BYKdb

Dataset for cluster tadcd of phylum chloroflexi

[Download (right click)] [Alignment] [Repertoires]

57 sequence(s)

>gnl|bykdb|A0A0M8KAF3 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Ardenticatena maritima] (length=573 residues).
MNTPLVPPDMLTDEDTIDLRQYWLLIRRWWWAFVLALLLGAVAAYIASQFQQPIYRAEARILVSQSSSSDLNDIYRDIVI
GERLVKTYAEIMKSDAVLDLVAETVGEEALEEAKISVSPGQDTQLLVVAVEHPDPELAATIANEVVRVFSAYMRRVQTER
FAESKANLQAQMERVQAEIEQLQQQLDALGTPETEAEQTRQQQLQTLLTQQQAAYTTLLRSYEEVRLAEAQAVDSIVVID
PATPPERPVRPRVLLNTLLGGVLALVAVGAVVVLIEVLDDRVRSPEVIERLTGLPMIGAIAHIEGTNGDGVLVAREQPRA
PVSEAYRVVRTNLQFAEVQSPLHSLVVTSSEPGEGKTTTAANLALVMAQAGRKVVLVDADLRKPLVHRLFQLSNAQGLTS
ALMHPEIAVDRFLQRVDAGGGQTLWVLPSGPLPPNPAEVVGSRRMQELLDELMTFADIVILDTPPVLVVADPALLARMSD
GVLLVTRMNVTHRQALQRAIEQLRYAEARILGVVVNDLTARDGGYYYYAYSQYYHHDDGSGGDGTRPERKRRRADASRKG
VMARLLSFVNVKS
>gnl|bykdb|A0A0P6WSP2 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Ornatilinea apprima] (length=740 residues).
MLSNREAVGLKWLANWNSPSLRIVLGCVLIATLIACLVILLIPPTYKSSTLLLIEPSPGLVTDDYSSIIAGEQLAFTYSQ
LMVEKQILETAIRRLELDLEPEDLARRVSAEPVSNTQLIRLSVRDSSPQNAALLAETIADEFVQHVRLLEREKFGESISG
LQAEMESQTTLISANQARVDSLSSQSIAHGSKMVHLQSQIDLDRGDYQFLQQSYFVAQSQADQIAEKIQIVEDAVVKEAA
GSRGFSAYLTLLVDPSLIIGQGTYSTVTNSARVASAYGEIWTGESYMQAVIDELGLDRDADDLANDVYFEPIPSTQLVRL
RVDDPSAAQAKTLVEVIGRNIVQTTQTQLARPYTDRMQALQKQMDELSAQIESAQAEIMTISAQKAQIEADLIKEESAKT
KLSQDYQVLYDQMEQLRKNANQASNSVMVVAQPSIPDRPTQDRLLYVLLAALLGGTVGIGAAFVLDQLDETVRIRQDVTS
KMGLNLLGCIDAQKNGDSGLEMDVHPRSKVAEDFRTLAINLCSVNAQNPIRTLLISSPGMAEGKSVVTANLALALARLGL
KILVVDADLRLPSLHRIFGVDQENGLSEALVSGKGTDHLKTTKEAGVKIMTSGSLPPNPSELLNSKKLTILLEKLSQQAD
LVLVDSPPILSVADSIILAGELDGTMLVARSGMTTRKMLREAEENLRQVRGNLIGVVLNGVPRDQHSAYRYESGEEERPS
AQRWFDVLQYWVKTPWFKKK
>gnl|bykdb|A0A0P6XM68 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Levilinea saccharolytica] (length=637 residues).
MEIKEYLQIARRWAWLLILGLLLGAVSAFFFANSQTRIYESSIRVQIVSAVKTVPNMDYNSYVEQNQLAQTYVQTLRSRP
VLDAVAERINTAITPEQIRAQIVQNTQLIDIFVTDTDPQRAASIANTLVEVFIERNSRMQAERFNESERSLEAQIAQIDA
QIEALQSRSTAATTEQSEQQIEKAKSELDRLQTEILAIRTALDTLRSPKAEAGWYSTPTPSPEIRAEINQKELELKELET
TYDLYQQIYTNLVVLGESRNENSANVEQEQMQSTLALYRQIHANLLSSYENIRLARLSSTSNIVSIEPAIPPEEPLSPKP
VRTGLLGGTVGLLLAAGIVFLIEYLDDTVKSAEQAEAALGVPVIGFIAELEHDQDKAYVAENPRSPVSEAFRTLRTNLEF
AGVDRPIRSILVVSAHPGEGKSTVATNLAITMAQGGKKTLLIDADLRRPRVHQYLNLPNRVGLSNLFRDAKSLHEVMGQW
KETTLQVITSGGLPPNPTDLLASDRMAAVLQSALEEADVVVVDAPPFLVADASILASRVDGVLFVIHPGRTPVDAAQATL
EQMRRVGANVLGLVLNRIPRNRPNYYGGYRYYSGYYKGEYSYYDDEARGNGKKHSTFRWRTRKNQTQEEKTAESGQE
>gnl|bykdb|A0A0P6XME1 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Thermanaerothrix daxensis] (length=616 residues).
MQPRDYLVLIRRWLWLLGVGIFVGALGGLVFSLLQKPIYQASTKVMVLGVPQSNLSDILNQNSELLSQTFTELLVTRPVL
EAASERLGYYINSSQVRVQQVRGAQLIQIIVEDSIPEKAAEIANTLVTVFLEQNAKIQSSRFSASEESLQAQIQQVEAQI
ADLQRQLAQTSEQSNEKRIQDVTNIISGLQSEINQLQADIVRIEAERDPILGVNSLGQPARVTPTLTVDQQIELTQKRSR
LDELRSLLSIYQQIYVNLTFSPSNQGNSNSTNSQLQAALVLYQQIYANLLSNYEAIRLARLQSTPEVVQVEEARVPSRPV
RPQTTTNVLLGGILGLVLAAGIVFVVEYLDDSIRNGETVTRVLELPVLGYINEINGKTPYEDYPPHVIAQPRSLITEAFR
SIRTNLEFVEIDRPLKTLLVGSPSPDEGKTTIAVNLAIVIAQAGKRVLLIDTDMRRPQIHERLRLPNRFGLSDILREHGS
LDESLHHLATEGIDVITSGILPPNPAEVLSSERMAKLMEEVAQRYDKVILDGPPFLISDAIVLASRVDGVLLVLRARNTS
QSVALEVLDQLDRVKARVVGAVLNRVQDTTSNHYYRSLKSYTYVSKETDELTLLEN
>gnl|bykdb|A0A0S8KFR9 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Anaerolineae bacterium SM23_84] (length=755 residues).
MELRAYLEILIRRKWVVILTTLATVAAVVLVTSRQQPVYSAAARVRVAQASSGSIEYVDYMYAERLMNTYIEMLKSSSIL
EEVIKELDLSSSPKDLAKQIEADVVPDTELLSITVTDHDPARAKDIANALATLLVERSRNLYFGGTRSAREILQQQLDEV
EAKLEQVRTELQTLVDSVARENARVDALKARIRSEEEVYASLLSQYEQARVAEAARENSVTIVAPAVKPAARDGPQVSYL
ATATVRVTQPYSAFPGYAEYGYVERLMNTYVELLKTQPILEEVLQKLDLPELPSALLQQIVIEVLPDTELLRITVEDRSP
ERARDIANALAGLLVEQGQTLYSGDTKSAREILQQRLSAVEGNLEQDREALQDLLDSSARENARIDALEMRIRSEEEVYL
SLLRQYEEVRVAEASRESSASIVAQAGQPDAPSKPRVKFNLALGTLVGAVGGIALAFLFEYLDPTLHSTDDLEAAAGASV
MGVIPGFAPHAVSRGKILLSSDGRSPEAEAFRMLRGNLLSVASTRPLKTLLITSAEPGAGKSTVLVNLAAAMAQAGQKVV
VVDGDLRYPCLHEVFELPNDMGLSNVLSDLRRMSTALQETNIEGVRVLTSGPVPPNPAEPPPLSKLPQLLGKLAKEADLV
LLDSPPILAIADAATMASMVDGVLLVAAKDQATGRRVQRALQQMARVGAKPLGVVFNRASAADGDYYYPYGRGIIGGAEP
VLPSFLGNFVGRFSIIRRIWERAPGLDEDRSPEDQ
>gnl|bykdb|A0A1F8PTW9 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium RBG_16_52_11] (length=529 residues).
MELKKYIFPLRKWWWLLLASTLVAVVLSYLYILRQPKIYQTHTTLMIGTTISDPNPSSNEFALGQQLASAYANIANRQMV
RNATMNALDMNELPEYTAWALPNTQLIEISVTDIDPKRAQAVANELATQLILMSPSNAQPEEQGRQEFINQRLNILEVQI
NETEDEIKKLQEDLGNMISAQQIDETQIQISSLQSKLSTMQDNYGTLLSNTQQGAINSLTLIEPAALPSSPIGPKIGLTA
LLAAALGLMLAVGEAYLLEYLDDTLKTADDVARLFSAPIIGHIFEQKNGKKQHHLYDTADLRHPIAEAFRILRTNIEVAE
ANQPLKTILVTSADIGDGKTSVATNLALFVAQRNKKVVLLDADLRSPNIHKYFNLANDRGLVDLISNGATSNDVLRVIED
GKLTILTSGNTPPNPTELLSSNKMDQLLSKLKEIYDIVIIDSPPFIIADTMILASKVDGVLLVVRPGHTRQPLAQVTTEQ
INLVGARLVGVVLNRIPLHGADYYTGKNYLYTYYLSNYGAERDDLIIDD
>gnl|bykdb|A0A1F8QGH2 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium RBG_16_57_11] (length=741 residues).
