKEELLAIQNNIKDEIQSVIDKVQNE
HELLVSKEKILIERKDELNEEAISLLDKSIQYNILDREVQINRNLYDYLLKRAGEINVTGSMRFSNISLVDKATIPKEPV
APNKPKNIILGALVGLILGTGLAFFLEYLDTTIRSIEDVEHYFSIPLFGFVPSFGAYIKKQDKKADVELVSFTYPKSTIA
ECYRAIRTNLLFSSEHPPKVLMVTSSTPEEGKTMTSVNLSISMANSEKRVLLIDADLRKSRIHKIFKVENKFGLSTILTD
NIDPLSIVVKTKIPYLSILTSGPLPKNPAELLMSVRMREVLNIFRNNYDFIFIDSPPILPVTDPSIIAKYVDVVCLVVRS
GVTSKDVAIKNAKKFQEIDVKRLGVILNDVSRQNSDYYYTEYYYSYYHRAEDLENL
>gnl|bykdb|A0A1F7SHX0 [Bacteria] Bacterial tyrosine kinase [Candidatus Schekmanbacteria][Candidatus Schekmanbacteria bacterium RIFCSPLOWO2_12_FULL_38_15] (length=696 residues).
MEKKVEVKIHLKDYLYILKKRMWTVVLVFIFLLLTVTIATFKQVKIYRAVCQIMIEFSADRIVSFPDISQVSGYREYFET
QFKIIKSRSAALEVINILFPGKNFTEDEKLSLADEIRERIKVNPIKGTNLVNLEVEGSDPNEITSLVNTISEVYMEKSLE
SKVNDYKTASGWLDDQITSVILKMKKAEFDLQKYRENKKIISPKIEDRQGSVMDELTLVNVERNQLKSKKVELEISLSQI
KSMTEKGIDIDETTLPGFMKQTNLPGMRQKTYAIKEEIAKLEKTYMPKHPRVVRAKEELTALQENIKNEIRTIIESIQND
YELTKSKEGILNERRDELNEEAISLLERSIQYNILDREVEINRNLYDYLLKRAGEINVTGSMRFSNITLVDKATVPKVPV
APNKPRNILLGTLVGLILGCGLAFFLEYLDTTIRSIEDIEHYINIPLLGFVPSFSAYIKRREKRSNPELVSFTHPKSTVA
ECYRAIRTNLLFSSDHPPKVMMVTSSTPEEGKTITSVNLAITMAHSEKRVLLIDADLRKSRIHEIFKIENRFGFSTILTD
SIDPLSVIIKTKIPYLSVLTSGPLPKNPSELLMSLRMRELINIFRNNYDFILLDSPPILPVTDPSIIARYSDVVCFVIRS
GVTGKDVVIKNAKKFQELEVKRLGVILNDVSKQDSNYYYTEYYYSYYNRAEDLESQ
>gnl|bykdb|A0A3M1RMR4 [Bacteria] Bacterial tyrosine kinase [Candidatus Schekmanbacteria][Candidatus Schekmanbacteria bacterium] (length=699 residues).
MDVAKKIETKLSLKDYFYIVKKRVWTVVLIAMFILVSVSIATFKQKKLYMAKSRILIEYSASNIVSFQDINKFSGYNEYF
ETQYEIIKSRMVALEVVDRLFPNENLTEDERIARADAIRAKIIVNPVKGTNLVDLAMMGPDPKEVARLVNLVTDVYIEKS
LEDKVNSYKTASSWLDDQITSVIVKMKKAEFDLQKYREQKQIISPKIEERQSNVIAELNQVTRELQGLRSRKLELEIALK
QIKELRDKGIDIDETTLPEVLQGTGIQAMRGQIYALTQTLYKLKTEFGEKHPEVLKVKAQIDAINKNIQTEIDKVINRIN
NQYELLKAKEKLYNERKKELNNTAIGLLERSIQYNILNREVEINRNLYDYLLKRAGEINVTGSMRFNNISLVDKATVPKK
PISPNVPRNLILGAVVGLIFGLGFAFFLEYLDETIRSLEDVEHYLNLPILGFVPNIHSYMKKRSQRVSPELITYTHPKST
VSECYRAVRTNILFSTEVPPKVIMVTSSTPGEGKTVSAVNIAIAMAQSEKKVLLMDGDLRRSRIHDIFRLENKYGLSTLL
TDENIDAFSLIVKSSITNLNILPSGPVPKNPAELLMKERMKSLIKIYKDNFDIIIIDAPPVVPVTDPSIISKYSDVVCLV
VRSGVTAKNIVEKNAKRFLDLDVKRLNVLLNDVRKQDSDYYYSEYYYSYYKKEEELHQV
© 1998-2019