BYKdb

Dataset for cluster tadcd of phylum chlorobi

[Download (right click)] [Alignment] [Repertoires]

19 sequence(s)

>gnl|bykdb|A0A081SFU7 [Bacteria] Bacterial tyrosine kinase [Chlorobi][Candidatus Thermochlorobacteriaceae bacterium GBChlB] (length=801 residues).
MENSKENGYAANGGASKFYRQLQQAQLEQEEDFGVVFYNYLRALLKGKWVILFLFLVSTTIGILVSRSQKNIYEGVTSVL
VKNTKSSASVVVSLDLQERESYADEIEILKSRTVAEEVAYKLLQIVFKDETTKKDTLDLIREEDGKISNIDAIAARVRSG
ISIAQPKATSTSILLISFKSFDPFEAATVSRAIASVYQERKKKSSSNTARILREFLEDQLAQKKRQLAESERTLQSYMEE
NRVVSLNEEATRMIGRYSQAQAQLDETGVLLNALTASLKQYNEELAALQPKLSNSAVQASIEPYTKQFQQEIARLEFERD
KVLADPGSQTNLNVQERIRQYEDQIESYKKKLQQAFDRQVKQGLANVDNSQYFKEIYRKKLETELQIIGLQTKLKAYKDL
AQDYDRAFLKTPGKNIEFARLQRNNQTLQDLYSLLEKRYQEALIAEEQIPSGVEVIDLAVPNLVPVGPNRATNVILGVVV
GLVLGVGVVMLLQFLDQSVHTPEQAEKLGTLLATIPVIETFDESVRGKAGTEVKAEDETDLEYKKIASHLVTHFDPKSSV
SESYRALRTSILFSSSFVGNGEKEDGNVFAVTSASPKEGKSTTISNLAITIAQGGQKVLLIDADLRRPVVHAIFGYNKEP
GITNHLVGRAALDDITRSSAIPNLDIITSGTIPPNPSELLGSDRAREFITQVRQRYDTILFDTPPVLAVTDAQVLATQVD
GIMIVIAAGQTQVELAKRARQAVARVDGRFLGFILNNFDVANSYGSYYKYYRYYNYYYESKGTPKIKKSFIEQLSDRFIG
K
>gnl|bykdb|A0A136K9M8 [Bacteria] Bacterial tyrosine kinase [Chlorobi][Chlorobi bacterium OLB4] (length=717 residues).
MDWIYVLLIFLGVLLTTVFYVLNARNIYESTTVIKITKPQGSILTSSPIPEFQDFGFLSDRYISNEIEVLKSFSIRSLTA
KTLLDSAEANGNISSFYHLLNDPDDLSKGLKNEFEIAKMLKQVVQVVQKKGLDVVDLSVESPSPYEAAIICNAYAKTYSD
YSLEFSRLDLTNIINYLNTEKEKKFRDLKLSEAALEDFQQREGVVQLDVQADELVRSLSAIDKEKTMTSIELAANEKKYS
ELSQKIDEIDPKLKVYLESEISKGYLPELQKQIAQLEIERELQLSIISNDRVRQKAKEEYDRKISSLQESLDKNVKSLDA
GMYVMTPEERREMVWELVKTGVMVNSDRIKNRVLGNYVNEYETRFNKLPSQIIEYARLERDKLTNEKIYILLEEKYQEAL
INQNARIGNVTIIDPAFESLLPSKPNRVFLLVSGAVFGLILGIGFVITRNYLDKSIKTPDDLENNGYSILAWIPSIDIKE
KSDLSSPDEFIVASDAKSSISEAFKVLRTRVQYAKIEEEPLKTILITSTIPGEGKTTVAVNLAGSFALDGKNVLLIDCDL
RKPRVHSVMGVNRYPGLTDLLFGNNDLSEVIRPTKFDNMHFIPSGTIPPNPSELLGSLQMKKTLENLKTQYDIIVLDSPP
SISVTDSEILFKITDGTLLVVQSLKTPMDAFSKVYDRFNSFSEPNLLGTVLNNFSYKRNYGYYYNYYYYYSSGEKPN
>gnl|bykdb|A0A136PFK4 [Bacteria] Bacterial tyrosine kinase [Chlorobi][Chlorobi bacterium OLB7] (length=891 residues).
