BYKdb

Dataset for cluster orphancd of phylum chloroflexi

[Download (right click)] [Alignment] [Repertoires]

43 sequence(s)

>gnl|bykdb|A0A0M8JPC7 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Anaerolinea thermolimosa] (length=539 residues).
MDIRPYLAPIFKWWWLLLAAAALATGTAYFILRDQPAVYTARTTLMIGRTLLEANPSSNDFWLNQQLSSLYSDMAYREPV
QEGVKKALGMTWLPKYVVKTFGNGQFIEIDVIDTSPERAMHVASELANQLILVSPGSKEVNSNNEAFIQEQLQKLQEQIV
ATEKELVARQDSLGGLTSAHEIEQAKAELRTLEDKLSLLRTNYANLLSSSKENITNILQVIEPASLPVRPTGPNRYLIIA
LCGMAGLVLGAGCAYLLEYLDEAIQNPEELARLIDAPIVGYISDLGRKANASLYVARHPRSLMAEAFRTLRANIELQNLD
NGPLALLITSPDTGDGKTSVAANLAVSFSQGGKRVILVDGDLRKPSLHEFFDISDRRGLTDVLQGKLSVEKALRTWDGGG
LRLITVGDEAVLPDLLLTAEKVENLLCELKPLADIILIDSSPFLVSDAMIFAAKVDGVITVIRPGYTSREMARVMKERIA
MAGGKIIGVVLNRIPLKRIGYYGGYRYYLPYGYYEKKKKREEDEDKKVPKKSELTFSGK
>gnl|bykdb|A0A0S7BVT9 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Flexilinea flocculi] (length=254 residues).
MLTMDRKLLTNFFRKNQKINDQNIRSLKKITDENSPFQFVEAYKSLRTNIDFVSVNKRYQTIEITSAIPKEGKSGIAINL
SISFVEIGKKVILIDADLRKPMLSSYLGENPADAKGLSTVLTGCDLYASILHTKFHFDFLPAGLIPPNPVELLGSRQMGE
ILCELRNEYDFIVIDTPPVSLLTDAVTLCQFVDGIIFVIRQKTASIDQIKFAMKKLESVKANVIGAILNDYVVPKDSSQS
KNYYNNYSDYYQHK
>gnl|bykdb|A0A160T936 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Candidatus Promineofilum breve] (length=215 residues).
MALVTISDPRSPASEAYRSLRTNLSFYSLDAPLRTLVVTSPAAGEGKSSTVANLAVTMAQSGRRTVLVDCDLRRPTLHEL
FGLAMTPGLTSLALDETVDLPLQETSVENLWLLSSGPKPPNPADLLGAARMGRLIDQLLERADFVLFDAPPVMAAADAAI
LGAKVDGVLLVIQAGKTRRDHSERARELLEKANVRIIGATLTNAPQDRSMREYYG
>gnl|bykdb|A0A1F3AZM3 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Anaerolinea sp. RIFOXYB12_FULL_60_12] (length=584 residues).
YYAYLDSQQLLQTYIQLLTTEKVLNAASEKLGYPVYAGQASAQQVPDTQFVRLTVTNTDPQRAADIANVLVMVLIDQNEE
LQAVRYLTSEQNLQSQIDQVQSQITTMQTQINDISEATVQDQLVQVKAQIEPLQTQVTTLETEIADLQKNRYPTEEENAQ
LAEKEATLAQVKPILTLYQQLYTNLVVLGQPVDTGTNTSTRLQQLQTTLSLYQGIYVNLLNSLENVRFARVQNTPNVVQV
EPAVASTSPISPRPFQSTALAAAVGLMLAAGIAFLIEYLDDTLKTMEDIERVMQLPVVGYIAEIQYESGSDESLYVTRQP
RSPVSEAFRLLRTNLEFAGVDRPIRRLLVTSAGPGEGKTTIAVNLAAIMAQGGKRVVLVDADLRRPKIHRFLGLSNKVGL
SDLFRGVVAVRMVSQQVQDVETVSVLTSGSLPPNPTELLASVRMEQILQEAEQDADIVIIDSPPSLVADVQVLAGKVDGV
ILIIHPGHTQEDASLATLEMLNRAGARTLGVVLNRIPRGRSDYYGGYRHYSPYYSGYHYYHSMDGQDLKPSRMRRLFGKL
SPFNHNGHKKVEAGVVEENVIEKP
>gnl|bykdb|A0A1F8N3P4 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium RBG_13_56_8] (length=221 residues).
