BYKdb

Dataset for cluster orphancd of phylum chlamydiae

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bykdb|A0A0E9F2I6 [Bacteria] Bacterial tyrosine kinase [Chlamydiae][Chlamydia trachomatis] (length=231 residues).
MPSLELAKNKEKTIKKTEEYYNALRTNIQLSGDNIKVIAITSVQSGEGKSTTSTNLAIAFARSGYNTLLIDADIRNSVMS
GIFKTRDKITGLTDYLAGATDLSNGLCETNIDNLFVIESGQVSPNPTALLQSKNFGIMIDILRNHYDYIVVDTPPIGLVI
DAAIIAQKCDASVLIVESGNVKRKTLQKAKEQLEQTGTPFLGVVLNKYDIQLEKYGSYGNYGNYGNYGKKK
>gnl|bykdb|A0A0E9FNN9 [Bacteria] Bacterial tyrosine kinase [Chlamydiae][Chlamydia trachomatis] (length=235 residues).
MAKKKRNQFDVDEIYRGLRTNIEFSQMDDKIQVINVVSTAPNEGKSTVSTNLARIMAAKYKNVLLIDCDLRNPSVHKLLH
ISNRSGLSNIMSQFKEETPVREYDGVQEHVFPNGETLSVITTGHKVPNPSEVLGSRRLGAFLNQARKSFGYIILDCPPIA
VSSDSIPVCNVSDGVLFVVDSKTADKRKVKSAINDVQRNGGNVFGIVLNKVEEFSDKHYGYGYGYGYGQEDKDNA
>gnl|bykdb|A0A0U0XQN3 [Bacteria] Bacterial tyrosine kinase [Chlamydiae][Chlamydia trachomatis] (length=261 residues).
MALFRKKRGTDDTIKHGAKLITVADPRSAVSEQFRTIRTNINFMAVDEEISTLAFTSANISEGKSTVTANVAITYAQAGR
KTLLIDADLRRPTLHSTFNVKNNTGLTTVLTSEADAINLNDVVEESGIDNLSILTSGPIPPNPAELIGSRRMETFIELVK
SHYDMVIIDLAPVLEVSDTQELASHLDGVVLVVRQGVTQKAGITRAVQMLKFAKARILGYVMNDIRAENGGYGYGYGYGY
GYGYGAEKKKGLFGRKKSDDQ
>gnl|bykdb|A0A1X6W5W9 [Bacteria] Bacterial tyrosine kinase [Chlamydiae][Chlamydia abortus] (length=230 residues).
MSRLDSKNRPIIADINKKSPISEAYRTLRTNIDFSSIDHQIQVIMVTSPGPGEGKSTTTANLATVYAQAEKKVLVIDADL
RKPTMHQTFVKTNRWGLTSVLAGQSPFAKVIAKTHIDNLDLLTSGPVPPNPSEMLSSKRLSALLEELRTQYDVILMDTPP
VLVVTDAQLIAAKSDGVLMVIDSGKVKRESALKAKASLELVQARMLGVVLNNVDQRRNEDSYYYYYGTQE
© 1998-2019