BYKdb

Dataset for cluster cd of phylum chloroflexi

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bykdb|A5V0I3 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Roseiflexus sp.] (length=224 residues).
MNHTNGYADSPLIALRDPRSPAAEAYRTLRTNIQFSSLDKPLQTLLATSTAPDEGKSTTLANLAVTIAQAEQRVILVDCD
LRRPSLHTLFGLSNDIGLTNMILAHNDAPPPLQETGVPGLSLLASGPLPPRPADILGSRRMEAIIQRLRGMADMVLFDTP
PVIAVTDAAVLATRVDGVLLVLEAGRTRRDRARRAREILEKVKANIIGVVLNSARFDGEYGYYA
>gnl|bykdb|A7NQ71 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Roseiflexus castenholzii] (length=233 residues).
MNTTNDARAMNQTNGYAESPLIALRDPRSPAAEAYRTLRTNIQFSSLDKPLHTLLATSTAPDEGKSTTLANLAVTIAQAE
QRVILVDCDLRRPSLHTLFGLTNDVGLTTMILAQDDAPPPLQDTGVPGLSLLASGPLPPRPADILGSRRMETVIQRLRTM
ADIVLFDTPPVIAVTDAAVLATRVDGVLLVIEAGRTRRDRARRAREILEKVKANIIGVVLNGARFDGEYGYYA
© 1998-2019