MSDNPDLVTLSDPLSPISEAYRTLRMNLQFAALDSPLRSLLITSATPGEGKSTTLANLAVTMAQVDQRVIMVDCDLRRPC
LHTFFGLPNNVGLTNMMLEDQALDDPPLQSTRVPGLHLLASGNLPPRPPDLLGSERLERVIERLLAEADILIFDAPPVIA
VPDAVVLSTKVDGVVLVLNAGETKREHAQHAVERLNRVNVRIVGAVLNNVPLDATLHRYYR
>gnl|bykdb|A0A1F8PQP8 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium RBG_16_52_11] (length=554 residues).
MELRTYFRPLLKWWWLLLAAGLVAAVSSFVVMGRRPLIYQSRTTLVVGSSVYEANPQTGDFFLNEQLAGFYADLVQRTPI
QLETMKALNLEWLPSYSASTIPNTPLIEILVNDTDPSRAQAVANELATQLIKQTPTNDPVNTERRGFIENQLNLFEADIV
QTQIDINDKTASLDSLTSARQIAETQDDIRSLEQKLASLRSSYAALLASSDRGAGNTLRLIEPANLPGRPISPNTFTMVM
LSTVIALALAAAAAYLIEYLDDTLKSPDEVTKLLDIPVVGFISEVERGKSLEYYITNQPRSLIAEAFRSLRTDLEFSSVD
KPLKTIYVTGTEVEAGKTSIAINLAIVIAQSGKRVILMDADMRRPNVHRVLSLTNQKGLSDVFRGTIDIYNATIPYKEGN
IFIVPSGSPPPNPAELLSSKKMDQILESLKKVADVVIVDGPPFLVTDAQILASKVDGVLLVVRYGFSRKNAAISAVQQLK
RADARAIGVVMNRIPRTASGYYGYGMYHSYPGYYIAEEDGATQPSITDRLKPPRKSRPKDKSTGDALNLEKTES
>gnl|bykdb|A0A1F8QKW6 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium RBG_16_57_11] (length=562 residues).
MEIKQYLEPLIKWWKLILVACLLAGISSFLIISRQPPTYQTRVSLVIGRAVYEPNPSGGEMGLAQQLAAYYANIAEREVI
RNATMTALNLRWLPAYASQAVPNSQIIEITVTDTDPVRAQAVANELANQLIKQSPSNPDLKEQKRQEFIRQQLELLETQI
QDTQEQIAQQENEMGTLNSARQIAEAQADLTAQRQKLTTLQTNYATMLGTSLGRASNSLNIIETAALPTRPIGPNRGTII
LMSIAIAFMISAGAAYLIEYLDDSIETPEEINRVMKLPVIGFIPEIDNDVHKATIVAEKPRSVVAESFRAVKVSLDFGQV
DVPAKSFLVASVSKTEGKSMIASNLAMTYALSGKKVFLLDADLRRPSLHTYLDLPNAKGLTTLLLHPEKSIQQCAQSLPI
GNLSVITAGNSVENPSDLIGSQRMKDILLELSERSDYLIVDGPPVLVTDSTILSTAVDEVLIVVGYGLTRRSEAAVALKR
LESAGAKIGGVILNRIPRNNRAYYRLYHYDYGMPAEDTRSIKLGKFHFPMKFNRPVNKKKKPASHDTSDLGDQVASRVDK
TI
>gnl|bykdb|A0A1V5YJ40 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium ADurb.Bin180] (length=231 residues).
MTDKTASDLLVTLSDPRSPISEAYRTLRTNLQFVSLDKPLRTILVTSAGPDEGKSTLIANLAIAMAQGERKVILVDCDLR
RPSLHKLFGLGSREGLTSMMVAEGGSAEPPLQETGVPGLTLLASGPLPPSPSDLLGSRRMDAVLATLKERADVVLLDSPP
VVAVSDAAVLATKVDGVLLVVSAGHTRREGVQAAKAKLEKVNANLLGAVLTNATMDTSLSRYYDAREEVSG
>gnl|bykdb|A0A1Y6K3L6 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Brevefilum fermentans] (length=635 residues).
MDFRQFVNIAKRWIWLALVGALVAGGLGYYISSQETPLFQASTRFVILRAATTGYDYYAYIDYQQQIQTYSELLTTDALL
NQASEELGYSAQDVTASASQIADTQFMRLTVTHPDPVKAAEIANVLVKVLIDQNERLQSVRYEATERNMQQRADQALEQI
EILQAQIDQLSTASVQEQLTQVESEINELQEQIFALETQIVELETKISEFNPLFATEEQKAQHEANRTRAAELEAEVKQL
TPILALYQQIFTNLTVLGRVPDSSTNTSIEISQLQTNLNLYQQIYINSISSLENLNLTRAQNTPNVIQVEPARIPKKPIS
PKPMQDAALYASVGFLLMAGIAFLMEYLDDTIKTPEDVKQILGLPVIGLVADMETGRSKHKGQSKGVFVADQPRSPISEA
FRSMRTSLEFYSVDQQLQMLIVTSSGPEEGKTTIASNLAVIIAGSNKKVLLLDADLRRPNVHQRLMIPNRVGLSDLIRGR
LEINDVIQFSTEIPYLNLITSGSLPPNPAELLGTQKMLSILEDLRAKFDMIVIDTPPAIVTDAQILASKTDGVIYVIRPG
KTRSLVARTPLEEFERLGANVIGVVMNRIPHNRGYYYGGFEYYSPNVYGSEKYYVDSHNDQPFIPIQDIETEPKK
>gnl|bykdb|A0A2A6RLU6 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Candidatus Viridilinea mediisalina] (length=222 residues).