MTNNANTDLRRIFSVIRRWLWLILGCTLVGGVIAFSVTSLLPPVYKATATLLVEPSQESSPNDYSTLMAGERLALTYSQM
LKGPLILEKVITRLGLDETPEDLSEKIVAEPVANTQLIRLTIRESSPEKVTLLANTIAEIFTDHIQALQTDRFTDLLQSL
QDQMSAASTQMNETESTMDGISARMIEEETKLVRLQTFVAELRADLQTLQQNQEELQSTIDEAANSVMIVEDAQVLTQED
SFFYEATVTLLVDQVHERSGDNYAAILANERLAQTYGEILAGRKVMEAAISRIKSDESPDDLMNKVKVETVSGTQLIRLS
VEDTNANQAKLLADAIAGAFLDEIQVLLTEPYVTRLEALQTHIDDLYEGIEATQAEIESLSAEKIRAETELARLESRLVE
DRNDYRALKQDYEQLQLTANDASQAVSIVEPAQLPESPEEDRVLYIGLAALTCAVVAIGIAFLWEYLDDTIRTPDDISDL
TGTSTLAIIGQLPQGEDELVVLAKPRSPYAEAFRMLAANIRFSSLDKPLQSLLVTSPSSQEGKSIVLANLAAAMAGSGQR
IVVVDADLRLPRLHQVFKLDGKEGLTDSLINSSLDGNLQATKMDGLKVITSGKLPSNPVEVIGSAHMRIFLKEFEEKTDL
VIIDSPPVLPVADAAILTSLVDRVILVLRAGQTRHRAAQQAVKSLQQAGAQQIWVVLNAVPHHMDGYNSYYTNEHEDKNS
GGSTLQVSLEGEEKNASPTLD
>gnl|bykdb|A0A1F8QH26 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium RBG_16_54_18] (length=555 residues).
MEFKRYLFPLRRWWWLILASTLVAAVLSYLYLYQQPKIYQTHTTLMIGAAITNPNPSYNDFVLGQQLADAYANLTNLQLI
REATMNALNIDQLPEYKARVEPSTQLVVITVNDTDPNRAQAVANELAAQLILLSPTTEHTEDQVRQEFINERLSVLETQI
NDTEEEIKQLQEELGSIISAQQIEEVRSQISSLQSKLSDMQNTYATLLSNTNQGAINSFTVVEPAALPVKPIGPWLGLSV
LLASLAGCALAVGEAYLLEYLNNTLKSSEDVVRLFSAPVIGHIFEYKDGKTGNHLVDLTDLQQPLSEAFRVLRTNIELSG
SDRPLKTILVTSADASDGKTFVAANLAMFMAQRRKKVVLVDADMRRPTIHEYFNLDNDKGLTDFFSKNASISDVLRIGEN
RKLGVITAGKPNPHPAEFLSSNKMNQFLSKLKTVVDYIIIDSPPFIISDAMILAAKVDGLLLVVRPGHTRQPLAKVTKEQ
IGQIGANLIGVVLNRIPLRNAVYYTGEGYLYTHYMSGYGAAKKTNNNGEGGEVGEGGEVGEGGEGGEGGEGGEGE
>gnl|bykdb|A0A1F8RRT9 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium RBG_16_68_14] (length=474 residues).
MQLARYLRLAGRWWWFIALAALIGGGSAYSISQLITPIYRADATLLVNQTQTPGVIAYNDILTSERLTMTYRELISKRPV
LEDVTEDLELPMSPDELGALIDVEAIEDTQLLRLSVEHEDPDQARWLANATAQAFIDSNEQDGLTRPGTVSIVEPASTPA
SPVRPRTTLNSIIGALAAVFIAGTVVLIYEYLDDTIKTAEDVETAARLPTLGGVARFPRRVSSRSGLVVASTERSAAAEA
YRVLRTNLQFSTLDAQALLVSSANPGEGKTTTVANLAVAIAQTGLRVIVIDSDLRRPALHRIFGLSNGAGLTNALLSRQP
EIQRFLQPTAFEGLSVLTSGPLPPNPSELLSSRRMDAIVDAARKEAEILLFDSPPALAVADASILAGKVDGAILVVDTGR
TRAHALQRASEALALSKTKVLGAVLNKLTGRGQGYYYYSYHYYSSSDDGKNGHRKGRLFRGKRSQPAEETRTHA
>gnl|bykdb|A0A1F8SS27 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium RBG_19FT_COMBO_50_10] (length=564 residues).
MNDYIELHRLFTMVLRKWWLLIMVTAFAAALGYTFGHRQAPVYEARATLLVGQIFESANLEKQDLQTSELVAQTYSDLTR
RQPILQSVVDVLGLNKTWQQLRKQVSVGLVEGTQLIQITAEADSPDTAQMIADEVAHQLILFSPGRSNTSNSIMVRQFIQ
QQLGNLQARIENGQSRLAEIEVEMVQVKSAEQLSELQRELNTLASLITSWENTYTQYLGFLQAKESPGTLTIIESAQVSP
KPINPQVQLIAFLATGLGFLLALGFIFLLGHFDDTLKTAEEITQVSGLPVLGMIRKLSRFKNTSDSVYVSKNPRSPAAED
FRILRANLELLSTDQPLKTILVTSCDKATGKSFISTNLAMILAHSDREIILLDADLRNSNIHKMMSIPNEYGLSDILRNG
MNVSQALRNYDGVNGGVITGGTVAPNPFELLGSKKMDEILAKLKKSDYVIIDSPPLFVSDSMVLSPKVDGVLLVAELSQT
KKKQIRRTVEQLNRTGAQVIGVVLNRATGESLKYYGAKQYVGYGLEEADEKLPNVKSYLNAVRAIPNYIARRFSRSNEAK
LEKK
>gnl|bykdb|A0A1F8U7F0 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium RIFOXYD12_FULL_57_15] (length=641 residues).
MEIKRYFSLVRRWAWLGILGLVLGAAGGYFSSANQTPVYQASTRFVILRAAQTTAADYYAYLDSQQLLQTYIQLLTTEKV
LNAASEKLGYPVYAGQASAQQVPDTQFVRLTVTNTDPQRAADIANVLVMVLIDQNEELQAVRYLTSEQNLQSQIDQVQSQ
ITTMQTQINDISEATVQDQLTQVKAQIEPLQTQVTTLETEIADLQKNRYPTEEENAQLAEKEATLAQVKPILTLYQQLYT
NLVVLGQPVDTGTNTSTRLQQLQTTLSLYQGIYVNLLNSLENVRFARVQNTPNVVQVEPAVASTSPISPRPFQSTALAAA
VGLMLAAGIAFLIEYLDDTLKTMEDIERVMQLPVVGYIAEIQYESGSDESLYVTRQPRSPVSEAFRLLRTNLEFAGVDRP
IRRLLVTSAGPGEGKTTIAVNLAAIMAQGGKRVVLVDADLRRPKIHRFLGLSNKVGLSDLFRGVVAVRMVSQQVQDVETV
SVLTSGSLPPNPTELLASVRMEQILQEAEQDADIVIIDSPPSLVADVQVLAGKVDGVILIIHPGHTQEDASLATLEMLNR
AGARTLGVVLNRIPRGRSDYYGGYRHYSPYYSGYHYYHSMDGQDLKPSRMRRLFGKLSPFNHNGHKKVEAGVVEENVIEK
P
>gnl|bykdb|A0A1J4ZRV4 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Anaerolineae bacterium CG2_30_64_16] (length=546 residues).
MELRQYALLLRKWLWLVVICTVVAGGTAYGVSKNSTPIYQASATLLVNQASNPVSGAGYQDILTSERLAKTYASLLTGWP
MLDETARRLGVDAKDLEKTVTVSSVRDTQLLEIQVEGPNPQLIVQIANTLPEVFIAQNQELQMGRVSESKASLEREITSV
EADITRTQDALNAVTDDNQRMRLETSLAQYRSTYSSLLSSYQQIRLAEAQATDNVAIAKPARVPELPIRPRTMTNTLLAA
VVGAMIAVGAAFLIEYLDDTIKTPDDVARVSGLSTLGAIARLKETGGTRQLVAWLQTKAPESEAYRTLRTNIQFSSVDKP
VRSLLVTSAGPSEGKSTTAANLAVVMAQTGQRVVLVDTDLRRPVMHKVFGVANNTGLTSALLNGEQVVLDGHLQGTEVEN
LSLLTSGPIPPNPSELLGSHRMARLVEKLAGQADLVIFDSPPVLAVTDAAVMGRQVDGVVLVVDAGQTREQVLAQAAAEL
QQTGANLLGVVLNRLDSRRGGYYYYYYYYSEEEGGQRRRSISPHGADEEGAPARGRARFPWPRLRA
>gnl|bykdb|A0A1Q7TTL6 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium 13_1_20CM_4_66_7] (length=821 residues).
MTLSNLPAPLVPPPVTAPGLPQRGVAAFDSDHSESGVDWRRILSAVLRFKWLIATMTLVGTVAGIGATRFIKPEYSAQTK
IWIDVEGRGQDRGPTPIRSAQLLDAESWVDLLLSYVVLDQVVRDQRLFVEPGTPADGQAVEKLSVADQYQPGVYRFTVDH
SGQGYTLASADGVELERGTLGDSVGTRYGLRWAPDASTVAPGRAVQFNLTTLRDAATALSEALDARMDVDGSFLRVELRG
HDPKRTTAIVNALAQRYVQVYADLKRQKLVELTKILGEQLQHSQDNLRSAEADLQRFREQTITLPSDRPPTVGSGSVAGA
AGGGGAAGAPDGARDPVFGGFFEMQITREEARRDRDALERVLAQYGDSGLSAEALAVVGSVQLNGELSQALKELTDKQAQ
LRAYRYKYSDEYPPVQRLIGDIATLQRQTIPRLARVLAGQLAAKETELGRRVDADARALRQIPARAIEEARLRRDANLAE
NLYTTLQQKYDEARLAEASSLADVRVLDYAVVPRRPVKNTRRRVVLLAFFGSFAMAVVGAVLIDRVDPRVRYPDQVSREM
GLTILGAVPHIRAGARPERSGRRVRPPEEVAVVVEALRGVCLNLVYAHGAVAPMVVTLTSPGAGDGKSFLAANLGHTFAE
AGHRTLLIDGDLRRGVLHRRLGARRRPGVSDFLRGEVPLEAIVQATPYPSFSLIGCGTRAYNAPELLGSQAMSQLFTTLR
PNYDVILVDSPPLSAGVDPLILGTLTGHLVVVLRTGFSHRDVAAAKLEVLQRLPVRLLGAILNAVPAGEAYRYYSYYLPG
YEAVDEEAERASGGKGQPFVI
>gnl|bykdb|A0A1V5RXW5 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium ADurb.Bin325] (length=541 residues).
