BYKdb

Dataset for cluster orphancd of phylum candidatus-sumerlaeota

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bykdb|A0A1V5FRG6 [Bacteria] Bacterial tyrosine kinase [Candidatus Sumerlaeota][candidate division BRC1 bacterium ADurb.BinA292] (length=302 residues).
MAKVLDALEQARRERLRKLRAAGARVEAPLNPTEPGDDLELELVEAPQRESALRPGQRPVVAPAAHPHIAPEIVALHASD
SPVAEQVRQIRTNLETVLAKLTARTIVITSPVSGDGKTLVAANLATILADDPRTRVMLVDADLRKPDQHRLFGVKGSPGL
AEYLRGRHELADVAVGTSIPNLDFIPAGFPPDKPTVLLSGERMGELLKTLEETYQWVLFDTPPMLPVTDASLLARHVTGL
ILVVRVGSTTRGAIERTQEMLAETHLPILGCILNDFNDHAAPGGYYHKAYGRAEAVAADEQG
>gnl|bykdb|A0A353GLB1 [Bacteria] Bacterial tyrosine kinase [Candidatus Sumerlaeota][Candidatus Sumerlaeota bacterium] (length=560 residues).
SKSERPLNAAPVAPVQPIAALIPEITSARKKTPPDEGPQQPDNLNVEIKDLMAEIFAQPTIDIAPTAVREKPEENSQVPD
LQAEIEVNIQSVVQDETSFFSQVKEEIETFVPDDPEPTVSLPNVKQNASDVSARFQADDTLPPFDVTPPIVQAQEEVSSA
ADLYPTLDFEVPKVTATVNSAPIPSGTVSEAPDPPSESEKVVAAAPMTIPEASVPKVPTPVTPPVTAARQAEPVFVLDPE
PVIPPAKPEPLPTQPLFPNQLETNASVPVAPTIPPPESPLFPNSEKRDALSGGRERHRLTPKRTKGEIPVPGPDPDPLSI
QRITVVHPRPDKRVLSFYEPKHHICEEYRLLGKNLLHTFANTGEITRRGKVVTLTSSIRGEGKTLTSINLSLNMADDLKN
RILLIDGDLRHPKVHKYLGLPGQTGLNDLINSADPKSILEDCIVRTESGLHCLFSQATRENPAPMLDTPRMSEILELLRD
RYSVIIIDTPPVLLATDSLVLGSRSDGVLFILRARKTKREQIQEARQRIARLEIRMLGYVINNVKTFLPKIWSRYYYGNY
© 1998-2019