MSSNGSTAETTLVTLRDPGSPAAEAYRTLRTNILFSSLDRPLRTLLVTSTAPNEGKSTTLANLAVTMAQAEQRVLVVDCD
LRRPSLHTLFGLPNEQGLTSAILAQNDDLPPAQATVVPGLKVLTSGPLPPRPADLLGSRRMAAMIERMSANADIVLFDTP
PVVAVTDAAALAPRVDGVLLVLHAGHTRRDRAREARQLLEKVKANIVGVVLNGAKQERGYTY
>gnl|bykdb|A0A2E0ZA41 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Anaerolineaceae bacterium] (length=214 residues).
MDLVTITNPRSPLSEAFRTLRTNLSFYSLESPLRSLVVTSPVMGEGKSSTVANLAVTMAQSGRKTVLVDCDLRRPSLHTL
FDRQVEPGFTDAILHNDEPVLQETAVENLWLLTAGTKPPNPADILGTPQVDQLIARLQEKADIILFDAPPVNAVTDAAVL
GAKVDGVLLVLSAGKTRREHAERAKEILEKARVNIVGATLTNAPVDSSMEAYYG
>gnl|bykdb|A0A2E6YFL8 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=526 residues).
MQNSNITMPQLNDINTTFRRYVGIFLNYWWVFLILPAILGIGTYFYSSSQDTMYEATSTLLVEQRRTGGVAGVSDFTLSE
DLARMYMKQILSTPFISRVVEEPDVKYNVDELKLMLTADAHINPPTLDVIIRNSDKTEAADVANKIAATFINYTVELRLA
EIAKIQTAALSQGLPNVQELVASNFTTLDSLSLLEPAAPPKSPAFPRTKRNTAIGVMLGFLLATFLSVLLSSITSTIKDV
ENIYNQFGVPTLGNIFRWGSQNDQNEVLTHTDPSSPYSEAFRHIRANFQFATANKQPPLFLITSPGPGEGKSTIISNLGA
SLAQNGKKVIILDADLRKPTIHRRFNLKKREPGLSTFLSDKDLTPSEIIMNPGIPNLDIIPSGPVPPNPSELLGTERMKN
LCNDLHSKLNYDYVLLDSPPILVVADGSVLASIATAGILIVDGFSTKIGSLQSAVNTLNGTAIETLGIIVNKLKNSRFSY
GYRYPYYYNYYYYQSYYQYNEAGEKTEKQEKRSTKSTIKKLFRWSK
>gnl|bykdb|A0A2H3KNY1 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Candidatus Chloroploca asiatica] (length=222 residues).
MGANGSSPETTLITLRDPGSPAAEAFRTLRTNLLFSSLDRPLHTLLVTSTAPDEGKSTTLANLAVTMAQAEQRVLMVDCD
LRRPSLHTIFGVPNERGLTSAVLAQDDGPLPIQPTSVPGLHVLTSGPLPPRPADLLGSRRMGALIERMRSEAEIVLFDTP
PVVAVTDAATLAPRVDGVLLVLHAGQTRRDRAREARRLLEQVKANIVGVVLNGAKVERGYAY
>gnl|bykdb|A0A2M8PN31 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Candidatus Thermofonsia Clade 2 bacterium] (length=330 residues).
MKKPNARIVDRAVPPMFPSSPRHVLNIGLGFIGGIGLGLVCVFGLAFIDDRVKSTVDVENSLNINLICLIPKVARKNSFD
KARIVQNNMEPRAAESFRSLYSSIRISDVGRHSQVILTTSTLPSEGKSFVATNLAYTFASHGERTLLIDGDLRMPAIAQS
LQMEDEVKAHGGGLVGYFEGSTSWENMIVNEIAHNLDMLASVKNASVPSEIANSSHFIDIINVLRQTYDRIIVDTPPIGV
VSDAMALVPAVDACLYVVKHKGVKMRSIRDSIRRLRDVHMPILGAVMNQVDKVGSGYYHNYTDKNYHKYYGAYTPQKTQN
PKRVSKPKKK
>gnl|bykdb|A0A2M8PT60 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=220 residues).
