BYKdb

Dataset for cluster tadcd of phylum candidatus-vecturithrix

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bykdb|A0A081BXV5 [Bacteria] Bacterial tyrosine kinase [Candidatus Vecturithrix][Candidatus Vecturithrix granuli] (length=742 residues).
MFDEVIQLREYVHILKKRRWIILTVTFLTVVAITIWTFRQIPIYEATTRILIEKESPNLIAFEEVLKLDTSAQDYYQTQY
MILMSRSLAKEVLKKLGLTDLQRPQVQMFFSVRGIFNELAEKLGLSTPAPSPESDETIDKEERLVNEFLQSITVSPIRGS
RLVDIKAISTDRQQAAMLANTLADVYIERNLDDKLVASKDAVLWLEKEVEITQKKVADSEAALQQYKEEHGILSFEERQN
IIMQKLLELNTAVNEAKIKRAAIEAQYKQVQKYQSDKVESLSVVINNPLIQGLKVELANLESELSQLRKKFRDKHPNMTA
LQSQIDATKSRLNTEIKRIFDSLKSDYEVALAQEKDLSKMLEEQKHEAMDLNKKAIRYGELQREVESNHRVYNELLQRTK
ETNVTERLQTNNIRIVDHAVVPNSPIAPKKIRNILLAMVVGLTMGIGLAFFFEFWDNSIKTSDDIKQYLDMPFLGFIPKV
YGKEYSNNGNNGTRAKPDMIVAIDPKSSASEAYRTLRTNVVFSLVSDEERALDLDFGSVMLVTSPGPAEGKSCIVANLGI
AMAQSGSKTLIIDCDLRKPVMHKIFNVNNDRGFADMMADIKTYGTKVVVKHTKIKNLDVIPCGKIPPNPSELLGSSLARI
VIEALAERYDKILIDSPPVNTVTDPILLSRIADGIVFIVHAGQTKRDVAQRARDQLLSADAVILGGVINSVDLKKDSYYY
YYSYYHSHYYTQDGKKQLNAAA
>gnl|bykdb|A0A0S6W9T1 [Bacteria] Bacterial tyrosine kinase [Candidatus Vecturithrix][Candidatus Vecturithrix granuli] (length=797 residues).
MIPCEEGKKTDFPKTKGGKDVFQEEVHLRDYLRIIKKRQWVILTFFVIVVVSVAITTFLKSPIYRATTRILIEKETPNVL
SFKEVLALDTSDTDYYQTQYTILKSRTLAKEVLEKLGLMEQAMQTESRSFSIRGLVSGLIVLLGLRESLSEEAQNRAREQ
QAIDHFLNDMITIEPIKGSRLVDVNAFSTDPKLAANIANTLVATYIQQNLEAKLSASKDAVGWLAEQLKVTQQKVADSEN
ALFQYKEQHAIISFEDRQNMVMQKLSELNTAVNNARIKRITAETQYNQIQEYLAAVESSSNAKAIEKLESISQVINNPLI
QRLKVELSTLESELSDLLKKFRNKHPNVIALRSQIDSVRNRINSEISRIVTSIKNEYDLALAQEQEMTAALEEQKREALD
LNEKSIQYGVLDREVQSNKRVYDALLQRTKETSVTEQLETSNIRIIDQASIPNYPVAPRKKLNIFLAMVMGAVLGTALAF
FFEYIDNSIKTPEDIKQYVNIPFLGFIPKVSYEHPALLNSSPYSIELVAAFDPKSTVSEAYRSLRTNVLFSSLERGPVLL
VTSAGPTEGKSITVANLAVTMAQSGSKTLIIDCDLRKPRMHKIFNIAEHEQGITDMIANLGTNGLRITVKRTKIPNLDLI
PCGKIPPNPSELLGSERTRRLIEALSKVYDKILIDSPPVNVVTDPVILSQIAGGVIIIIRAGETGRDVVRRAREQLLDVK
ANILGGVLNSVDLKKDNYYYYSYYHNYYYHRDQNELNQATKETRLPIKYPQKVLQAANLMKKGSSIEPSDKPQQGSS
© 1998-2019