MPCSGGWRLRTVVEQARTLRPRSNPRFPFSPILLPGYIALGAFFRMASNNNYPYGRDGANGSQLPSRSQQFSPARPQPYN
TDMVRLQRTLRDVDEKKNRLQWLDYVGLLWRGKWIILACLLVMGSLAAWYTYSLPFIYESSLQILVNEKDQSIDLLNNRN
YWSNTDRELKKELQILTSRPIYEKAAQRLLTLRYTDTIRRKTVLPMLVAVEAKLGTASHNQSSQDRHARLIDEVVESLHK
MIEVKPSKDADIIQVITRAGDPLEAALVANTFAEVYIKDNKEQNSRKATQIRQFVADKMEKVRDSLAVIELRLKDYLESK
NILGLDIQAHDLVQAKSKLENDASQTQIQISTLSRKLQEARQQYQAVDSGFATEFASGDWAYASQLQTQIASLKTQRGLM
LSVPFDGASKLAYDQKVKTLTEQMEMLESQLAPVIARLKNSNVGTLLSTTKQGELPTAPLGNLRQQIFEDEIALQALRAQ
GAAINAARAQVNAQMSAVPQQQMDVGRLVREQSASAKMYEDMLDEYNKKVLEEQSVTSTARIFEDAQPVLKPVSPNRTAN
ILTGCFLGLAIGVGIALLLAYSDTTVHSPDDLEKHGFTVLTAIPLIPEGMLNYEIISNDPLSVRLNGRASSHLITHIQPK
APISESYRSLRTAVQFAAIEEPVRKILVASSVPQEGKSTTSTNLAITLAQSGARTLLIDCDLRRPTQNSVFGFPREPGLV
NCLIGMARLDEAIRPSGIPNLDILSSGSIPPNPSELIGSRRMRELLNDLEKDYDMILIDSPPIGAVTDAMILSTMTDTTI
LVVRAHKTKMEFLEKSREGLERVNTPLLGVVLNDFDVSQTYGSASYKYYRYYRYYNYYGGMEEEESSRRKDRRAKAIANG
EATEKQPRLHG
>gnl|bykdb|A0A1B1Q171 [Bacteria] Bacterial tyrosine kinase [Chlorobi][Prosthecochloris sp. CIB 2401] (length=801 residues).
MTPDHNNQFEQEIDIKELLFTLWHNRLVIGAVTVAALLIVFLMYLGSTPEYRSTSMVLIKSSKSSPAELMTPFESMTGSQ
LQNDIELIKSFPLAEEVVRSLYRQTERDSLELFRERRYISPLARFFGAGNGDEPSVAEKKRKIPLDLKLRSYASRLSSRV
TVENGRDTDILYVSVSSPFSHEAALLTNVLCKTYMQKDIEWNADQAMMIKDFVSEQLAVQEKEIAAVESQLSSYMKQENI
YELTGNAQNLLNRLVEAESRYNDTRSEINILTKRQEYLVEKLSEEERAISARIAQNVDRQSSELKRRIMEEERTLIEMER
LGNASGEAYDIRKQQLELLRRRLEESTGNIIAGELAFMSKARQYQFDLISEQLQADVRLAELTYVADEYLKSKNYYEAQL
NKLPQKQLNYARLQRDREVLNNTYTFLRNKLEESRIKIAAESGKVVIVGAGYPPLSPVAPDLKKNVLIGLILGLGLGGAL
VFVREMLDNSLRDNEFLEQHGYVPLAFIPFIADKARGMQRKQSGKKAKRVGGLIEKLLVQLSPKKEHERLALHTQATADE
PLLMNNSLDAGFSESFRDLRTNITFSRADNPLKTIMVSGTEMSEGKSTVAGNLGLAFALTGKRVLLLDCDLRRPSLHRVF
KVDRGPGLTDYLAGQQDDLKRLTRQVLHENLHLIPAGAKTPNPNELLGSQKMKELIRQLEAEWDIVILDTPPLLMLSDAT
VLSRHVDGILMVARMGYTNKNLLRDVQKTEHIRKNILGVAIIGPSVQDKYNYKYGRYYGRYSYKGYYSRESYQKYLDTSS
T
>gnl|bykdb|A0A1D8D4L1 [Bacteria] Bacterial tyrosine kinase [Chlorobi][Chlorobaculum limnaeum] (length=813 residues).
MDYKSHQAVTGNQVQVQDDKEITLAEIFQIIARRKIGIGIIVSLSLLVSILFYYSQTPEYRAVSVLMINQKNDSQGLVEA
VLGGGPAADSKMAQKDVELLQSLPVADMTVRALWNSSRRDSLEFFGYRPYISPIRRLVDWIAPVKPLNASDRDIIENTPA
FDTMMRFYAIKLSKRIKVEGSRDSSVLRVSVASPFSDEATFLSNMLCSVYQKSDIQRNSEKYIQSNQFVAEMLQEQKDMM
ANADAALSKFMTENQMYEVSGNTGGLLAKLIEFEGRYNDIMAEYNIVSNSRNFLENQLTQADREMSDRIARNVNAQLGAI
RDEIHSKESAYISLLREKTVDDPEVKGKKQELEQAKARYDQISRSKIAGQIEYIGKAQKYRYDLISEKLQLDQKLNTLKF
SAGEYAKVKQKYDGQLAQLPEKEQNFVRLQRDRDVVSKTYLFLKEKLDETRILIGSEVGSVTMIGSAFKPFMPEKPELVK
NILAGLVIGIVLAGLFTYGAEMIYDTVNEEMQFFKSLGLNIWGVIPFINSSSDYSGTYHEAKRKIEKKSVMLLDIFKKKE
EQINNPQSEVSGDIKNNPLMTDKLNSSFAESFRTLRTNLNFSRIDKPFKTILISGCSIGEGKSTVSTNLALAWAIADKKT
LLIDADLRRPSQHTILGKKRSPGLTDCLIDDGKNDNDKYFQKTHVENLFLMTAGTPVPNPNELLGSEKMHLFLKKISDQF
DRVVIDSPPIFISDAAQLVNEVDGVLITARLHYSSRAPLKQYASDNFLHSKIIGVAIIDKPRPSKTRYGYGEGKYGYGRS
GYGRYSSVYPEKL
>gnl|bykdb|A0A1W6HT77 [Bacteria] Bacterial tyrosine kinase [Chlorobi][Prosthecochloris sp. HL-130-GSB] (length=808 residues).