MANAKLITLTDPRSPASEAFRTLRTNIMFSSVENPITTLTVSSPAQGEGKSTLIANMAVTFAQGGNKTILVDCDLRRPSQ
HEIWDVENERGLTTMILEDAAISSPPLVETEVDNLQLLPSGPVPSNPADIISSQRMNEVIGVLKARANYVLFDSPPVLAA
TDAALLASKTDGVLLVIRAGHTRRDQAARARQALERVHVRIVGAVLSNAPREDSGEYYGL
>gnl|bykdb|A0A2N2MQC3 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium HGW-Chloroflexi-5] (length=300 residues).
MGKMFDVLQKLEREKTADQKKEEPAIVSDPDNQVLDNKIVSFFAPSSMVTEQFRRLRTHIIQPNQPNSPKTIVITSTLSG
EGKSLIAINLAIIIAVEMQSHALLVDCDIRNPSIARLFGLKDTKGLSNYLLGEAEIPDLLIKTSVDKLSLIAGGPLQENP
VELIGSERMKNLIQELKTRYKDRYIILDCSPLLATTEPTVLTEMADGILMVIKSGKTPRESVQQALRLLNKDKIMGVVLN
GMEYRTKALIQRHFGTNRYYHDYHYSKTHPEPDNWEKAALILKDIKMLLLKLIPHKKGER
>gnl|bykdb|A0A2N2PFW9 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium HGW-Chloroflexi-1] (length=341 residues).
MGRVSESKASLEREITSVEADITRTQDALNAVTDDNQRMRLETSLAQYRSTYSSLLSSYQQIRLAEAQATDNIAIAKPAR
VPEEPIRPRTMTNTLLAAVVGAMIAVGAVFLIEYLDDTIKTPDDVARVSGLSTLGAIARLKETGGTRQLSEGKSTTAANL
AVVMAQTGQRVVLVDTDLRRPVMHKVFGAANNTGLTSALLNGDQVVLDGHLQGTEVENLSLLTSGPIPPNPSELLGSHRM
ARLVEKLVGQADLVIFDSPPVLAVTDAAVMGRQVDGVLLVVDAGQTREQVVAQAAAELQKTGANLLGVVLNRLDSRRGGY
YYYYYYYSEEEGGQRRRSASR
>gnl|bykdb|A0A2N5K785 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=224 residues).
MTNKATPNLSQLVALRDPRSPAAEAYRALRTNIQFSSLDKPLRTILTTSTAPDEGKSTTVANLAITIAQSEQRVILVDCD
LRRPTLHTLFGLPNEEGLTSLMLQEGGRVPLQKTEVPGLMVLTSGPLPPRPADILGSRRMEAVIAQLREHADIVLFDTPP
VNAVTDAAVLATKVDGVLLVFRAGATRRDRAGEARRLLDKVNANIVGVVLTDVKQEDGYSYYGS
>gnl|bykdb|A0A2W4MA80 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=222 residues).
MSLSNGTSPLIAIRDPRSPAAEAYRTLRTNIQFTSLDRPLRTLLATSTAPDEGKSTTLANLAVTIAQAEQRVILVDCDLR
RPSLHTLFDLSNESGLTNMILASEDTPPPLQETGVPGLSLLASGPLPPRPADILGSRRMEQIIARLSGMADMVLFDTPPV
IAVTDAAVLATRVDGVLLVFQAGKTSRDRARRTREVLEKVKANIVGVVLNGAELEQGYGYYS
>gnl|bykdb|A0A2W6B4S3 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=520 residues).
MELRDLIRVAKRWVPIALIVALTLAIASYAFTKFTVKKVYTATVTMEVQAGVTGQSVPDPTISNLIVPTEAQVAAQGPTV
DQAMRRVQSTPGIAITPGEIAAIKASIQCKPNPDTSLFSCSASAHQAEVAALVANQLATVFTQGEQAFDQQRYQTVLTNI
RSSEAIARKNGDAALLSRLQGSEISVLVDAAQRASIVRITQQAQRPTSPSSPHPTLNAALAFLAALLLVLGVGFVSDRLD
DSVRGEEEIKELTGLPLLGIVPSIDMLKDRALSPNSLLFFTGKRSPEAESFRVVRTGIAFSRIDDPPRCLLVTSTVQAEG
KSTFASNLACAFAESGKSVILVDLDLRRPSLSKIVNTPMRGLTNVLLDQASSLESYLVAGALPNLRVLPSGPTPPSPAEL
ISSLRMAQVIQRLQTMADIIIIDSPPILAAADAAITAGLCDSAVLLVRPDRITRRGLTRAVETLNGVGVRVIGMVVNGVP
RTDADYYGYGNYYDYQAPAARGDGAKPVAITTDKKNAAGQ
>gnl|bykdb|A0A350FYF2 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Anaerolineae bacterium] (length=585 residues).