MELREYMALLRKWLGLILACMILAGGVAFFVSRQSIPIYQASATVMINQASSPSAAAVYADILTAERLSRTYANLLMSRP
VVDQTAEQLGIEPRSIERSIDVTPVRDTQLLKITVEGPNPWLIARVANTLPEVFIEQNQELLLGRLSQSRANLEQEIANT
EADIARTTDELSRATDDAQKTRLETSLAQYRSTYSTLVANYQQARLAEAQTLDSIVLSEPAIAPERPVRPRTLTNTALAA
VVGALLALGIAFLIEYLDDTIKTPDDIERVTGLSTLGAIARLKDAGSARERIAWLRTSAPESEAYRTLRTNIQFSSVDNP
VRRLLVTSSSPGEGKSTTAANLGVVLAQTGQRVILVDTDLRRPTLHKVFGIPNNTGLTTALLASQDTPIMEQLQPTEVPD
LHILTSGPIPPNPSELLGSQRMAYLIEMLAEIADIIIFDSPPVLAVTDAAVLGRQMDGVLLVVDTGTTREQVLGNAVAEL
QKTGVNILGVALNRLDTRRNGYYYYYYHYYYQEDESGERRKHSSRRGTGVRFRLPWPRKAA
>gnl|bykdb|A0A1W9UQ51 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Anaerolineaceae bacterium 4572_32.2] (length=575 residues).
MNKQVAQYVRLLGKWWWLFVISVIIPAVISYYFTAQQPALYQAKATIMVGASIFQDPNPDQTAIRLGNTLAAAYAELLRQ
GPVVEAVIERLGLERTPEQLAAQIGTGFYSGAQLLEIQVTDTNPEAAALIANALADELIRRSPASGGSDPEQQEFIRRQL
EELEAKVGNVGGQIEELTASLSELTSAAEIQDVQDRIAALEEVKSTYQSTYADLFNSYRAESPNALALFEPAVTPQWPIP
SKAKLIVAVAGAAGLVLALGAILLIEFLDTSLRWEGDGVQSVLGLPVLGAVPQVSRKNALSSDNPPDQPYKVLLLTSPGA
SEGKSFVIANLAVVLAAAGNRVIVVDADMRRPSLHELFDRPNVTGLADVLSDHKVDDEGLLSVPLLETDFDNLYLLPAGR
PPADPATLLTSPRLFALLDSLGSQMDMVLIDSPPVLGPPDAMILATLVEGTVLVVSAGVTRRETIQQAKERLLGFDQREV
NLLGLTVNRAKLDGSYHYSSDQEGGEQKQKGTSRDGAWLTLGEAAARLGVSKDQARRWCKSGRLPATKKWQLWWRIDPGG
LERMLEDTWELKAKV
>gnl|bykdb|A0A2A6REI6 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Candidatus Viridilinea mediisalina] (length=618 residues).
MDNELLRYLFIIRRWAWLIIIGTVLSASAAFLVSREMTPVYQASTTLLINQASASNANADYNAILSSERLARTYASLMLT
RPILEEVIAELELVTTPSALADRITTTPVRDTQLIRVTVEGEDPAQVAAIANRLVTVFVERNEALQGERFVATRASLEQE
LEKLQLEIDTTQAQLNEATGAANAAERSRLQELLAMYRTSYASLLKSIEEVRMAEVQQTNSVHTVEAAAVPEYPVRPRIV
QNTALAALVGLLLMVGVALLLEFLNDRVTSSQQVAELLDTSVLAAVGEIDGQRSMDKLVTLISPHSKFSEAYQMMRVRLE
IARYGHAFKTVLVTSGNQGEGKSITAANLAVVLARAGKRVLLVDADLRRPTTHTYFAHHNLRGLTTALVREGDTPVDFHL
HSTKLNNLLLMPSGPLPSDPAAMLSSPQLVELIEELKTQVDVLVFDSPPLLQVADASMLMQLCDTVVLVATDGKTRTSAL
RHSMQLLEQSGVKLAGVVLNRVRKSRYGYGYGYGYGYGYGYGYEPEPEKLTWRRRLRRMWRRLLGRKAAPQPSTASGVAG
GDWEDLTAIEQMETTHANGQNGHNGHNGQNSQPQPVQQKSDTGRQQSSRSRGRRRSGD
>gnl|bykdb|A0A2E0L5X9 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Anaerolineaceae bacterium] (length=644 residues).
MLRAILRWWWLIVLSVSLGVGVGYIVRSQQPDLYFSEATVIVGADSNNPVPTGVDSTVLDAYSVLIGRNSLLQPVIDDLG
LNISVLDLMELMSLETNRSASLITIGITDTDPERAAAIANRIVDELIRQTSDRATLLDLEFINSQIEDMQNQINNLQSQY
NQLVQEAATITSAFELNQNIEDRGEIEKSIQELRTLLLSLIENAPRSEIQVFEPADPNYFPLTANSVRDLLIAGVAGGVL
ALLTIVLFTYFDDRLQWDEESSAETILGMRILGPLGIIPRNKLPLYVESMPQSIETEAMRQLRARIALAAGGDMPHILTV
VSYDSGEGKTLTTANLALESAQTGLRTLIIDGDMRRGDMHEIFQLPNMYGLGDILQSNEPLANLLPNVLLDSGYENLNII
PAGRSEADPAALLGRTRLNNLIDLLSKRYDAIFIDAVPTIGGSDSVFLGEISDGVIIIVNARRTRLSSLRRSKDELMAAP
NVNILGVVFNRVRLQVTSKYNNTYYRQTPALTPEKLSREMARSGSGLFGMRRHIITTGRGERLFSVSACAARLGVKRRTV
QGWIETGHLQAESRFMRQWIPESAIDMVLSQRITTVEPPTPASGVSEESPDSSNGTHGTPGDLRAQREAILDFVSRPNKS
DSEN
>gnl|bykdb|A0A2E5F6N9 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=511 residues).
MVEQNFDEESSLDLRQYVDALIRWSWVAIIVAVLAGAAAYFYTQSRTPVYQASSLVQIQQTQGSALPTFSDLQLSRALAS
TYKELITTTDILSAVTKELGLSASTGGLRKNISVSILRDTSILRILAMNEDPALAASIANAVAQQFQSQTREKHLADIAE
FMGVAQSQGIRIQDDLLVSQMSSLSSVSIVEPAIVPTAPIYPRVRFTVLVATFLATVSTILAIIVVEFFNDKAKSSEEIE
RRTGLTRIATILRWTPKEIGAKEVTLLSQPRSSHAEAFRQAKVNVQFLSLTPPPKRYLVTSPGPGVGKTTFSVHLATAIA
QEGKNVILIDSDFRRPGVPPYFSLSNQMGLSSLLANPELQLEDLLQSTAIPTLKVLTAGPNPPNSVELLGSSRMEAIMDE
VAARGDILVIDSAPIMAVTDSSILASKQIETVLLVDPNTRMGWLKDCIGALRKADATVLGYIHNRINARRFGYGYTYYNY
YNYYKSYNEGGSDDARAPSFIGRIRNKLFSS
>gnl|bykdb|A0A2E6J6X7 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=512 residues).
MNQNEQEQSIDFKKYIGLAISYSWLIILLPTIVGTGAYFYSQQQTKLYEAKATLLVEQRSSGLSTSISDYSLSARLSKTY
AKLITADPFLDQVRETNGFERLGSVQTRTQENPPLIEIYVRDSDKVLVGEVANAISLNFIDYVIERRLTEIARLQAAASA
QGLSDVQSLVNAQFTALDSLYLLEPVSTPTTPISPDVQQNITFGIMIGLALALGLTFLISNLRDTVRNPDDIRTKFGVSV
LGMVFEWSSKEVNENDLIVDTSPKSSFAEAFKQIRTNLQFAATKSESRVYLTSSPGPGDGKSTLISNLAVAIAQTGKKVL
IVDGDLRRPTLHRRFKNITRDTGLSNYLSDNTETLGAVTQTSGVSGVDVITSGPIPPNPSELLNSPRMKDGIEKAKDIYD
IILVDCPPVLMVADTPIISTVVDMAILVVDSFTTKTSSFGATVETLNNSGVEIAGVIMNKLKKPKFGYGYGYNYGYYYNY
YYYNYKYSLEDTNPESKSSKNPFRIFRSIFNR
>gnl|bykdb|A0A2G6GG97 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=551 residues).
MELKNYFLLIWRWVWLIILGVVIAAIAAFLISKNTAPVYQSTSRLLIDQAPGAGSGNDYTQILVEERLAQTYVELLKTDP
ILEETISQLELPMSVPTLKKMISVSAPQETQIIIIQVEDTNKDRAALIANTLGQVFIFENQKRESLRYADPINNWEERLQ
EIGDQIETIETEINTLNAQGKEITPEESATLSRLETNLNEAQIRYTETFNNLNDLQIKQAKETSNLIQIEEAKPHEIPIR
PRTETNVLLAAAVGGMIAVGIIFLIEYLDDTIKTPDQVLEKTNLATLGAIAIIKDHTIGSGLITQNAPRDPISEAYRIIR
TNLSFSTVDKELKSYLVTSASPGEGKSTTAANLAVVLAQTGKKVVLIDADLRRPIQHKIFNLPNNMGLTTSILDGRTPVT
AHLQQTKISNLGLLTSGPIPPNPSELLNSRRMQDVLKELEDNSDLVIFDTPPVLTVADASIIGPQVNGVLLVINTGRTRQ
EAFINAVDRLRRTGTHIFGAIFNRVKLDRSSYGYYYYSSYEYNAKSKKRRSRRLSKSSRIPSWITSIIKRS
>gnl|bykdb|A0A2N2MEG3 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium HGW-Chloroflexi-6] (length=653 residues).