MQDPTPHSQSGNQFEQEINIQELLQVLWKNKLIIAAVTGIVVFMVLIYHFSATPEYRSTSIVLIKNDKGVVTGEMINPFE
SLTGFELQNDIELIKSFPLAEEVVRDLYQQQDRDSLQLFGERRYVSPLKDLFGGLSFGFGGKEEEEVDFDLKMRTYAEAL
KKRVSVSNSRDTDILQVSVSSPFPDEAALLTNAICQAYMRKDIEWNADQALSVKDFVSEQLAQQQREIAAVENQLSAYMK
NQNIYELTGNAEKLLEKLVEAESRYNDAQSEITILKKRQDFLVQKLSAEEKALSDKIASNVDRQASDLKNRIKQEEKALI
DIATQNGTSDPSYVAKRQEVDVLKQRLQELTRNMIAGELAFSSKARQFQFDLISEQLQTDVRLAELDYIAQEYLRAKNYY
ESQLNRLPQKQLNYARLQRDREVLNNTYTFLKEKLEESRIKIASEVGKVVIVGAAFPPVQPVAPDLKKNLLIGLILGLGL
GGALVFVREMLDHSLKDDAFLEDHGFVPLAAVPYVAREGETLQGSLQKSVDDVRKLLPSFNGNGTSGKHQKQNSQGKPVA
SSSKRPPLLMADSLSSPFAEAFRDLRTNIIFSQADRKVKSILVTGTEISEGKSTVCSNLAFAFALTGKRVLIVDCDMRRP
SQHRMLNTLRMPGLSDYLAGVETDLEEILQPTMHENLWLLPSGSTTPSPNELLGSNKMTELVEKLEEEWDYVILDTPPVL
LLSDATLLSRAADGILMVVRMGYTNKNLLKEVQKLDYLKKTMLGVAIIGPSEKSGYYKYGRYYGRYGYKGYYSYKSYSSY
LEPEKNKG
>gnl|bykdb|A0A222SG44 [Bacteria] Bacterial tyrosine kinase [Chlorobi][Prosthecochloris sp. GSB1] (length=779 residues).
MLEMKDAGSQLNVQELLRLAWKNRYVIGLITGLALVIALFIYLSARPVYSATATIMLKSSQKEELVGELSGSERVGEMQV
QNHLQLLASVPLAEEVIRSLVAGGAQDSLELFGNRPYKTKIQGFLDGMFGVSEPSRQPVQAGEILDNIRPYAELLRSRLS
VLNERGTDIITVTVSSPFPREAALLANIVGRTYQKQDVAWNVEQARNVNQFVVDQLREQQKKVAEVEAAVSRYMKQENIY
EVTGGAEELQERLADADARYNEVQAEARILRQRLAFLRRKLSEDEKAYSERVAETMAPRLKAVQDMIRKEESVLSELIVQ
RGPEDTAVRTKQEQIRNMKAQLDQITRTRIAGEIAYSGRSQRYQFGLIAEQLQTDARLAELEFSASELNRLRNYYQAQLR
SLPQKQLELARLQRDRDVVNRTYSFLRERLDESGIEIASEVGQVVVIGDAHPPDSPVSPNLGMNLFLGLFSGLGLSALLL
ISQNLLDDTIRDDSFLEDNGFVELARIPFTGSGETHEAAVPFGIAKLFSRFTNRKNADVELHAGKSGAAPLLISDYPSTA
FAESFRDLRTNIMFSRADNPVNSMLVTGTSISEGKSTVCSNLALSYSMIGKKVLVIDCDLRRPVQHQYLQTSRQPGVTDY
LAGASDEIAEEFIQDAGYENLFLLAAGSPVPNPNELLFSNKMTQLIERLKARFDIVLLDSPPVLLLSDAAVLSRSVDGVV
VVAKTGYTSKDQFRELGKVDYLRERMLGVALIGSVGQKKYGKYGYDYKALDYYGAGAKI
>gnl|bykdb|A0A317T3L6 [Bacteria] Bacterial tyrosine kinase [Chlorobi][Prosthecochloris sp. V1] (length=798 residues).