MEINTYLRPLIRWWRLIVIVTMLAVIASAVSALLQPAAYVSRTTLVIGTTILDPNPDSGQIYIAQQLAGIYADIAEREPI
QQATMDSLGIDWLPLYQSKVVPNTQMVEISVTDTNPKRAQIIADELARQLMLQSPAIGGTETGDRQEFIREQLSSLQIQI
QETETKIEELQTSLVDLNSASQIANIETEIRDHTQKLNSLRESYANFLVNSQEGALNILSIVEPANLPTRSVGTSKLIII
ALAGLVGFSLGSGAAYLLEFLDRTIKTTSDVERIFNLPVIGYISEIYENGNNAAYVYENPNSIIAENFRLIRSNIEFFQI
SNPITTILITSPNQGNGKTTVASNLAISISHGEQDVVLVDADLRRPAIHNVLNITKNPGLSDVIRNKTDIDSVVRYWKED
GLKVITAGDIPPNITEVVGSKRIASILEELKEKHEIVVIDAPPLIIADSYNLASKVDGVILIMEPGQTSEEQAMTIKEQL
DRSNAHLLGIVFNKISEQSAHSSYDYQYRSLYSPKYYGDYISKSTNEPNTGSRSKKIMDFFEHGQLPPDMAESVELTITA
IKTQPKQIVERLRKSKKNGKNGKDG
>gnl|bykdb|A0A351G432 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=427 residues).
MFQKKICKPKWQMLKXALETREETRPYQPTPTLAPETLSQIQENRLDLQQKQGMLNLYQELYFNLLSSDSSGNPILTSGA
GSNQYQSTLALYQQIYANLLSDYEAVRLSRMENTTTVVSVEPATPKMQPIRPKPVTNTLLGSVAGLMLASGLVFLIEYLD
DTVKSPDELSRFSSIPIIGYLPSLNQSKLNGKNQSNVYVQENPRSPAAEAYRSLRTNIEFAGIANQTKTIMITSASPQEG
KSTTAVNLASILVQGGKKVVLLDADLRRPFIHRFYKFSNRVGLSEYFRGEVSLESTFNYVDPSRRLIAIPSGKLPPNPAE
LLGTEQMSALLQQLELISDYIIIDSPPLVVTDPVILATKVDGVLLVIQPGVTRISSVRASIDQLERAQARILGIALNNIT
RQNAYYYASYYQQEYYAPDEEEARSLN
>gnl|bykdb|A0A353H3Y9 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Anaerolineaceae bacterium] (length=406 residues).
RYIDLRTNLETELANTDKQISSINARLAAIPTDTAGNAINPNDVATRAQLETSLSQYEQARSYLVSDYQQLMLSEVLSTS
TVVQKDPAVANPLPIQPQPMRSALLAAVVGFMIAAGVIFLITFLEDTIRDPEEVTRKWGVPVLGVISRYGSTATPIITVS
QPRAPVSESFRSLRTNLQFASVAAPLKTILVTSPSPEDGKTSVVANLANVVSQNNRKVLVIDGDLRKPRIHKIFQLPNRI
GLTDYFLHAQERLNGVIKKTEIKSLFVITSGNLPPNPSELLGSERMQEVVETLSSHFDPIFIDTPPLLAVTDALVLAPRV
DGVILVIDPAKTKRAALQHSIEQLKQVNANLLGVVLNNVKISRSHYYYNRDYYYGKPYGKAAEESGGSGADTDTTELELQ
KPALRD
>gnl|bykdb|A0A356DVN8 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Anaerolineaceae bacterium] (length=595 residues).
YSYLNNQDIVDTYAQLLTTEELLFQASEALGFPVRKGQATAKQVDDTKFVVLTVKDPDPFKAATIANGLVSIMISQNENL
QSVQFAAAEKNLQDRIDQAEEQIATLETQISQISDEMLQSQIESVQLQMDDVQAQVNNLKTDMAQIYPGSLAVENIADLK
SLTEDLESLTEEEIAQLTAYQTKLDEITPILELYQEIYTELVVLGQTTGASNQNPTDLDRLKTTLNLYQQIYISSINNLE
TLKLAKAQNTPTVMQVETAAKPTVPISPKPTETALLGAAIGLLITAAIVFLIEFLDDTLKTPDEIKAILEVPVIGFIGEL
KQSSKKGEDALGVYVAKNPRSPVAEAFRSLRTNLEYSSVDNPVKTVLVTSSRESEGKSTIAANLAIVEAQSGKAVVIVDA
DMRRPKVHLQFSKPNRMGLSDVVTGKLGIDDVLKTYDQVENLSIITCGTIPPNPAELLGSERMSQTLKDLKMRFDVIILD
TPPMIVSDAQILSSKVDGLVYVVIPGQTRAITAMRPLEELRRIESKVLGVVANKIPRNRDYYYGGYNYYSPYSNHYSYHT
ESIVPNSEIDMDSKKVTPLGSVFEKYQRRDADKQN
>gnl|bykdb|A0A363U3C3 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Anaerolineales bacterium] (length=589 residues).