MEIKHYYMIAQRWAWLLILGLLLGGGGAYIFSSLQEPVYQTTTRVQVVSASRVGGAGTDAYSNFYIENQLAQTYVQTLKS
HSIVDMVAERIGGSVSPDQVQVQIVQGTQLIDITVEDTDPERTALIANTLVDVFIARNVQMQFERFATSEQSLEAQIEQV
DAQIETLKTRSEAVSSAEAQEAIAKTQTEIERLQGEILALQNELDLVKSPGRLPNSLSTPTPSPETRSQINEGTLRLRQL
QSTYDLYQQIYTNLVVLGQNRAVGEADTEQEQMQSTLALYRQIRANLLSSYESIRLARLSSTSNIVAIDLAQVPSSPIRP
QPLSTAGLGAAVGLMLAAAIVFLIEYLDDTIRSADQAVEALGLPVIGYIAELEHDQDKAYVSENPRSPAAEAFRTLRTNL
EFASVDKPIKTLLVVSAHPGEGKTTVATNLAVTIAQGGKRVLLIDADLRRPRVHHHLGLNNRVGLSNLFRDSIAIGDVAH
AWQDSNLSVITSGGVPPNPADLLASERMAAILESANKLFDMVIVDAPPFLVADASILAARADGVVLVIRPGKTPLDAAMT
TLEQMKRAGANILGVVLNRIPRNRPNYYGGYRHYSGYYKGEYSYHNYYDEGSSSNQRAYRGNGNGNGKSKMTSWFGRAKK
APGEAPAQEQEKQ
>gnl|bykdb|A0A2N2MEK3 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium HGW-Chloroflexi-6] (length=624 residues).
MEIKHYLGMLQRWAWLLALGLILGGVGSYLFSVNQSPVYQSSTKLLVIRAPQGQNSDLAYLASQQLAQTFIQLLKTKPVL
DSASAELGYHISSGQIKAEQLRDTQVITLTVEDNDAGHAAAIANTLVGVLVAQNDSLQSSRYLTSEEGLQAQVEQVGAQI
DQLQEQINRLTMENVEEQIGQAETKIAELQSEIASLENDIFYTTNRGRNPDLAPTEWTARLAQLKSTLELYQQIYANLLV
LGKPTSSGASDRLTHLQKTLELYQQIYLQLLGSLEEVRLARLQNTPSIVQIEEAAVPGSPVRPLPFKTAMLGAAVGLMLG
FGIAFAIEYLDDSLRSPMDVDQVLGLPVLGYIADMKPANGPRQLHVAAFPRSPAAEAFRNLRSSIEFSGEDRPPKTLLVT
SSRPGEGKTTVASNLAAIFAQSGKRVVLVDADLRRPSVHRALGIPNRLGLTTLFRDSLKLESVWKHSNGISRGMLVITSG
SLPANPSELLGSEKMLHILAELRQKADIIIFDGPPMMVADAQILASLMDGVLLVLQPGKSPADEAKSTLAQLKRSGAKVI
GTVFNRVPKNGGQHYGGYRYYSTDSYNTYEQKKPATPIRVMAPVPAAFEPTTRPNGHHSVELVN
>gnl|bykdb|A0A2N2MJJ0 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium HGW-Chloroflexi-6] (length=622 residues).
MEENNDNDTLEFDLIDAASLRRMGGLLWRNAWIIALAGLLLGLAAFIFGRMQAPVYEARTQVLVSRPSMQSQIVDITQSM
NSQQITQTYVEMFKLASVRQAAAEHLQIEIKPGQVSVSALTNTQIVEIVVEDTNPALAGEIADTLVDVLIEKNDAIQSER
YTNSEQSLSTQIADVEGQIADLQEKITVRSAEVLEEQKTNFESQISDTRAQIAELESEIASLPAESTSLAAEKRSQVEQL
QSLLRSYESAYNTLMVQKKILAADDEELTQLEKTFNLYQQIYLNLLNNREALRLARLQNTLTVAKIDAAQVNPAPIRPRT
TLNTLLGGLAGLILAVSIIFLRDFLDDTIKSREDVKRMFGLTTLGQIPEHGAAKETGLFIASQPRSPVSETYRALRTNLE
FASVDNPLKTILVTSAGPGEGKSTVACNLAGALAQAGKKVLLIDTDLRRPRIHQYLGLGNRFGLSDLFLSHGKLADVTQV
YEGPNNTHFEVVTTGAIPPNPGELLSSERMKTLLAEAVKNSEIVILDSAPSLVADSQSVSASADGIIIVVEAGGTRAEPV
RAMLESLRRTHTRILGLVINRMKAHHGEYGHYSNSYYQDDIEGNNGKKSRLRLPWAKKVQQD
>gnl|bykdb|A0A2U2S5W9 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Ardenticatenia bacterium] (length=572 residues).
MTLRQYFAVIWRWLWLIVLAGAVAGGAAYASSQSMPRVYQSTTTLMVGQKVMRDPNVTAQDLYVSQQLAQTYIQMATRQP
ILQATIEALGLKEDWTSLRGRVNASPVQGTALLQVSVLDTSPEWAVAIADEIARQMILQSPTAPEEAQRAKHRAFVEQQI
ADLQAKIEAAQQQVAELEKQLGGAFSARQIQDLQGQINVLQNQINTWQANYAQLLNFIEGGSPNYLAVIEPAQLPTEPVS
PRTSMNVLLAASIGVLLALGAAFLLDYLDDTIKSPDDLVTTAGLTPLGAITRMRGEGYENKLVTMRHPRSSVAEAYRTLR
TNIQFSTLDKPARTLLVTSPSALEGKSVTSANLAVSMAQAGFKTVLVDADLRRPVQHKIFGLSNQQGLTNALLQPGEPSA
DGHLQSTEIENLRVLTSGPIPPNPSELLGSAKMQALLQRLKEEYEVVIFDSPPALVVTDASVLATRVDGVVIVTDSGHTR
RDTVVRAREALRKVGANLLGGVVNRLSPRSGGYYYYYYYYYAADGNGEQKRKRKKKHTNHSEQGGFLRGLFGRSQEHTGS
SGEGRTENVQHS
>gnl|bykdb|A0A326UPN3 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Thermosporothrix hazakensis] (length=534 residues).
MRISLSRYILLAKKWVWLVVVGVVICGVGTFAVSKLFIKPTYKASASIVVTLQTSSSPSDNATAALTLLPTYIELVTNPT
VLQPVVSKYHMQSANELASKISVKQIGGTQVIEVTVSDEDPKMATNITNDVAQNFAQYQNTQLGGVSQLRVVPAIEPTRP
SKPQPTQDAIVGALVGFGLAIALIVVFEWLDDRVPNPEEMQKLLEADALTIIPELSKNQQGKNAEDTPELAEGCRVLCSN
IATAQTQQPFKLIMLTSALAGEGKSTIAANLATFLAMSGKRVLLVDADLRNPVLDKHFHINNQNGLAQILMGVWGNNEMA
LDGIPTEIPTLRLMPAGTRPQNPAELLISDTARRLFKHYQDTNRFDYVIFDTPPLLPVADAQIVASYAEVSVLVVAASRS
PRRLLNRAMQILRRTGTRVLGLAINRSQWPEYGDIHDYRGSVQTQGAPLLKAAPAAQQRVPQQASPVANQPQMQPAQMQP
MQQMQPGHQMAPNSPSMMPNAPSMAPGSAPMMPPLNGSRGLLSQQQPQQNNQRR
>gnl|bykdb|A0A353RQ31 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Anaerolineaceae bacterium] (length=622 residues).
MDIKHFFNIAKRWLWLVIAGVIIGAAVGYFVSSRQTPIYEASSKFVILRAPQTTYDYYAYLDNQQLISTYVQLLSTESVL
QKASDELGFPIYKGQATASPITDTQFVVLTVRHTEPEKAALIANGLINVLIDENEQLQAIRYISAEQNLQNRIDETQQQI
SLLEKQINELSTATVESQLESVQKQILETQSQMTALNVEVAKINPATATEEEKARLAEYQAQLDQLSSVLSLYQQIYTNL
VVLKTPAESGTTTATSAQLTQLQTTLNLYQQIYLSSINSLEALRLSRAQNTPNVVQVEEAQIPSVPISPKPGQTALLAGA
VGLILTAGAAFLIEYLDDTIKTPDEVKEILNIPVIGLIGELHKKNKDDKLGNYVVYHQRSPVAEAFRALRTNLEFSSLDF
SLKSILVTSSGETEGKTTVACNLAIILAQGGNRVLLMDTDMRRPNVHVQFNLHNRIGLSDLVRGKLSLHEVVRSIPEVKN
MDIITSGSLPPNPAELLASERMRNLLDELKKSYDVIVLDSPPLIVSDSQILATRVEGVLYVIVPGSTRIESAKRPLEELE
RINAHLLGVVMNRIPHNRSYYYGGYDYYSPYSSRDKYRHSYGSEESTEVALTEQKGNKVLHH
>gnl|bykdb|A0A359HML3 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=583 residues).
MDIAELIYPLRRWWWLIVLATVIAAGASFAVARQQPPTYQSRATLMIGRTIENPNPTSVQFSLEEQLAVSYANIANREPL
RDATMEALGLDWLPEYSVTAVPNTQLIEIVVVDTDPQRAQIVASEIANQLILGSPTSTNQADVERQAFISQQLDTLQKQI
TDTQAELEDLSQLLGELNSAREISDTQNQISSLKNSLASLQLNYANLLSNTEKGAINTLTIIEQPHVPTSPVGSKMLVTV
GLSAAVGFTLAAAAAYLLEFLDKTIKTVDEVKRLIKAPILGYIPEIPRKEDRWHFVTNHPRSPISDAFRNLRINVDLLGV
ETKTIMISGSAISEGKSTIALNYAQIATQANKKVVFVDGDLRKSKMKEALKLEQDTGLSTLLNSPAKLKDVVFTLDQRLT
IIPSGSCPPNPTELLGSEKMDRILTHIKGMADLIVVDSPPLFVTDAAVLAKKVDGILLVVQLGKSRRDTVKEMMVQIERT
GTSVLGVIINKISSGSNYYSKYYGSYYNIPDSEQNDADISETEIENNPQEPGVETDATSEPPKDEMKPDPEIILNEQNRE
ISSHSEDVPQGRNPKLRGLLTFG
>gnl|bykdb|A0A363SX22 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Anaerolineales bacterium] (length=514 residues).
MELISFLKIFLKRWWIIVLIFLVTVGSTAIFTWRQNPTYSVTTTFVVSPSSTIFSDPRSFLSGLDVLGGRVSVANTYSDI
ATSRRIKNDTIDALGLNPVQAETLDVGSKILAGTNVIYITVEGPDPSLITTFANKLGETTVKYVEELYGVYDLKILDLAE
IPVFPIKPNWKLNLALAAVLSLAVGMGISFLVEYMDDTLREPDEISQLFQAPLIGFIPVMSKAAAHSLYMVKLPQSVVAE
AFRSLRTNLEFASVDKPLKTILVTSNGSSDGKSSIATNLAVAFAQSGKKVVLLDADLRRPSLHGFFSIPNQTGISDIIRG
QVSLEEAIYRSAKGGVALILAGPLPPNPAEMLGSKKMENILASLEEIADVVILDSAPLLVADAWALSAKVDGVVLVVEPG
RLKRKTAQAIMDRIQLSRVRIVGLVLNRVKKGSESDYYSGYLADASKYDSQASNKRKANLQDIQSTSGLGLSLIPKKTPG
NSHRFRNAQKQNKPTPINEPNSGEINRNISNKLL
>gnl|bykdb|A0A3A0AXU8 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=607 residues).