MADNENQIEQEINIQELLQILWKNRVLIGVVTGLALVLVLLYHFSATPEYRSTSVVLIKTDKGGVGEMINPFESMTGFEL
QNDIELIKSFPLAEEVVRDLAARKDRDSLQLFGERRYVSPIGALFSGLQFGMGKEEAADYDLLMREYAKTLQKRISVGNA
RDTDILKVSVSSPFPDEAALLTNAICQSYMRKDIEWNADQAMSVKEFVSEQLASQQREIAAVEDQLSSYMKQQNIYELTG
NAEKLLEKLVEAESRYNDAQAEYNILKNRQDFLVQKLSEEEKALSAKIAKNVDQQSKELKSRIKQEEKTLITLAGESGAE
SSSYIAKKQQLDVLKQRLQELTRNMIAGELAFTSKARQYQFDLISEQLQTDVRLAELSYIAQEYQRSKNYYESQLNRLPQ
KQLNYARLQRDREVLNNTYTFLKEKLEESRIKIASEVGKVVIVGAAFPPIDPVAPDLKKNLLIGLILGLGLGGAMVFVRE
MLDHSLKDDTFLEDHGYTPLAAIPYVEDGNGKDLPKTLKGSLEQLTGYLPKYGDNGKSSKYIKTNSQGKIVPSTHDRKPL
LMADSLSSPFAESFRDLRTNIVFSQADRPLKSILVTGTEISEGKSTVCGNLAYAFALNGSRVLLIDCDLRRPSQHRLYSC
KKVPGLSDYLAGLEVDAEALIQPTMHENLYILPAGNKTPSPNELLGSNKMNELIKRFEDEWDYVILDTPPLLLLSDTTLI
SRAADGILMVVRMGYTNRNLLKEVQKLDYLKHRLLGVAIVGPSEKIGYGSYGRYYGRYGYKGYYSYKSYSSYLDEQRN
>gnl|bykdb|A0A369RAQ9 [Bacteria] Bacterial tyrosine kinase [Chlorobi][Prosthecochloris sp. ZM] (length=805 residues).
MTNNDPNQFEQEINIQELLQVLWNNKLIIGAVTGLVVLLVLLYHFSATPEYRSTSMVLIKQDKGGAMGEMINPFGSLTGF
DLQNDIELVKSFPLAEEVVRNLYTKKDRDTLQIFGERNYVSPIGGLFGWLSFGGAAEKDSVDYDVQMRKYAAALQERIKV
GNSRDTDILNVSVSSPFPEEAALLTNAICQAYMRKDIEWNADQAMSVKEFVGEQLAQQQREISSVENKLSSYMKNQNIYE
LTGNAEKLLEKLVEAESRYNDAQAEYNILKKRQDFLVQKLSDEEKQISARIAKNVDQQSIDLKSRIKKEEKALIELANST
GTEDGSYIAKKQQLDVLKQRLQELTRNMIAGELSYTSRARQFQFDLISEQLQTDLRMAELGYVAQEYLRAKNYYESQLNR
LPQKQLNYARLQRDREVLNNTYTFLKEKLEESRIKIASEVGKVVIVGAAYPELAPVAPSLKKNLLIGLILGLGLGGALVF
VREMLDHSLKDDSFLEDHGFTPLAAIPFVDSDGGGSMQASMKKSLKDFASVFPFLSGNTDGKKDQHQKKNSYGKPVESTR
NKQPLLIADSLSSPFAESFRDLRTNITFSQADRTLKSILVTGTEISEGKSTVCTNLAFAFALTGKKVLIVDCDLRRPSQH
RNLNTMRMPGLSDYLAGQEKDINAVLQPTMHENLSVLPAGSQTPSPNELLGSNKMTELVKKLEEEWDYVILDTPPVLLLS
DATLLSRTADGILMVVRMGYTNKNLLKEVQKLDYLKHRLLGVAIIGPSDKSGYSNYGRYYGRYGYKGYYSYKSYNAYLEP
EKSNG
>gnl|bykdb|A0A395LXF8 [Bacteria] Bacterial tyrosine kinase [Chlorobi][Candidatus Thermochlorobacter aerophilum] (length=804 residues).