MDISVYLRPLLRWWRLIMIVTVLAVVASAVSTMFQPEIYVSRTTLVIGTTILDPNPDSGQIYIAQQLASIYADMARREPI
QQATMEALGIGWLPQYQAKVVPNTQMVEITVSDTVPKRAQIIANELANQLMLQSPAIGGTETGERQDFIKQQLDSLKVQI
QDTEKNIEELQKSLIGINSASQIANIEKQINEQTQRLNSFRENYASLLANSQEGALNILSVVEPANLPSNPVGTNRFFII
ALAGLVGFSLGTGAAYLLEYLDKTVKTASDVERIFGLPVIGYISAITDDEDSGTYVEKNPDSILAENFRLLHSNIEFFRV
SNPIRTILVTSPNQGNGKTTVASNLALSISHEEQDIIIVDADLRRPAIHNALKVPKNPGLSDILRNKADVKSVVKSWKDD
DGIKVLTAGNIPPNVTEVVGSKRIAMILSGLEKEYELVIVDAPPLIISDAYNLASKVDGVILVMEPGQTTEAQARTIKEQ
LDRSGARVLGIVFNKVTEEMAHSYYDYRYQSLYSPKYYGDYISTASREPNTGSRSRQLMDFFEHGKVPADVAVEVEHAIT
AIKTQPRKTMERLRKSKKSGTGRKNGKNG
>gnl|bykdb|A0A399ZSS8 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=222 residues).
MTNSLITISNPRSPIAEAYRTLRTNLEFSNLDKTLRTLLVTSAGAEEGKSTMLANLAVTIAQSGKRVILVDADLRRPTQR
QIFGLKDNAGLTDMARDDAARAQPPLQDSGVPNLQVLTSGQLPPNPAEILGSKRMSEILAALLEQSDIVLLDAPPVLAVT
DAAVLSGKVDGVLLVVSAGKTKRENAKKAQAQLEKINARIIGVVVNNVQAEKGASYYYAESN
>gnl|bykdb|A0A3B9YZ03 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=248 residues).
MTSSSGAPVPSGPESAVKGTPDVIVYTDPRSPAAEAYRTLRTNVRALIRPAGGAPLRQILMTSAGADEGKSEAIACLGIA
FAQAGMRVVIVDADLRRPAQHLRFNLPNSDGLSNLFGGATPRTPTLQPTAVPNLHVLTSGTEPESPADILASSDLDHIMD
HAGRDADLVLIDCPPICAVADASVLSTRVDGVIVVVGAGVVKRDLARHARAQLDAVRANVIGLVVTNAPYNERTFASYYE
ESPGRSAS
>gnl|bykdb|A0A3C0ZZ70 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=230 residues).
MIMANNRQESLITISNPRSPISEAYRTLRTNLEFSSLDKPLRTMVVTSAGPEEGKSTTLANLAVTLAQAEKKVILVDCDL
RRPSQHEIFEVENGVGLTTMVVDEEAFKNPPLQETPVPNLKLLPSGPLPPNPSELLGSRRMEEIIATLRERADLVLFDAP
PIIAVTDAAVLASKVDGVLLVINAGTTKRDHAQRAKALLEKVNARLVGAVLNNVRMDISLHRYYAEQKQA
>gnl|bykdb|A0A3D0CW09 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=222 residues).
MTIQGRAALITLTDPRSPVSEAYRSLRTNLEFASLTGPLRSLVITSPGPGEGKSTMLANLAVTMAQAGKKTIVVDTDLRR
PSQHELFGLDQEPGVTTMFMDPALQSAPPLQATEIEGLWLLASGPKPPNPAELLAAPQLRTIIEALTARADIVLFDAPPV
VVVTDAAVLASQVDGVLLVIQAGKTKRDQAAQAKTLLDQVRARLVGTALTNVKLDPKLQGYY
>gnl|bykdb|A0A3D0US14 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=215 residues).
