BYKdb

Dataset for cluster tadcd of phylum candidatus-wallbacteria

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bykdb|A0A2N1PQJ6 [Bacteria] Bacterial tyrosine kinase [Candidatus Wallbacteria][Candidatus Wallbacteria bacterium HGW-Wallbacteria-1] (length=696 residues).
MKEEIRKEFSLHDYFHVIEKRLVTVISTIVIVVGLVALFNWRQIPTYVTSGKVMVERARSVIQSLNVMQSLLLSLNNYIE
IIKSRKFLGKVVDKINETEPGIVTLEDLQDKISVSPVPGTDLLEIKGLGSDPKVLKMTVDTVIDFFVRDSEEVQGDVARG
NLEYLKNQLDNLEEQLRTSERDLREFQQREKVYSLPKEMEQFHQDLIRWQSEKTQLDMELELTEKAIESLTSELKTYAGM
TGLGGDKGSNSMESELSALEREYATASKLYKGKHPKLIEVRQKISAIKKSFQAIASGNYLAIGGTNDPIFNELKTQLLQK
KIDIFNMRVKRNSLEELIKDKSSSLENVPEKNLVYVRLSRKLSVTEKIYSSLLQKFNEAQIQASSMTSKARVVDYSREPK
EPIMPNKKLNLFIAFVASIITGIGFAFLKEHLDKSIKTSEEAKIIFERPVLGLVPQFRSSELKESRKVIEKSKIFISPSL
LTYSELNTMSSESFRTMRTNILYANDENQVKTLLLTNAQAAAGKSTVVANIAISFAQIDKRVLVVDADLRKPIMHKLFNL
DNSMGLTNALLGADIEGLISRTSIKNLDIMTSGPLPPNPSELLASSRMVEVIEICKANYDLVIFDSPPVIAVTDAAVIAS
KVDGVLYLVSLRRVARKQAEKGMELLENVNANVFGVVCNFVKERELGGYYYRYGYI
>gnl|bykdb|A0A2N1PV92 [Bacteria] Bacterial tyrosine kinase [Candidatus Wallbacteria][Candidatus Wallbacteria bacterium HGW-Wallbacteria-1] (length=762 residues).
MHEEEIDLKEYFRIVYKRKWIILLTVMAITVIGILISFALPPVYQGSTVLLVETNKQTMPMLMMEFADMGKGDAIQTQCE
IVKSRSVVEAAVRHLNLVNRPSEYNTFLKNILTYVGFGDKGWARSLIAFSESRNRKSDKNLKLPEAERFRKIVEDLQKNL
SVKTLKKTDLINITVDSESPSLASDLANTIADEYIKLSLNARRGEAKSVKDFVNNQLEIRESELRDLEKLLREFKEQKGI
VSLSEETKIDLEKEAEFGKALEEVRVEREALKIKVENIEKDLNEQEKLVVSSSTLTKNPILDQLKSQKIDLELKMERLIS
DGLTPNHPDIKKINAEISQTERKIVNEESKVFGSKVYTLNEIRRKLEGEYLESRALFKALEVKQSELEKICAQYDRKFEN
LPKLELEYLRIQRDIKVTEEIFVMLAKKKEESRISEAMEIGNIRIIDSSIIPIKPIKPKKALNAVISFILGIMLSLGLAF
TIEFFDTSFKSAEDVEKYLSLAVLGSIPFIKKDGLADKVVDEPGEGRAARLITELDPKSPVAETYRSLRTNIQFVNIDKK
IRTLLVTSAGPSEGKSTTISNLAVTYAQMGHRTLLVDCDLRKPMLHNIFHLERDRGLTNILVGGMNHKDAIVESGIDNLA
LLPTGPIPPNPSELLGSNKMSELLEILSREFAMILIDAPPILAVTDAAVLSPKLDGVLMVIHSEKTERESSKRAKILLDH
VGANIIGVVLNGVTAGSGHGYYYYYYYGPTGEKTRSGKRKEG
© 1998-2019