MQNIKANGYRAGGEVPMPDHRTLRQALQEDDDNADLYYRYLRALLRGKWIILILFLTSVLVGYLINVSQPDIYEGVTTAL
VNNTRSNASVIISLDVMQQRGESNVDDIEILKSRTVSEEVAYKLLQWVYKNPSEKKDTLSIILTADGKIASVDEIAARVR
MAMFVVPAKVPGSNIITIGFRAFDPYEAATVSRAITEVFQERKRKSANNAARMLRQFIEDQLVQKKRQLAESERALQAYM
EQNRIVALNEEATRMIQRYSQAVAQMDEAAVMLSALNASLKAYNEELAALQPKLSNSAVQAAIDPYAKQFQAEIARLEFE
RDKALADPGIQFNISAQERVKQYEDQIEAYKKKLQQAYDRQVKQGLANTNNTEYFREIYKKKLDTELQIVAVQTRLKAYK
ELAEEYDKAFLKTPGKNIEFARLQRNNKILEELFSLLEKRYQEALIAEEQVPSGVEVIDWAVPNPIPVGPNRRNNMILSV
VIGLLAGVGVTLVLQFLDQNIHTPEQAEKLGMLLTTIPVIETYDETVRDKASAGDKVAEDPNAEYKKIASHLVTHLDPKS
AVSEAYRSLRTAILFSSASPTKENGKAGKVYLITSASPKEGKSTTVANLAITLGQGGQKTLLIDADLRRPVIHSVFGYNK
EPGITNYLVGRASVEEITRITPIPNLSLITSGTIPPNPSELLGSPRMREFLDQMREKYDMILFDSPPVMAVTDAQVLSQH
ADGVIVVLAAGQTQIELAKRTKQALLKVDAPIIGYVLNNFDVTKAYGSYYKYYRYYNYYYESKATPKKKNFFEALSDRLS
GIKS
>gnl|bykdb|A0A422HIT8 [Bacteria] Bacterial tyrosine kinase [Chlorobi][Prosthecochloris sp. ZM_2] (length=813 residues).
MQDPTPQSQQGNQFEQEINIQELLQVLWKNKLIIGAVTGLVVVLVLLYHFSATPEYRSTSVVLIKSDKGAAAMGEMINPF
ESMTGFELQNDIELIKSFPLAEEVVRDLFRKTDRDSLQLFGERRYVSPLQGLFGGLSFGSASAEEEPVDYDVQMREYAAA
LQKRIEVNNARDTDILKVSVSSPFPDEAALLTNAICEAYMRKDIEWNADQAMSVKEFVGEQLSQQQQEIAEVEDRLSAYM
KNQNIYELTGNAENLLEKLVEAESRYNDAQSEITILKKRQDFLVQKLSVEEKALSDKIAQNIDRQASDLKDRIKSEEKEL
ISLANDAGTNSPQYASKKQQLDMLKQRLQELTRNMIAGELAFSSKARQFQFDLISEQLQTDVRLAELQYIAQEYLRAKNY
YENQLNKLPQKQLNYARLQRDREVLNNTYTFLKEKLEESRIKIASEVGKVVIVGAGYPPTSPVAPDLKKNLLIGLILGLG
LGGALVFVREMLDHSLKDDTFLEDHGFTPLAAIPYVPREGETLQGSFRKSMDDITRALPSLNLNGNGKNGTSKHKKVDSQ
GKSVPSSSKKPPLMMADSLSSPFAESFRDLRTNITFSQADKTVKSILVTGTEISEGKSTVCSNLAFAFALTGKKVLVIDC
DLRRPSQHRMLNTLRMPGLSDYLAGVEKDLDVLLQPTMHENLWLLPAGNSTPSPNELLGSRKMTDLVKELEEKWDYVILD
TPPVLLLSDAALISRSADGILMVVRMGYTNKNLLKEVQKLDYLRNNMLGVAIIGPSEKSSYYKYGRYYGRYGYKGYYTYK
SYSSYLEPEKTKG
>gnl|bykdb|A1BJQ6 [Bacteria] Bacterial tyrosine kinase [Chlorobi][Chlorobium phaeobacteroides] (length=814 residues).
MKVEQQTPIKQQEEIERGEREISLEEIFKIVLRRKYGIILVMALSLFAAIFYHYTETPEYHAVAVMMINDNKEPTDLLAT
VLGSGAAVDNKAVKKDVELIKSMPIAMLAVGELYKSARRDSLEFFEKRIYRSPVSRFFSQLNVFTPLNADQNPPYRALSD
EELRRYAVKLNSRITVEAARETNVLKVSVASPFADEAAYLSNTLCRVYREADIDRNSEKYAQANKFIAEMLGDQQKKVGD
ADYALSKYMEANEIYELTGNTQQLLNKLVEADAKFKSIQAEYNIANNGLAFLEKKLSESDRAISSQIAKNVSNQLGSIMD
EIKGLESEYMQLVQEKGIDNADVKAKRQQLEVVKTRYEQLSRSKIAGEIGYAGKAQKFSFDMVSEKLQIQRKLNELSFSS
REFSRLKEYYEGLLGQLPEKQQDYIKLQRDREVVGKTYLYLKEKLDETRIMLGSEVGGVSVIGSAFVPFKPEKPNLKKNM
LMGLVLGGLLAVLFTYTAELVDDSVKDDSFFRDIGLATLSIIPLVPGEKNAVPSREVSGFNRILYNTSKAFREKVLLSGN
GAGKRKGAQPKVETPMPMITDSLSSSFAESFRTLRTALDYSRVESPLKSLLISGTAMSEGKSTVCSNLAMAYALVGKKTI
IVDCDFRRASQHKKFSVKREKGLTDYLFGEDRSIDESYFQATHVDNLFLLSSGKKVPNPNELLGSAKMQDLIRELETKFD
KVIIDSPPLFLSDAAQLAHSIDGILLVSRLQFTSRKPIQDFVSDHFMRPLLLGVALIGSRQGTGYGYGKYGYGKYGYGKY
GYGKYQYGQYEEQA
>gnl|bykdb|A4SF30 [Bacteria] Bacterial tyrosine kinase [Chlorobi][Chlorobium phaeovibrioides] (length=808 residues).
