BYKdb

Dataset for cluster orphancd of phylum candidatus-wallbacteria

[Download (right click)]

1 sequence(s)

>gnl|bykdb|A0A2N1PQJ7 [Bacteria] Bacterial tyrosine kinase [Candidatus Wallbacteria][Candidatus Wallbacteria bacterium HGW-Wallbacteria-1] (length=690 residues).
MDPFSQRDNQQFKEFTLHDYFHVIRKRYLVVLAVMVLGFSFTLVFTLRQKPVYRASGSLEVRASQSYYQTDSIRLLAFSL
NTYAKVITSDELIREALENTTSKMTVAEVISGLRVNQEPGTFIINLTLQGHDQSSLATVLNSLMDALVRRTKTEHRRKIT
DAIANLRDQMGDIEANLRTSEKELKEFEALRGIAGEKRRYEEIQNKILELSKQLYQTTLDREQTALTIQSMKNRLRSVIG
TSGEINTQSGGGPGIAESVVRLIEGLARERGSLLRIYKPNHPKVLELDRRIDKLRRGEGEEAQGPTADYRQKMDELSFAL
AGLEIREKTLKSLIESERGKLSEAPDEDLVYIQLKRKLETAQKVYDSLVGRYSEINVVQSTLKAMAVIVERAVDPRRPEY
SRMSVSLFLALISSFIMGIALTFLIEHLDNTIKNHEEAESILGYQVMGLVPEIAPASARNLSTSDSPASFMDLKLVTMHD
PMHIAAEAFNSLRINMKFALTDRPQKTIIITSPIREAGKTLVASNLAISYARSGLKTLLVDVDLRKPMIHYVFNTDNIRG
LTNFFMDELTVDEVVVNSGIRNLDLITSGLLPDNPVELLDSRIFDQIIHALSTKYDHVIFDCPPLLGFPDSLLIASKMDV
VLYLVSLRNTKVQQARAGLKLLHNAEAAVVGLLCNRVKEDELGGYYYRYS
© 1998-2019