MELLTYWKILRKRLLLIVLLILVAEFGAVYYVVSRVPLYSTTTTMIITPSAMGSLLSYQVNLTLGPLANTYIQYMGTRSF
GEMVAARMPVEISSAEVLRSIQAEFVRDTQIFRITATHRNPEVAQMLANTTAQMLIDANTERQLSQQEARLAAQRSPEAL
ARQKQMNDLIAVLQDELNYYDDQIRTLDNEIRNLEQGPQSVETTQRTLELRDRILQYRTERIGVLTSLAETQNALSSAFE
EPSSDVDTIVVVDPALLPVVARQRDFLQPMVAALVAALALGFGLAWLLEYLDYTVKTPEELDELFGMPTQGAIAGVGGGN
GDQGRGLALVTATDPRSPVAEAFRALRTSVRMAGVDGPVHSLMVTSAGPGEGKTFVASNLAVVFAQEGRRTILVDLDLRK
PQVGARFGLRREPGFSNLVVDRELAVEHCLQATAIPHLLVIAAGTIPPHPSELLGSVRAGEVIEQIKALADMVIFDTAPA
ATVTDALLVVPHMDGALQVVDAGSTRRDLALRCKALLERAGARLLGPVLNRVEAGDLGYYANYYSYGGYYHEEAEEAKGG
FWRGRGGRRAAPVRESALPAAPQPARPAVASRMAGAREKGGRVSDGG
>gnl|bykdb|A0A3A0B2P8 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=561 residues).
MEELNLRLLLRPLLKWWWLIAACTLLAGVSSGLYTLRQPRTYLSRTTIMVGSSLLEPNPNSNDLYLAGQLASAYADIVQR
STVRDATQAALGLGWLPYYTARLVPNTQLIELSVVDTDPVRAQAVAAELVNQLLQIGPGMQEGSEYQAFIADQLDQMEKG
ITETTAEIERVKTELTGMFSARQIQDARSQITALEAKLATLQANFANLLANSRQGAINTIHVLEPANLPTTPMSRGLKTN
VAVAAALGFALAAAAAYTMYYLDNTLQNEDDIQDHLALPALGLVPKNHAAEGRAGLEGDDERAALNDAFSALRLNIQAAL
GGDVPKTLLVGSPAVGDGKSSVAANLALAFVEAGYRALLVDADLRRPSLHRQFNLPNQRGLTTLLLGEEHNLELLIQQPA
QQRLSLLTSGPLPPNPTRLLSRKELRGVLAEMAQKFDIVLLDTPPLTATVDASILATHVEAMLLVVAAGRTQRTPTQRVV
KSLRHLQVNLLGVVLNAVPVSQTVYHAGYGYAVPRAADAEGTRRGALQIQANGQAGAHTLPALQEGIKPASNPLYQALRK
R
>gnl|bykdb|A0A3A4VPK9 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Anaerolineaceae bacterium] (length=597 residues).
MEDETIDLRQYGLLLKRWSWLLVLSLVIGAATGLIVSLLSTPIFQSTAKVMITRAGQDQSSDVTAYLTTNQQTQTYLQLL
QTESILNIVSERLGFELDEDAIDTKAIIDTQIIEINVEDPDPQRAALTADMLVEVLIEQNELISSERYDLMEESLSAQKA
QIESQIADLQNQINHASIKTIEEQEQWIQEQINVLQQESETLPVEISQMGNPATPEERDALEQKKARLEQVELLLPLYEQ
SYTDLIVYGKQVDGANTSAGSQLTLLNTTQSLYQQIYVSVLNNLESVRLAKLQNMPNVVQIQPAIVPDDPVRPRTMLNSV
LGGIIALILSAGFLILKENLDTTMKTSAQVEELLKLNVIGYIAEMQNSNGETIGLYTTNQPRSPIAEAFRSLRTNIEFSS
IDKPIRTILVTSPEVSTGKTIISTNLAAIYAQKGEKVLLLDADLRRPRVHKTMGITNHIGLTDLLRGSHDLQDVIQKMDG
AENLTIVSSGSLPPNPAELLGSARMEQILLELGNKYNIIVIDSPPSIVADSQILSSKVDAVLLVIQPGKTSKEAAKATED
LIKRAGGHIIGVVFNRIPRDRVDYYSGNYQYQYYSKD
>gnl|bykdb|A0A3B9J9U6 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Anaerolineae bacterium] (length=585 residues).
MEIKHYLGMLQRWAWLLALGLILGGTASYLFSVNQSSVYQSSTKLLVIRAPQGQNSDLAYLASQQLAQTFIQLLKTKPVL
DSASAELGYRISSNQIKAEQLRDTQVITLTVEDNDAGRAAAIANTLVGVLVAQNDSLQSSRYLTSEEGLQAQVGQVGGQI
DQLQEQINRLTMENVEEQIVQAEAKIAQLQSEIASLENDIYYTTNRGRTPDLAPTEWTARLAQLKSTLELYQQIYANLLV
LGKPTSSGASDRLTHLQKTLELYQQIYLQLLGSLEEVRLARLQNTPSIVQIEEAAVPGSPVRPLPFQTAMLGAAVGLMLA
FGIAFAIEYLDESLRSPMDVDQVLGLPVLGYIADMKPAEGPRQLHVAAFPRSPAAEAFRNLRSSIEFSGEDQPPRTLLVT
SSRPGEGKTTVASNLAAIFAQSGKRVVLVDADLRRPSVHRALGIPNRLGLTTLFRDSLKLESVWKHSNGISRGMLVITSG
SLPANPSELLGSEKMLHILAELRQKADVIIFDGPPMMVSDAQILASLMDGVLLVLQPGKSPADEAKSTLAQLKRSGAKVI
GTVFNRVPKNGSQHYGGYRYYSTDS
>gnl|bykdb|A0A3B9KNR2 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Anaerolineaceae bacterium] (length=617 residues).
MDIKHFFSIAKRWLWLVIAGVIIGAAVGYFVSSRQTPIYEASSKFVILRAPQTTYDYYAYLDNQQLIATYVQLLSTESVL
QQASEELGFPVLKGQATARAITDTQFVELTVRHTDPEKAALIANSLIDILIEQNEQLQAIRYIAAEQNLQNRIDETQQQI
SLLEKQINELSTATVESQLESVQKQILETQSQMTALNAEVAKINPATATAEELTRLAEYQAQLDQLSSVLSLYQQIYTNL
VVLKTPAESGTTTATSAQLTQLQTTLNLYQQIYLSSINSLEALRLSRAQNTPNVVQVEKAHPPSVPISPNPVQSATLSAA
IGLILTSGIAFLVEYLDDTLKTPDEVKELLNLPVIGLVGELRKKSNNDKFGSYVISNPRSPVAEAFRALRTNLEFAGIDS
PLKSILVTSSGETEGKTTVACNLAVILAQGGKKVLLLDTDMRRPNVHTQFNLHNRVGLSDLVRGRLTLEEVVRTIPEVKS
MDIITSGSLPPNPAELLASERMRKLLEELKSHYDVIVMDSPPLVVSDSQILSTRVEGVLYVIIPGFTRIDSARRPLEELE
RINAHILGVVMNRIPQNRSYYYGGHDYYSPYSARDKYRHSYGSEENIDLAFTEQKGT
>gnl|bykdb|A0A3B9Q1T8 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Anaerolineaceae bacterium] (length=619 residues).
MDIRRILYLLKRWSWLLIIVTLISGVAGYYFSSQQTPMYRASTRFVIMQPASTDSDNLSLVEIQQQITTYSQLISSTDLI
NQVSTELGFPVDQKQLEVEQIGDSQFVRLTVTNEDPFKTAVIANALIDALIQNNERLQSLRFESTEANLQRRAEDALQQM
EELQNRIDQVTEKNVQEQLITVQSEIETLQSQVTDLELNIASIDPLYATDEELQQRIQFQAELGQTQSILDLYQELYTQL
VVLGKPIDQENPSSRQSDRLERTLSLYEQIYFSTLNSLEALNLARDQNKPTVAQIEAAAVPVEPFFPRPIETGLLYGAVG
LFAVGGLVFLIEYLDDTIRTPDEAEQILGQPVIGTIGDINSSLLKRGGKKSGVHVANQPRSPIAEAFRSLRTKLEFYNID
QPLKVLLVTSAGLEEGKTTVAANLAAIMANNNKNVLLIDADMRKPKIHTHLGLSNRYGLSDLILGRSASVVQRAGSNKKF
SVVTSGSIPPNPSELLASEKFTRIIDKVSQQFDMVVIDSPPGFVTDAQILGTKVDGVIFVIRAGKTRANIARMSLDEFNR
VGAKVVGLVMNRVPRNQRYYYGGYQYYGLKGEVNAAYDQGDPSENTVDLQKEGIQRMDN
>gnl|bykdb|A0A3C0LJ76 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=564 residues).
MDNRELQMYLRPLLRWWWLILLSALLAGASAFVFVRLRPPVYIASGTVMVGTAIQERNPDSQQLSLTQGLAQTYVKIAQR
PSIREATRKALGMDWLPEYSVRIVPDSQLIEISVTDVDAQRAYAVATELINQLILLSPGGQERQQREVFIQEQLRKLEQG
MRDTEAEIVRKRDELSSLLSARQIGQTETQISALEAKLTTLRSTYVGLLASTDQGSINTINVLDPPVVPTEPVNDRWYLL
VLVAAIIGATVAIAGAYLLEFLDDRLVDIEQILQVTGLTTLGTVPEIKLDTASQGLVMLQNPHSTDAEAIRVLRTNLLFA
SVDHKLSSLLVTSPTPGEGKSFISSNLAVAFAQTGKRVILVDADLRKPTLHRVFGLVNNIGVTSALVSDAADVEAALQAT
ATPELRVMTSGPLPPNPSELLSSHKMQELLTHLQSLCDVVIIDSPPVLVVSDTAVLASRADGVLLAFTHEKLRRDPARNT
IGALRQVQARILGVVLNRVEGSQHGYYYSYHKSYGNRYYTTPYSQHKPKSGKRSAPTARTVSQPGANGAGATHVTEAAPS
KKRA
>gnl|bykdb|A0A3C0XJG2 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=533 residues).
