BYKdb

Dataset for cluster tad of phylum chloroflexi

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bykdb|A5V0I4 [Bacteria] Adaptator of bacterial tyrosine kinase [Chloroflexi][Roseiflexus sp.] (length=240 residues).
MQLSDYLAVLRRRWWVILLTMVVAVASALIFSRLQERIYRSEASYLVVPNRIDNGLSIVLQNSMSSFREMALARPQLQKI
SDELKLDRTPEWLLKRVAIQPRPDERKMIVQVDYPDPATAQRLADAIGNNMVALVSARNNFLEGTDRISMTVLEPATPPV
LHRPQTRVNMLAGAVLGLVLGVLLAFVLEALDDTIKTPSDVERYVQLATLGAIPAVSSDSRGATFTARRARKNEELEVVP
>gnl|bykdb|A7NQ70 [Bacteria] Adaptator of bacterial tyrosine kinase [Chloroflexi][Roseiflexus castenholzii] (length=229 residues).
MQLSDYLAVLRRRWWIILLTTVVAVASALIFSRLQERVYRSEASYLVVPNRIDNGLSIVLQNSMSSFREMALARPQLQKI
SDDLQLDRTPEWLLKRVAIQPRPDERKMIVQVDYPDPATAQRLADAIGNNMVALVSARNNFLEGTDRISMTVLEPATPPV
LHRPQTRVNMLAGAVLGLVLGILLAFVLEALDDTIKTPDDVERHVQLATLGAIPATGSDTRSAALPARR
© 1998-2019