MSLITLTDPRSPVSEAYRTLRTNLSFTGLDEPIRTLVVTSPAPDEGKTTTIANLAVTIAQGGRKTILVDCDLRRPTLHTL
FDLKPEPGLTNLLLEENGQPALQPTMVDGLQLLSSGPLPPNPADLLGSHKIDQIIATLLERADIILFDAPPVIAVTDATV
LGAKVDGVLLVISAGKTRREHAERAKEMLEKANVRIFGAALTNAPKDSSIGGYYD
>gnl|bykdb|A0A3L7VU47 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=225 residues).
MTNPVAASPTSTLIALSAPQSAAAEAFRSLRTNIQFASLDHTLQLITITSAGVDEGKSLVAANLAITMAQAEQRVILVDC
DLRRPALHSLFGVSNDTGLTSMLFANAGDAPPLQATSVPGLQLLASGPLPPRPADILGSRRMGEILQALRGLADVIIIDT
PPVLAVSDAVVLAPRIDGVILVMQAGRTRREPAKQARIVLEKAKAHIVGVVLNDAEMTQSSGYYG
>gnl|bykdb|A0A3L7X1Q5 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=248 residues).
MTSSSGAPVPSGPESAVKGTPDVIVYTDPRSPAAEAYRTLRTNVRALIRPAGGAPLRQILMTSAGADEGKSEAIACLGIA
FAQAGMRVVIVDADLRRPAQHLRFNLPNSDGLSNLFGGATPRTPTLQPTAVPNLHVLTSGTEPESPADILASSDLDRIMD
HAGRDADLVLIDCPPICAVADASVLSTRVDGVIVVVGAGVVKRDLARHARAQLDAVRANVIGLVVTNAPYNERTFASYYE
ESPGRSAS
>gnl|bykdb|A0A3M1DIE1 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Thermoflexia bacterium] (length=219 residues).
MTQKPRLITLTDPRSPAAEAYRTLRTNLTFAGLDQPLEALVVTSPAMEEGKSLAVANLAVTMAQGERRTILVDADLRRPR
LHAIFGVSNDRGLTTMFVEPAAMANPPLVDVGVENLWLLPSGPLPPNPADLLGSRRMDEVLAALRARADILLFDAPPVIE
VTDAAVLGRKADGILLVMTTGRTRRDHALRAKEVLERAHVRLVGVVLTDVSVSRAHRYY
>gnl|bykdb|A0A3M1E8I5 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Caldilineae bacterium] (length=221 residues).
NIQFMAVDHPTKTLLVTSPSLGEGKSTTAANLGVIMAQADLRTIVVDADLRRPSLHKIFQVPNAGGLTDLLRSPEMELAD
QLKRTEFENLQIITSGPLPPNAAELLGSQRMGHILKQLTGMADIVIFDTPPVLSVTDATVLAGRVDGVVLVIQAKRTRRD
AARHAVQRLQQVGATILGAVLNQSGKGSGYYYSYYTQTGARPVKQPRRAPQRRWWQIGSTR
>gnl|bykdb|A0A3M1EV88 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=224 residues).
MAVEEQAKLVTLSDPRSPVAEAYRSLRTNLEFSSLDEPLRTMVVTSPAPEAGKSTTLANLAVTMAQAGKQVILVDCDLRR
PSLHEIFGVSNTTGLTSVILDDTTSAPPLRETGVPGLKLLTSGPLPPNPAELLGSRRMADLIRALREQADIVLFDAPPVI
AVTDAAILASQVDGVLLVLNAGVTRREHAQRAKAALEKVNARLIGTVLNNVKLDTSLYGYYSAQ
>gnl|bykdb|A0A3M1M4P3 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=224 residues).
MKREIPLVTLTHPRSSAAEAYRTLRTNLTFASLDKPIRSLIVTSAAPGEGKSTTLANLAVTMAQGDRRTILVDADLRRPS
LHRIFGLPNEPGLTTMFVDEASRTDPPLLETGVEHLWLLPSGPLPPNPADLLGSRPMEEIIASLLERADFLLFDAPPVIA
VTDAVVLSTRVDGVLLVVQAGRSRREHVQQAKQLLERVQARLVGAVLTNAPSDSVMGAYYTDEW
>gnl|bykdb|A0A3M1MN85 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Anaerolineae bacterium] (length=536 residues).