MDDSSRGVPGFARARVLFMFRRWGPLIALATVVAGGTAFAVSEVLPKEYSATSQLYVAPAANPTAALQDAVLGQNLAPSY
VQLAQSEVVLRRARDKVSWPDSKSFRERTQVAQVRNTSIIAVSFRDRDPQRAAEIADLIANSFVEQVRALQSSLQSTTAT
QLDEEISSVEADRQRIDDELSRLRAALAALPAFPQGPPADLRSQISQLESTGTARQDTLAQLMRTRDDLRLVAARAENTV
TVWEPAVAPTDPESPRVALNTILGAIAGGLLTLTGIAVFTYMVDRITDVDEVSERLGVPALGEIPFANEQTLGAHGLFVR
DAPASPEAEAFRAVRANLVLAALDRPPRTIMVTSALSDEGKSLVAANLALAFAESGSLTVLVDADMRKPMQHLLYGLDST
VGLADLLRETVPLADIRKFEVMPNLIVLPTGRPPLNPAEPLSSTKMLSLILSLSQLADAATVVIDTSPVLAVADAHALST
MVDGCVVVVDSARTPARASRRAVDVLNAVHARILGVVLNKVPAIQLDYYQSYA
>gnl|bykdb|A0A3D0CW53 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=567 residues).
MELKEYASVLWKWLWLIIVAMLIAAVSSYWASLRMQPIYQTSTTLMVGQFIQNPNPTDQDLRISQQLAQSYARLLRRQMI
LQTTIDALGLQIPWQALAGRVSAASAPGSQLIQINVVDGDPQRARLLADEIAHQLILHSPTTPEKEQEQYRQFVNQQLLT
LQTRIEDAQKQVDELEKQLALESSARAIQDIQGQIGALQQTITTWQATYASLLDFSKGSRTNYLSVVEPAVVPTTPISPN
IQRNVSLATAIAFVLAAMAALLLEYLDDTLKSDEDVDRILKLPTLGATTRIPKIQQPSDHLVTVHSPRDPITEEYRVLRT
NIQFTGLSNRSTTLLITSAALGEGKTTIAANLAVIMAMAGKRVILVDGDLRRPSVHRFFGIPNRLGLTNLLVDEALALET
VLMETPVAGLKIIPSGPVPPNPAELLSSERMKQRGNEMKELADVIIFDSPPALVVTDATILGTLSSGIVYVVNAGRTRSG
VVRRGKETLDQVGLKILGVVLNNSTSHRARGYYYQRYYYSHESTGERRGRRLRAGAVSHRFAVNGQGTGQLKSSTTDHPT
TSEDDVR
>gnl|bykdb|A0A3D0D4X6 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=546 residues).
MELRQYARIVWKWLWLIVICTAVSGAIAYVVSINTAPVYQATASLLIREGKDPESTTYTDLLTSERLARTYSERLQSRPV
LEETARALGLQQDLGTLKVKITVQPVRDTQLIRLTVEHTDPALAQAIANTIPQVFANRNAEQQSERFAASKESLQRQLDT
LAGDIEDAQGRLTRERAANPRNEDEIDRLESRVTQLRNTQSSLVQSFEQVRLAEATSLNSIIVDEPAALPTKPVRPRPLT
NTLLAAVVGAMIGLGTAFLIEYLDERVRDPAMVESLVGLPILGQITELPHEHSTPAQAVILANAPRSPLAEAYRMLRTNL
QFAMVDRPLHILVVTSPGPREGKSVTSANLAVAVAQTGARVILVDADLRRPSQHTLFTLPNQTGLTSAIVSDEVDLQALL
KPTTMSGLSVMTSGPIPPNPAELLNSERMSHLLQELAAQAELVILDTPPTLAATDAAILAAKADGTLLVIDTNLTKRTEL
VHTTEQLQRVGATLLGATLNRLRRHNLAGYYYYYYDVSSDHNESGPAPAQRRKRKGFLGSARHTAE
>gnl|bykdb|A0A3D0UNQ0 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=580 residues).
MDELNDFVEIRHYISIFLRRWWLVLLTALVAAGIGYVVSQSQDRVYRATTSVIVGQSIQATQLDSRDIQTSERLALTYAD
IARRQPVLEAVIVSLDLDYAWQNLRNRVRVDLVPDTQLLEISVDASSREEAISIADELAQQLILISPTSLQSPEDENARL
FVQERLQDLQKKIEASQARLDELASAMDVAPTPEEKSQIQAEMNDLEGILVEWENTYARFLQFIGGEESANYIAVVDKAH
ARLNPVRPTIRLNTLVAGLVGFILALGVIFILDYLDDTVKTVDDISQDLNLTPLGTIGQYGNGKFQGRMIVSEDPRSPVA
ESYRIIRSNIQFMFIDNPGRAILVTSAVPGDGKSTTAVNLAIAMAHNEKRTVIVDADLRNSELHEIFGVSNSNGLTEQLR
QPESQKKIHLFDTKVEGLQLLTAGEPPPNPSELLGSQRMVKLVDTLNSEADVVIFDSPPAAYVTDAAILSRLVDGVVLVI
SAGKTRRDEARQAIFNLEQAGANILGVVLNGMAEKRGGYYYRYGSSPHDQSLIGNRIRAGLQQARNTLTSAYERLRKKED
VIQDSTQLPDEGKEMTHNIP
>gnl|bykdb|A0A3D1JCW0 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Anaerolinea thermolimosa] (length=594 residues).
MEHFDGEESTLNTGDTDLRKYLWLLWQWAWLIGLATLLAAGAAFIVSELQTPVYQASTTILVNEAPSTQSSNYSAIYLTS
QQLTKTYAEMLTKKPLLDKVRQNLGLSENVEFDVKVNFIRDTQLVQLLVEHTDPFLAANVANEMVAVFSEDIRNLQQSKY
AASKENLKAQLDYLDQQIVENQNALDAIIQNNLKQLQSSGENVEAQPTAALLERARMLNAAEIDRLETRISQYRQLYASI
LSSYEQIRLAEAQTTTSFIQVEPATPPEKPIRPRTLLNTALAAVVGLMLAIGGVFAIDFLDDTLHDPESITTLSGLPILA
SISEHEVEDGGPITQAHPRSPVSEAFRSLRTNVQYSSVDRPLRRIIVTSPTPEDGKTTIVANLAVVLAQGGINTLLLDAD
LRRPRLHKIFKCENKLGLSSLFVQPMDGLEKVIVHSQRTEGLHLITSGGTPPNPAELLGSQKMKEILNRLSQSFDTLLLD
TPPVLTVTDTVALSKAVDGILIVVRLGKTKRGEFLQAIEHLRQVNANLVGVVINGVSPRHARYHYYYRNYYYYQYSAYYG
EGEKRKPSSNGSRSNGKHAPVPHPAGESAPREPL
>gnl|bykdb|A0A3D1TRD4 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=530 residues).
MALIAPPMRYTDAGSVTWPAGLSQYSASDTSSADQFNRRYGESMLPNIDYLVWVRRWLWLVLLGTLLGGGIAFGIAATTA
PTYQSSATLLINASSTPNALTYTDVLLSQQLTLTYSKIAVQDPVLAQVIQEGHLPFTVIQLQKMVSAAPVLQTQLITITA
NTHDAKQAATIANLVANVFITQQHDRMAKGDASNAVSVVAPAQVPASPVSPRVKLDTVLGMVVGLLAAVGFIALVTYFDD
TIKSHNDVDRALQLPVLGLVQRNVGQAVVTVGADSVAQDRHSAEVFRVVRANLGFATASYRSKILLVTSTQKAEGKTTTI
AKLAVALAEAGKRVVLVDADLRLSSLHRMFKLDNRRGLSNLLVDPVASPAELLPYLQQTPLPTLRVLTAGVMPPNPTELL
QSENMATLLAMLAELADVVLIDSPPVLAVADAMTIAPNVQGILFIIESGSIRLGRLNEALGRLRRSGTPILGVILNKVKA
DTEGYYYYAYDGYYSSSGKPATEHVNGVIEVVEHGAAPVGDGKSGSRRQG
>gnl|bykdb|A0A3D1U3H5 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=575 residues).
MGSLNRRQEFDSVGIALNPATQALDAEQSSGDRAALLRWYYHLVRRWIWLIVLVTIAAGVTGYSVTTLFIKPTYVATATL
QVDAGQLSSDVNGTGVIASQQLADTEARLVVTQPVAVKAYKALHLHLPLTPSTLLGGATASSDVNSQLVTLSVSSHDRVF
AARAANALAYAAQQSEQQHQMSRFSAAIDAIDRQISSYQKDMASATKKQAQAGGAGNAQTQDLTREIDQDRTAINNLQTQ
LVTLQSTEAQTSANLDVRVPAQVPHFPSSPHPVRSAAIAAFLALLAATGLLFAREYFAGTLRNPEEFQALMSGAPVLGVV
GDLNRETKRPGLSVTENRRSLGAEMYRMVRTNLLFSGADAANKVILMTSCGEGEGKTTTSMNVAMVMAEIGRKVLLIDAD
LRRPHIHQVAGIENRGGLTALLLGMDGGDIMTSTVQSEADPHLYFLPSGPIPPNPTALLSSQRMRDLLHAFKQSFDTIIV
DSPPLLAVTDSAVLSTMADRVVLVADPRKATRHTLLRAKDVLERVGSRVSGVVLNRVGEESSGYYGYYYYGGYSAYVTDG
QKVSSGSRNGKRAAK
>gnl|bykdb|A0A3M1EAN8 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Caldilineae bacterium] (length=481 residues).
