BYKdb

Dataset for cluster orphancd of phylum candidatus-vecturithrix

[Download (right click)]

1 sequence(s)

>gnl|bykdb|A0A081C5E2 [Bacteria] Bacterial tyrosine kinase [Candidatus Vecturithrix][Candidatus Vecturithrix granuli] (length=237 residues).
MARHRSSRKHRDLNIIWEEGKHSMAAESYRTLRTNISLSQVDNPIRTLLVTSCIPREGKSTTVANLGVTFALAQQKVLII
DADLRRPILHRLFGIPNVQGLTHTLSDTVEYDQVFTPTKISNLWVVTSGIIPPNPSELLGSKKMKAFLERAKQQFDMILL
DSPPISSLADASVLGSIVDGVLFIVKVNMANRDLIQKAKEQLTTVGANIIGVVLNDVDVKRDGYYKYYYYYNYEYYG
© 1998-2019