MKNESRLLGSGNNDGSRHTEYAAHHSAARREITVDELFRIIRRRRFGILVLMGASLVLTMLVYVLQKPEYHAVSVVMIKD
DKRPSDLLQAVLGPDASVDMNASKKDIALIKSMPIAELTIKELERSRNGKALEIFGNKTYQSPVIALVSHIVPFKVGNAG
PRKDRSPEEILRRRALLLTKRIRVTPVKDTNMLKVSVASPFSNEAELLTNTLCSVYREADIERNSEKYAQANSFIAKSLV
DQKQKLDEADRSLSGYMSRNEIYEVSGNTQQLLNKMVDSDAQYNAVQAEYHTVANTLNFLEKKLSESDKAISSQIEQTVN
SQLSSIMDKIHGLENSYVALLKQKGSDEPAVKAKKQELDEVKARYEKLQRSSIAGEIGYAGRARKFGFDMVSEKLQIERK
LNELKFRAGEFARIRQYYESQLSNLPYKQQAYLKLERDRNVASKTYEELKQKFDETRIFLGSEVGGVSIIGSAFRPFTPE
KPSLPVNLLLGVLFGGLLAIGYTYIEESVDGTLQDDFFFDEIGVRPLAYIPTVGPYGYPALPGYGKGKLMESTGRTIRKL
LPGSSEGDGENSVTVTVLPAPLICDNLDSPFAESIRMLRTSIQYSIPGKPPQSILISGTAMWEGKSTVCVNLGMAYALVG
KKTLIIDCDLRRPSQHIKLNCQRGPGLTDFLNSENDEFSAPHIQTTQVDNLFLLSAGAKVSGPSELLASDDMQRLLAVMK
TRFDCILLDCSPFFLSDASQLADWVDGIVMVSRLQYTGRKMLQNIISDPYLKARLLGVALISTTEMSKQGYYGKYGYAEY
EEESQLLS
>gnl|bykdb|B3EF76 [Bacteria] Bacterial tyrosine kinase [Chlorobi][Chlorobium limicola] (length=795 residues).
MPEQNNFEQEINIQELLRLLWGRKYLILAVTAASLALALLFRYSATPEFRSTAVVMIKDSNGSEGDVLAPMLAVMPSSFI
DPMKNDIELMSSLPIAEKAVEQLYRSPMRDSLELFGKRRYISPIDRLLAFAGLQGFSEKDAEEVPASQKETMRNFAENLK
GRITIDNPKETNVLHVTVSSPFPEEAAVLSNALCRAYQQKDIEWNSEQAKSVNQFVEEQLGEQQKKVATVENNLSGYMEK
QDIYELTGNADQLLKKLIDIDARYNEIMAERNILAKRLDFIRKKLSGEEKALSANIAESVGSQLRAVQNRIKAEEADYMA
LLQQKGAASPEVKARRQQIDQMKSQLDQVVRGKIAGELAYSGRAQKFQFDLISEQLQTDLRLAELNYSAQEFGKLKNYYE
SQLNALPDKQLNYARLQRDREVVNSTYTFLKQKFEESRIKIASEVGRVVIVGPAYPPKLRESPDTKKILLVGLVLGLGLG
GALVFVLEMRDHSVKEEQFFDDHGFVTLARIPFVDKAEFTLADGMKKAVGQLLVTIDPGKGNGKSNGNGRHPGQGSADGA
PLLITDKLSSPFSESFRDLRTNLTFARAGTPLRSVLVTGTAVSEGKSTICANLGLAFALTGKRVLIVDCDLRRPSQHKLL
GSSKAPGLSNYLAGQEADMSKLIQPTLNENLFLLPAGAAVPNPNELIGSQKMSETVELLEFRYDMVIIDSPPLLLISDAA
LLSQSVDGILLAARLEYTNKKLLQEVQKISYIKPQLLGVALIGSSSRDRYGYDRYGYKGQYKYKTYSHYIDTPES
>gnl|bykdb|B3EME9 [Bacteria] Bacterial tyrosine kinase [Chlorobi][Chlorobium phaeobacteroides] (length=803 residues).