MELKQYLLILWKRVWLLIAAPLLAGAISYAASLRMVPVYRASATLLVSPSGESAALNYSSLLASERVAKTYAELLTKRPL
LEQVIANLHLSLTPRQLAGKINVAQPADTQLLELQVEDSNPQLAVAIANNIADTFVAQHEKRRDDLAVYIEVVEPASMPA
YKLRPRPYFNTFVGALSAFLLAVVFIFFMHHLDESLTYTEAEEVLQIPTLATIPPLPAKSPLHRRRARSLPLSMLEPLSA
YAEAYRTLRTNLRFAGNGSPPGALLITSALPGEGKTTVAANLGTVMAQAGRKVLLVDADLRHPDLHRLFDVPNRRGVADL
LLNGQLPDETWLVETSQPRLYLLPGGPFTADPRSPTPAELFDATRLQALLDHLRFLAEVIIVDSSPVLEVPDGLELAALV
DGVLLAMQNGRSGRYEVQDAVRRLQYARAELLGTVLTRCQGRGGYTYTVHPAPAPHTPKVVPLVAPPDGKETLFPPEQHP
G
>gnl|bykdb|A0A3M1EJ46 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=578 residues).
MINEDQMELRHYLAVLWTWVWLLLLAPLLAAGISLAVSMHIQPVYRASATLLISQASGPSLDSNSYNSLLTSERVAKTYA
QLLTKRPLLEQVISDLHLKLTPYQLAGKIEVIQPANTQLLELYVEDSDPEQAVAIANGIATLFMQQNARRQGDSSGLTGY
EEMLAKQIAEVERDIQALEAERAQINRGGSNSRSLPTAQNADTDTSSLEASAKDGRQQALAEESARLAEVASLDAALQEA
RGSYARLLESYLQVKSATGGSVVISIVEPAAMPARKVKPRVYFNTFVAGVVGLILAIGFIFLLDHLDDTLSRPEGVEQAL
RIPTLAAIPAVRMRTSKNGNPFAANHPTSPFAEAHRTLRTNVQFSSGDVTAETLLITSALPRAGKTTTVANLGVVMAQAG
MKVLLIDTDLRAGNLHQVFGVPDRPGLTDLLLSNAVPDESMLLKTEVLNLYLLPSGPLPPTPSELLSSDRMVSLIEHFRG
RVDVLLMDSPPVLAVTDAAILASLVDGVLLVIESGRTSKGEAQRALHTLQAVGGRVLGAVLTRSKAEGIGYRYDRRGVTP
SQLADMVSMLTPSGKGLS
>gnl|bykdb|A0A3M1H759 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=538 residues).
MAELRRYRNIVRWWWLVLLSTVIAAGASYYISDQQPRIYASTTTLMVGQAIAKANPSDQDLYLADQLANVYAQMAEREPI
LQATIDALALDVEWDVLGGQVSAFHPSQSQFLSVTVQDTSPERAAVIADEIARQLILQSPTSPQNKARQERAGFVQAQLD
DLERRIQDAQAEVKKLEAELETAFSARQIRDLQSDIASWQSLINEWQRTYTNLLDFLQGGDSPNYLSVVEPAVVPDTPIS
PNIPQNVMLAAATGFLLALGAAFMLEYIDSTIKTSDDLSPSLGLTPLGSIARIKGKGYADRLVTLHNPFSAASEAYRVLR
SNIQFMAGEQPPKTIMLTSTTPEEGKSLTAANLSVVMAQADFKTILVDADLRKPSIHKIFEISNSQGLSDLISNPDMEPE
AVLQDTTVKNLRVLTSGPLPPNPAEKLSSQRMSQLVHLLEETADVVIFDTTPVMAVTDAAVLANRVDGVILVIRSGRIPR
ATLKKAVARLKQIRANILGAIVNQTPGKGDGYAEYFTPLAQIQTETAKRPWWKPSFLR
>gnl|bykdb|A0A3M1LAM5 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=668 residues).
MSMTFSWRLVWRLVKQWWWLLVVGAVLAGGTGYYFASKKPNIYAARTTLMVGANIRNPDPNSRDFGLTVTLAQIYGEMAK
RRPITQAVVDRLDLPMEWWDLAGRIETRVNPTAQLLEITVFDTDPQVAALLANAVAEELVRQSPASQEGVERDFVLKELN
DTQAKIEEAQAQIDQLRDKMLGMTSAVELSEAQARLAELEQLKSNYRADYVRLANLLNTQSPNTLTIMEPASPSRRPIAP
NPKKSAAIAAVAGLILAVGAVILLEFFDDTIYWYGEQESIVGARLLGTIGRFPAKSDKVIVRRAPRSPAAEMVRQLRSKI
LLAQPGRTFRTLLVTSAAPQDGKTVAVANLGAAMASAGMRTVVVDADFRAPSLHESFDLPNVLGLAELLSAGRDEYQALL
DKALLETNVERLTLLPAGRPPLDPTMLLTSPRFPELLDLLLERFDAIVMDSPPVLLAPDAVILATRADGTVMVVSAEHTS
RQAARRAIKVLRDQEGVNFLGVVVNRIPLHHYAYYLPPQVTGEAAAVSLPRRVWRRLTGFLKPIRRRLGLGRERIHEDGR
VLLSLAEAAHLLGVRKETARRWCASGRLPAVKRGLRWWVEEEALQAMLNVQLGWDPDGWRQVVREQARGVTGHRGAEAPG
QPGDAAPAMEPVAVDSNLVREEDADGPA
>gnl|bykdb|A0A3M1ZZ81 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Chloroflexi bacterium] (length=547 residues).
MEIRQYIRLIWRWLWLIILGAIIAGGTAYVISKNTVPIYRASSRLLIDEAPGSGSNNEYAELLVEQRLTQTYLQILSTRP
VMEETITRLNLPYTPEQLAAKVSASSPQDTQIIIISVEDPNPELAAQIANTLGEVFIEQNRERESLRYAEPIQNWETRLD
EIGNEIQAIETEINALGTPETPEEEAELSRKDTKLKELQIQYTEAFNNLNQLRVSQAKESSNIVPIEPAQPPQRPIRPRT
FTNTIMATIIGGMVALGFVFLMEYLDDTIKTPDDVLADTNLPTLGAIAFIKGSAPNQRLITHHTPRDPISEAYRVLRTNL
TFSAVDSELHSLLITSSSPGEGKSTTTANLAVVMAQTGKQVILVDADLRRPTQHKIFQLSNNQGLTTAILDSLTPVSYHL
QKTRVPGLRVMTSGPIPPNPAELLNSHRMKQVLEALQQEADLIIFDTPPVLTVADAAILAPRVNGCVVVAEAGSTRRPLF
LQAIERLARTGTNLYGVVMNRSKPGRASYYDDYYYYATYEYVEGRRKKRRRRSRSLLPGWITAIIKR
>gnl|bykdb|A0A401ZA55 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Dictyobacter aurantiacus] (length=478 residues).
MRSTLSRYILLAKRWAWVIILGMVICGGTTYLVTKLLMQPVYEAQTRILITLAGTSQNDSTLAAIAQQSTYSQLVTNPNV
LAPVAAKHNMELKQLTGMVKTQSATNSPIIDILVDSSNPQLAATLSKEVAQSFTSYATSHLASQANFNTIDPVVPTDPVR
PRPSQDSLIGALIGLGLALAIIVIFEWIDDRLTAPEEVNKLLGIDALTIIPELSRKQRSRNAEDTPELAEGCRILCANLN
MAQMMRPFKLVMVTSPMAGEGKSTIAANMASFLAMSGKRVLLVDADLRHPVLDQHFQLNNQKGLSNAFLGIWNQVETELD
GQPTEIPSLRVLTAGVLPSNPSELLQSQLASQLFNHFRNSQKFDYIIFDTPPLLPIADAQIMAAYMQVTIMVVNASRTPR
KAMVRAKQALARTGTRILGVALNKSYWPEYGEVHDYLSNIQSRPRADIAMAMPPNTPAINHAIDATNTAILPSTNNKR
>gnl|bykdb|A0A426TTK3 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Candidatus Viridilinea halotolerans] (length=619 residues).
MDNELLRYLFIVRRWAWLIVMGTLLSAGAAFLVSREMTPVYQASTTLLISQASANNANADYNAILSSERLARTYASLMLT
RPMLEAVIADLDLTTSPDALARRITTTPVRDTQLIRVTVEGEDPLQVAAIANRLVEVFVQGNEALQGERFVATRASLELE
LEKLQSEIDATQAQLDQATGAANAIERSRLQELLAMYRTSYASLLKSIEEVRMAEVQQTNSVHTVERAVVPDVPVRPRVM
QNTALAALVGLLFMVGVALLLEFLNDRVTSSPQVAELLDTSVLAAVSEIEGQRPMDKLVTLISPHAKVSEAYQMMRVRLE
IARYGQPLRTILVTSGNQGEGKSITAANLAVVLARAGKRVLLVDADLRRPTIHTYFAHHNLRGLTTALVREGDTPVDFHL
HSTKLSNLLLMPSGPLPSDPAAVLSSPKLVELVEALKAKVDILVFDSPPLLQVADAALLMQLCDTVVLVATDGKTRTSAL
RHSAHLLAQSGVKLAGVVLNRVRKSRYGYGYGYGYGYGYGYGYEAEPEKLNWWRKFRRALRHLRGGKTRAHPRPVPSGSP
EDWEDLVALEQMEGVSGNGHNGNGNGKEHARPGDSATPTGNASSRQSSSRPRSRRRSGD
>gnl|bykdb|A5V160 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Roseiflexus sp.] (length=605 residues).
MTLQRYLTLFWRWLWLMLLMTLIAGGAAYLVSRQMTPIYEASTTLLINQAPAGSSSPDYQAVLTAERLARTYAELLVKRP
VLEDVVRELNLSIAPSLLAERVRVRPIRDTQLIVVTVEDIDPQRAADIANRIVAVFSEQNRELQSERFAESKRSLMNEIA
KLQADIDATQAEIAVLRGIDDPTRRARLEEALVQYRSSYATVLRSLEEVRLAEAQLTNSVNVVETAVPVTTPVRPRIVTN
TAMAAVAGLLLAVGLALLIEYLSDRVSSAEDVTAATHVGMLAAIGRIDGAEPSDKLVMLRDPFSQVAEAYQMLRVKLEIA
RFEKPLHTLLVTSSSPGEGKSTTAANLALAIARSGKRVILVDTDLRRPSLHRFFRHANLRGVTTALVRDPSDSLYNHMIA
TGLENLLVLPSGPVPSDPAVMVSSKKMLDLIDELKRMADVVVFDSPPILAVADAIPLAHICDATLLVVLAGATRTSQLRR
ACDQLLQAGVEPQGVVLNRVTKEQGGYDHYYYYYGQNRKRSRRGVLSRLFKRRRRRNAVPGVVDTLDTVMSGSGQTLYGA
PDVVEATVHRRAPDMTTHPDAQPAVTATTAVQGLDERRNGRAPHQ
>gnl|bykdb|A7NIZ1 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Roseiflexus castenholzii] (length=624 residues).
