BYKdb

Dataset for cluster orphancd of phylum chlorobi

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bykdb|A0A136K9F1 [Bacteria] Bacterial tyrosine kinase [Chlorobi][Chlorobi bacterium OLB4] (length=752 residues).
MENNPTGNFINQYQLNNGTEDSGRDTLRDYLVILRMHWVAIALIFAAAMCVTIVYILTATNYYSTTTSIKINKPQESILS
SSIFTDFGGQQADRFIANEIDLMQTYPIRQKAAKFILDTLQTIEDKSALYYLYSDPENISQGFRTVESMAKLLSDIVAID
QKRGLDVVTLVAESPSPIEATIISNLYARAYSEYSLELSRKDLTNTISFLVKEKDRKMRDLNNAEASLEDFQKRSGLINL
DVQSEQLVNSISELDKAKGYAQVEITGNQTKYNELSAEIKKIDPQLVTFLEGELSGKYVTDLQAKISELELQKSIELSNT
QTQAVRDKIIGDYEQRLQPLRNSLNEKVMKLEEALYVQTPEERRELIQELLLAGVQRSESKSRLNIISGMLGKYEREFSL
LPSQALELAKIERQRLSSEKLYLLLEEKYQEALINQNARIGNVLITDPARVPSQPSKPKKTIVLLAGVLIGLGLGFGYAF
GRNYLDRSIKNPEEIEKKGVTILAWIPSIDTLKEFKGGSPDELVVLNKSTSTAAESFKALRTRVQFSKLEEKPLKSILVT
SSIPGEGKTFVSSNLASSFAIDNKKVLLLDCDLRKPRLHNVFAADRFPGLSDYLFSNVELEDIIRDSQNENLKFITAGTI
PPNPSELLGSVQMKKFLELLENKFDMIVIDSPPLISVTDSEILFAVTDGGILVAKAQKTPIDVVMKSANTVNNINPRNFL
GCVLNDFNVKGSYGYYYNYYYYYSKPEQKANA
>gnl|bykdb|A0A136N8H5 [Bacteria] Bacterial tyrosine kinase [Chlorobi][Chlorobi bacterium OLB5] (length=428 residues).
MKEGAQSNTPDEMRSLTYKYFETKIVNNQNKIKEGLLKNYMNKYQEKFNKLPAQSIEYANLERERLANEKVYLMLLEKYQ
EALINEESQPNNVKIIDYGKVPKAPSKPNRFLIITIGLLIGLGLGYGFALLRNILDVSVKSPEDLENIGISLIGWVPTFM
REPKAGRHTHTEQELVLAYNSDSVPAEAFRTLRTRLQFSKLEPEPIKTILITSSIPREGKTIISSNLAASFALSSRVLLL
DCDFRKPRMHNIFNMKRYPGLCDYLFGTVPIEDAVRETSFPNLHIMTCGTIPTNPAELIASKHMQTFLNMIKPKYDYILI
DSPPLATVTDAELLSSYVDGTVVVCLASKTRLDLLVNTIDTLNKINDTFIGVILNNFDYQATYGSYYKYYYYYYGSEKGK
EGASATNGKSSNGVNNNGNLKEKTIKPN
>gnl|bykdb|Q3B4U4 [Bacteria] Bacterial tyrosine kinase [Chlorobi][Chlorobium luteolum] (length=763 residues).
MIVLMVGTLVVAMLFYLFKTPEYHAVSVVMIKEDKQSNDLLQTILGPEAGMDINASKKDIALFKSMPIARLTIEQLERNL
KGKPLELFGSRDYTSPLMALFTKLQPSSIGNAFPSETDGLSKEELLRQRCLLLTKRIRVEPVKDTNMLNISVASPFADEA
ELLTNTICEVYRQADISRNSEKYAQANSYIAKSLVEQQSKVDEADRALSLFMTHNEIYEVSGNTQQLLDKLVEADAQYNT
IQAEYHTVGNTLRFLEQRLSESDKAIGSQIEQTVNSKLGAIMDEIRGLESSYVALLKQKGADDPAVRAAKVRLEEVKSRY
ATLQRSQIAGEIGYAGRAKKFGFDMVSEKLQIERKLNELQFRAGELSRIRQYYEQQLSSLPNKQQEYLKLERDRNVAGKT
YAELKQKFDETSIFLGSEVGGVSLIGAAFRPFFPESPSLLKSLLLGVLFGGMLAIGYAYIEEAMDGTLQDECLYDEIGLR
PLSVIPTVGSARNPAVPPSGSSRMLSHVGNSFGKLLPDASSRQSPSGREDAAQLIPLITDNLTSSFAESIRILRTSIQYS
RQGSPPQSILISGTAMWEGKSTVCLNLGMAYALVGKKTLIIDCDLRRPSQHVKLNCLRGPGLTDYLLSSDGDSCVPNIQN
TRMENLFLLSAGLNVSGSSELLASKKMQGLLSVMRKRFDCILLDCPPFFLSDASQISALTDGVVLVSRLQYTERKMLQSI
IADPAVKDALLGVALIATPELSRKGYLGKYGNGVYEEDPLLLT
© 1998-2019