MPNNDPNQFEQEINIQELLQVLWQNRLIIGAVTGVVLVLVMLYHFSATPEYRSTSVVLIKSDKGGMSEMINPFESMTGFE
LQNDIELVKSFPLAEEVVRELYARKDRDSLQLFGERRYISPIGHLFSWMRFGTREKEEKEYDIRMREYATALQKRISVSN
SRDTDILQVSVSSPFPDEAALLTNAICRSYMRKDIEWNADQAMSVKEFVSDQLASQQKEIGEVENQLSSYMKKQNIYELT
GNAEKLLEKLVEAESRYNDAQAECNILKNRQDYLINKLSAEEKALSAKIAKNVDQQSRELKERIKQEEKQLIAMAGEAGT
QDAGYLAKKQQLDMFKQRLQELTSNTIAGELAFASKARQYQFDLISEQLQTDVRLAELKYIAQEFQRSKNYYESQLNRLP
QKQLNYARLQRDREVLNNTYTFLKEKLEESRIKIASEVGKVVIVGAAFPPIEPVAPDLKKNLLIGLILGLGLGGALVFVR
EMLDHSLKDDAFLEDHGYTPLAAIPYVGDENESDLQDSLKKSIRQLSDSIPGFGASSNGKDASHVKMNSSGKSVPSTRES
KPRLMADSLASPFAEAFRDLRTNLVFSRADRKLKSILVTGTEISEGKSTVCANLAFAFALSGNRVLIVDCDLRRPSQHRI
YSCKKTPGLSDYLAGVEDDADALIQSTMHENLFILPAGNSTPSPNELLGSNKMTGLVERLEEEWDYVILDTPPMMLLSDA
ALISRAADGILMVVRMGYTNRNLLKEVQKLDHIRKQMLGVAIIGPSEKAGYGKYGRYYGRYGYKGYYSYKTYSSYMEPEK
TKG
>gnl|bykdb|B3QVI2 [Bacteria] Bacterial tyrosine kinase [Chlorobi][Chloroherpeton thalassium] (length=796 residues).
MSKDFLNGNQAVATNSGSNYPVFQRESDFLELEDDFDFKRIFSLLLRYKWLILSSVIFSTLISALAIYFSLPIYKSEGTM
LVQESSGKLGRGAGSDLSNLLASTYGVGMGSTIANELFVLQSRKMSYKLAKVLLQERWQKGGELYPLLWEKYPDDSTIVS
EDVLAQRIRKQLQVAQADKSADVINISFESPSPFEASRMVDLTMDTYSTLSTEQNRLMARSALEFLENEKQRVENNLRVT
EEQLRDFMNQKGLIQIDAQTTDVIKILTDLESKSQEIKVQRVAIDAALQNYKQQLNSFKPGIAEQYTDAYGATLSRCQYR
LAELETERLLILSRNPGLKQKEENSPELKKIQDEISVLRSEIKVITSKMLSDDQDQLSSILSATNGDIAAEILLTKRKLL
ELDIQRRQYDAQSAVLEQELEKKKLFFEKIPDNMIILARLKRNVDVNEKLYLTISERYAETALWEQTQFGLGRPIDYGYL
PEAPIKPKKQIFLLVGFLFGLAGAVTFIYVKESLNTGIDGAEKLKKKQYPLLAVIPDMEEVIKESYDEEKYITVKGSKIS
TRLVSFLDVISPIAESFRRLQSNVIYSHPDEKLKLIVVTSPGKGEGKTTVISNFAVALAESGKKIILVDTDFRRPYVHKM
FGLDQQPGLTETLFDGVPVEEVIMKSIVPNIDILTTGKRPSNPAAVNQSLKLRELLQSLKKKYDHVLVDTAPFGITTDAA
SIMKLTNGVILVVRFGQTSETELDQTVENLRQVNANIIGTVLSAFDYRKTSDHYYNSGYYKYSYKRYTDYHEEKEV
>gnl|bykdb|B3QXQ6 [Bacteria] Bacterial tyrosine kinase [Chlorobi][Chloroherpeton thalassium] (length=798 residues).
MSSFNGNMKDGSYYSKSKTMPFQVEEEDISVLIFNYLRALSRGKWVILITFVATVLISVIYSFRQKDIYEGITSVLVRDN
TRQSSVIVNFSVTDRRNLANEIEILKSRTLAEQVAYKLLQIIYRDPIRKTDTLDIIKGAGSAKIARVDVIAARIMGAVSV
EQVDKADLLLIKFRSHDPEEAAVVSKAIAESYEERSMKYTRNTARSVRQFLEDQLAQKRRLLYESEERLRRFMEDNRVIS
LDEEGRRMIQRYSLAMSSAEEAEVMVKMLQSSLKAYEQEIRAMTPKLSNSAVQATIDPYTKLFQEEIAKLEVERDKILTD
PASRYNVNVQERLQEYNDKIESYKKRLQQSFERQVKQGLSNVNASEAYQELFKNKLNTELELIEQKSKFEAYKKLAEEYD
KAFLKSPGVNVEFGRLERKTKSAQELYLLLEKKYQEALIAEEQVPKMVEVIDWAITPGAPIAPNRKANILVGVVIGLTFG
VGIVMLIQFLDKTVYTPEQAERLGPLLATIPMMESFDDDVRDKSGASVKVIEGPDAEYKKIASHLVTHFDPKSSVSEAYR
TLRTNILFSGVHDFNGSKKQGLIYIITSSSPKEGKSTTISNLAITIAQGGQKVLLIDTDLRRPIIHSIFGYNKEPGITNY
LVGRAQIDDIVRNSPIQNLDIITSGTIPPNPSELIGTQRMKDMLQLFRERYDIVLLDSPPIIAVTDPQVLAKVADGMILV
LLSGQTQIELAKRSIDAIRKVNAKIIGFVLNSFDFNNSYGSYYKYYRYYNYYYEPKGKNKNVKQGFLTKIIERLVDKV
>gnl|bykdb|B4S3Z6 [Bacteria] Bacterial tyrosine kinase [Chlorobi][Prosthecochloris aestuarii] (length=803 residues).