MRQVDEQSEHRMILQRYLTLFWRWLWLMLLMTLLAGGAAYLVSNRMTPVYEASTTLLINQAPASSASPDYNAVLTAERLA
RTYAELLIKRPVLEEVVRELSLPFAPSMLAERIRVRPIRDTQLIVVTVEDIDPQRAADIANHIVAVFSEQNRELQSERFA
ESKRSLAGEIAKLQSDIDTTQAELAALRGIDDPVRRARLEEALVQYRSSYATVLRSLEEVRLAEAQLTNSVNVVESAAPV
YTPVRPQIATNTGMAAVAGLLLAIGVALLIEYLSDRVNSAEDVATTARVGMLAAIGRIDGAAPSDKLVMLKDPFSQVAEA
YQMLRVKLEIARFEKPLHTLLVTSSNPGEGKSTTAANLALAIARSGKRVILVDTDLRRPSLHRFFRHANLRGVTTALVRD
PSDSLYNHMIAAGEENLLVLPSGPVPSDPAVMVSSKRMLDLIDELKRIADVVVFDSPPILAVADAMPLAHVCDATLLVVL
AGVTRTSQLRRACDQLLQAGVEPQGVVLNRVTREQVGYEHYYYYYGGERKRSSRSALSRLFKRRRRRQSGMPGMVDTVDA
GVTGIASGTRPDRGAPIDIVMDGFYATPTPETIDRHPVSAGAVVATRTDERRNGMTPHQMNQTK
>gnl|bykdb|A9B6E3 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Herpetosiphon aurantiacus] (length=575 residues).
MNIIRRYITGLRRWLWLLVLGPVVAAGAAYGISSQQTPRYASSTRVIVGQTLKNSNPDYGSLVASERLVATYAQIAQSRT
TMQAVEQRLNLSDMASSAIITTRPVQETEFLDIAVEANDPQQAADIANAIADQLILTSPAGPQSAEAKLLDEVNRQIATL
NEEITRTDEEIKTLKAEIEQIGADKPAAESLIANLQLKQQSQNQNRQTLSTLYSTALGNRANSISVVEAATVNPTPIAPR
PIRSAILAGILGFALVFGLALLIEYFDDSVQTPDEGVDLVNAPLLAAIVKQETKVTKASQRLVSRLDPRSPTAETFRTLR
TNLQFSNVDTKARTLIVTSSQPEEGKSTVAANLAWVLAQAGQKVVLIDADLRKPMMHRVFEVSSEYGLTNLLTNNEDPTI
RERTVLSVAENLWLIPSGPLPPNPSELLSSKRMEMLIWLLQQEYDWILFDTPPILTVTDPIALIPRVDGVVLVAEAKRTR
RDMLAKCRAAVQTVGGRVIGLVFNKLDPRSEGYGVYYTYYYDQHHTSNRGRRFWNRKDDHQPVPSMSEPAPLDLHDPALD
RSEAAYEMASHERSK
>gnl|bykdb|D1C8M3 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Sphaerobacter thermophilus] (length=557 residues).
MTSSILARGLRWWWIVLVGALAAAALAYLVSAAMTPIYQAQLTLLIEESQGTGAGDYNDILAAERRTRTFSRLVAQRPVL
EETIRRLSLRMTPEELMAVIEVTPIRDTQLVTLAVSDPSPARAAAIANTVAEVFIEQTQQRQAEIAGPGADQVQQNIEAI
QRQIDEANARIAELQAQPNAGDPAVQEEIRNLQAQLAQFTETHSALIEAQQRILASAAASGPRIRVTADAIPPDAPIRPR
TTLNTALGGVLGTLLGLGVVLVLVYLDDTVKDAEDVRRLTGRPALGWIPRFRGPSGIALVTAPRSPVSEGYRSLRTNLQF
ATLGQEVRSILVTSARPGDGKTTTVVNLGAVLAQGGQQVIVVDADLRRPRLHAALGNVPNRFGLTNLLLADDEVDLAALL
QETDVPGLRVLTTGPLPPNPTDVLDSPRMHELIAGLERMADMVLVDAPPVPVSDALVLAGLVDRVLLVAYSGRTRSAELA
RAVEELTRAGTPLLGVLLNRAEAGAGGYDLYYAEYYSAEPDTGDQDGSGPGASTRLSQRLGTLVSGRAVDATQRGNQ
>gnl|bykdb|D1CAL1 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Sphaerobacter thermophilus] (length=564 residues).
MRDLTFIEILGLIRRWWWVFIVCPLLAAAAAYGVSRALTPIYRAEATLFIDQRETTGSLNVGDIQAAQELAATYSRLVTA
RPVLEQTINRLSLDTTPEDLVENISVTRIGSTQLVEIAVEDPDPRQAAQIANTLAQVFIEETHAQEDAATWSGRDELRRQ
IEEVQQRIEDTSSRIAELQQSGASGTAVQTELRTLQTQLSQDQALYASLLEAQQRMELAAAQSATQIRVVEQAVPPTKFV
KPRILVNTALAGALGIVLAAGLVLVAGYLDDTVKTSEDVQRLTGRGALGLIPELRSPESIEAIAHPDSVGSEAYRTARTN
LQFVAVGQSLRSFVVTSPRPGDGKTTTAVNLAAVLAQGGQRVILVDADLRRPQVHRYFAGLNTRSGLSNLLLSEWDVKLT
PTLRQTTIAGLTVLPAGPLPPNPLDLLSSPRMREVLDWLAEQADVVIFDAPPLAVSDALVLSRLTNGVILVSETGRVRTA
EIADAVQQIQQSGSTLLGIILNRFPLEKSGGYYTYYRSQEDDAGGARRGESPSVIPHWADGAGDRVVIRRSLRPTISKPA
DSET
>gnl|bykdb|E8N5M1 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Anaerolinea thermophila] (length=604 residues).
MLYLDTGGMLPIRGNFSMEDFAEPVQQPSTDLRQYLWLLWQWGWFIALAGVLAASGALILSLLQTPIYAASTTILVNEAR
SGQYYDSTAIILTNEKLTRTYAEMMTKRPLLVKVAQKLNLPYVIDTVKVTPVRDTQLMQVIVEDINPVYASDFANELVNA
FAEQLQEMQISRFKASKENLQNQLSYLEQQIQENSSALEKILQENISEVKRTNPDAANGTLSNATIENLARQINQAEIDR
LETRLAQYRQIYASVLASYEQIRLAEAQNITSIIQVEPATPPDKPVRPQTLRNTAIAALVGIFLAIGIVFALDFLDDTIK
SPDWITTQTKLPVIGTIHTFDPKAGDPVALSSPRSPVTESFRSLRTNVRYASVDHPLRVLLVTSPTPEDGKTTVAINLAV
VIAQSGNRSVLIDADLRRPRIHKVLGLDNRQGLSGLFIQNPTMLNGALQQTRLETLKVLPSGGTPPTPSELLGSRKMKEI
LDSVASEAEMIVVDTPPVLSVTDAAVLSPLVDGVLLVVKMGTTKQSALLQAVEQLQQVNARILGVVVNGVNPKKSHYYYR
NYGYYQYYYYGDNGNLKKKRKTAISEPGSQPVTSINPPSKPTSR
>gnl|bykdb|I0I8T2 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Caldilinea aerophila] (length=565 residues).
MNQRELQAYLRPILRWWWLILLAMALAGTSAYIFARMRPDVYIASGTVMVGTALQERNPDSQQLSLTQGLAQTYARIMQR
PSIKKATMEALGMDWLPQYTVRTESQLIEINVTDVDPQRAYAVATELINQLILLSPGGQERQQREQFVQEQLRKLEQSMR
STEEEISRRQTELSAALSARQIRQLEDQIAALEAKMASLQSTYVNLLANTDQGSTNTINILDPPAVPTQPVPNRWWLLVA
VAALIGAGVAVAGAYLLELLDDRLENVEQIQRVTGLTTLGVLPESNVDSSERPLIMLSAPHTSDAEAFRVLRTNLLFASV
DRGLGALVVTSPTPGEGKSFVSSNLAIAFAQTGQRVILVDADLRKPTLHRAFGLVNNVGVTSALVSNLDEFTAALQQTIV
PELRVMTSGPLPPNPSELLSSRRMQELLDRLRSDCDLLVIDSPPVTVVSDTAALASRTDGVLLVFSREKMNRDLAHKTMG
ALRQVNASVLGIVLNRVTSGEHGYYYSYHKSYSSRYYSGYYAPRRHAKAAAETTMVVSPQPVPHRSINNGAPLEPESVGQ
PKSVK
>gnl|bykdb|I4EI06 [Bacteria] Bacterial tyrosine kinase [Chloroflexi][Nitrolancea hollandica Lb] (length=559 residues).
MDMTIADMLKLGRRWWWVFVACPLLAAGAAYLVSSLLTPIYEANLMLLINQSRVPGVINYDDILAAQQRTQTYSRLVTTR
PVLEETIRKLNLSVTPEQLLKKVDVSPVRDTQLFTVAVSDPSPEQAATIANTIGQVFIDQTRDQNVAATGTSREALQKEI
DAAKQQIDDLTTQVANLRGRPDASTAAVQAQIADLEARLGQQQSSYDGLRATQQQIDLANAQANSQIRVAEPAVAPTKFV
KPRIVVNTALSGVLGLLIAAGLVALAGYLDDTVKTSGDVRRLTGKAPLGSIPVLVSADGVESLRAPHSPAAERYRSLRTA
LQFATLGQPIRSLVITSPRPGDGKTATATNLGAVLAQAGQRVILVDADLRKPQLHTHFAGVKNRAGLTNLLLAQPGDGLA
DALLQPTEIPGLRVLTTGPLPPNPADVLNLPRMREILTSLEDAADVVLVDAPPMAVSDPLIIAGLVDGVLLIMTGGRTRS
GELTQVVQELTRTSTPLIGAVINRVDVKGDGFYAHYASYYGAGSDRVGDGNPVASLGTDLDGRHASPDRPVRRVGDPGD
© 1998-2019