MNLKFLDYFSPIFRWWWLLIVCALVAGGVGYALVNPLPPVYQSGITLLVGNALDTPNPSSLEVEIPRRLTDAYAAMALRE
PVRDGVKKALGLDELPKYTAYTIPGSTMVRIEVTDTNPRRAQAVATELGRQLMAQSPGGTTRDSETQAFLEEQLHKIADA
ISETEQDIAAKQEEMATAEGASAILSLQADLDALNNKLATLQENYARLLASSQSNAINTLRVVEEATLPTRPIGPNKVLD
VAAATLGGLILATLGAYGIEYLDDRLKTETHIQHLVHYSLTGYIPTIYTQENPVTYLRKRPRSPAADAFRSIRNALGYLA
DAPYRTLLVSSAAAGEGKSTVAAGLAISLAQAGYRVILVDADLRAPSLHTMLGLPQKPGLSDVLQGKIPLAESIIMLENL
GIDLLTSGDIPDQSTELLASRAMQTTMAQLGQSYDVVVLDGPPFAVPDAVVLARRVEGMLWVIRVGYSRRTAVKYMQEQI
EQTLVNVLGVVINCGRGPRAHYYQVYGYHGYYQDGNGRERRKPAFRRLVENLRRTK
>gnl|bykdb|A0A3M1YX52 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=219 residues).
MGNTKLITLTDPRSEAAEAFRTLRTNLMFSSVENPIHTLLITSVAQSEGKSEVLANLAVTFAQAGHKTIIVDSDLRKPAQ
HEIWGVANERGLTSMMLEDTALAEPPLIKTEVEHLQVLPSGPLPPNPADLLSSQRMQEVIGILKARAAYVLFDSPPVLAA
TDAAVLGVKLDGALLVVQAGNTRRDHTARARDALERVHVRLIGAVLTNADRETAGSYYG
>gnl|bykdb|A0A3M1ZY58 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=220 residues).
MNKEAEKYLITLSDPRSPVSEAYRTLRTNLSFYSLDNPLRTLVVTSPAADDGKSTTVANLAVTMAQSGRKTILVDCDLRR
PSLHTFFGLPAEPGLTNMLLDDDEPPLQETGVENLWLLASGPKPPNPADLLGARKVDRVIERLKEMADVILFDAPPVVAV
TDAAVLGAKVDGVLLVISAGKTRREHAERAKELLQKAHVRLVGVTLTNAPKDDAISGYYG
>gnl|bykdb|A0A3N5NV84 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=269 residues).
MAAAIGLVLAVGGALLIEFLDDTVKTPDDLQRTAQLTTLGTISRVAGGEDKYRLIPAEEPLSHVAEAYRALRTNIRLSSV
DEPIRTLIVTSPSPREGKSTTAANLGVVVAQAGKSVILVDADLRRSSLHRFFALPSKEGLTNVLVQDELAVDGWLQETGI
DNLRVLTSGPLPPDPADLLGSKRMHHLIECLEHEADLIIFDTPPTIPVSDATVLALEADAVLLVVEAGRTRRGAIRRTME
DLQRAGAHVLGAVLNRVTSRPSKGYYYYE
>gnl|bykdb|A0A3N5PDS6 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=233 residues).
DRPLRCLVVTSALAAEGKTTTVANLAVVIAQGGKRVVLVDADLRRPAVHRLFGMPNRGGLTDALVEEPAALNSFLRDTAV
ENLRVLTSGPIPPNPQELLGSQRMEDLLQRLQGEADVVLVDTPPSLVVADANVLAARTDGVLLVVNADRTRRVAVQQAAE
GLRQVGANLVGGVLNMVDIRRGRGAGYYSYYGYYSHYYGEEEGERHRGPRGWWRRLRRGKEAGSPRDGVSPAA
>gnl|bykdb|A0A3N5RU86 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=292 residues).
MELITVALAMAVGLSLSGSVAYVLEYMDGAIKSQDEIEVLLNTPVVGNIFEVKQGKNKQPFSIADNPRHPVTEAFRNLRT
FIEFTNRDKLHTILVTSAGSNDGKTWIAANLAISMAREGKRVVLIDADLRNPSLHQFFHEERENGLTDLFQGKQAVTDVL
KYNNKERVGLITAGELPQNTYELMNIKMMERILMELMDAVDTVIIDSPPFFIADSVLLSSLVDSVLAVVRPNHTLKQSAL
AMIEQIHRSGGNLTGVVINRIPFRQLKYYLKYPYNSLEKYHLASERMQKEPR
>gnl|bykdb|A0A426U8Y8 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Candidatus Viridilinea halotolerans] (length=217 residues).
MTTETTLVTLRDPGSAAAEAYRTLRTNILFSSLDRPLRTLLVTSTAPNEGKSTTLANLAVTMAQAEQRVLLVDCDLRRPS
LHTLFGLSNEQGLTNAILAQGDELPPLQATAVPGLSVLTSGPLPPRPADLLGSRRMAALIERLSANVDMLLFDTPPVVAV
TDAAALAPRVDGVLLVLHAGHTRRDRAREARQLLEKVKANIVGVVLNGAKLERGYAY
© 1998-2019