MTNNDPNQFEQEINIQELLQVLWNNKLIIGAVTGLVVMLVLLYHFSATPEYRSTSMVLIKQDKGGAMGEMINPFGSLTGF
DLQNDIELVKSFPLAEEVVRNLYTKKDRDTLQLFGERNYVSPIGGLFGWLSFGGAAEKDSVDYDVQMRKYAAALQERIKV
GNSRDTDILNVSVSSPFPEEAALLTNAICQAYMRKDIEWNADQAMSVKEFVGEQLAQQQREISSVENKLSSYMKNQNIYE
LTGNAEKLLEKLVEAESRYNDAQAEYNILKKRQDFLVQKLSDEEKQISARIAKNVDQQSIDLKSRIKKEEKALIELANST
GTEDGSYIAKKQQLDVLKQRLQELTRNMIAGELSYTSRARQFQFDLISEQLQTDLRMAELGYVAQEYLRAKNYYESQLNR
LPQKQLNYARLQRDREVLNNTYTFLKEKLEESRIKIASEVGKVVIVGAAYPELAPVAPSLKKNLLIGLILGLGLGGALVF
VREMLDHSLKDDSFLEDHGFTPLAAIPFVDSDGGGSMQASMKKSLKDFASVFPFLSGNTDGKKDQHQKKNSYGKPVESTR
NKQPLLIADSLSSAFAESFRDLRTNITFSQADRTLKSILVTGTEISEGKSTVCTNLAFAFALTGKKVLIVDCDLRRPSQH
RNLNTMRMPGLSDYLAGQEKDINAVLQPTMHENLSVLPAGSQTPSPNELLGSNKMTELVKKLEEEWDYVILDTPPVLLLS
DATLLSRTADGILMVVRMGYTNKNLLKEVQKLDYLKHRLLGVAIIGPSDKSGYSNYGRYYGRYGYKGYYSYKSYNAYLEP
EKG
>gnl|bykdb|B4SD09 [Bacteria] Bacterial tyrosine kinase [Chlorobi][Pelodictyon phaeoclathratiforme] (length=819 residues).
MMVEKETTLSTQSNNEQTQGSEISLGEILKIILRRKYGILLILIASLVMAWIYNKAQTPEYHAVSVMMINENKAPGDLLA
TLLGPSAGVDTKSARKDVELLQSHPIAELTVKELYKTTRKDSLEFFGKRKYVSPIDFLFSAIDVFHPLNADQKAEAWHYS
DALLRFHAMQLKDRIRVIPLRDTNLLQVSVASPFADEAVFLTNILCQTYKNADIIRNSEKYTQANKFIAEMIQDQQQKVG
EADNALSQYMQANKIYEVSGNTGAILAKVVDADARYNDIKAESRIASNSLAFLEKKLSDTDREISSRIAKNVNSQLGAIM
DELRTLESDYIKMVREKGIDNPEVKIKRQQLDVVKTRYEQLSRSKIAGEIGYAGKAQKFSFDMVSEKLQIERKLNDLNFS
ASEFSLLKQYYESQLSMLPIKQQEFIKLQRDKEVVGKTYLYLKEKLDETRIMLGSEVGGVSIIGSAFKPFSPEKPVLSRD
LLAGFILGGLLAVLYTFGAEMADNTVKDDLFFRDLGLTVLSVIPLVGQKGQTPFLDNKESFIKRFLYSKSQAFREKVLSE
ASVKGALPMPMITDSLSSAFAESFRTLRTALDYSRVDFSRIDSSLKFILVSGTAMTEGKSTVCANLGMAYAISGKKTLII
DCDLRRASQHKKLNVKREPGLTDFLYSQQANIDESFFQPTHIENLFVLSAGKKVPNPNEILGSQKMIRLLKELDGKFDKV
VFDSPPLFLSDAAQLAHSVDGVLLAARMHFTNKDPIRNFAVDHFLRPLILGVAMIESRDSQRYGYGYGKYGYGKYGYGKY
GYGKYGYGKYGYGQYEEEA
© 1998-2019