BYKdb

Dataset for cluster orphancd of phylum cyanobacteria

[Download (right click)] [Alignment] [Repertoires]

37 sequence(s)

>gnl|bykdb|A0A081GP61 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanobium sp. CACIAM 14] (length=857 residues).
MGGFPPSGAAGRFQAPYPDQPLQSPLTPTAEAQAGSGGLGGLVRTIRRRQTVFLLTFAVVTGALAINTLRQRIFSPVYQG
GFQMQISNPFEDKNGGGGGGSVEAIARTPLKPDVPSLIVLMRSPLLLGPVAQRQGVPLDLLAANLSINPESAAVENVLNI
SLRWPDPVKGKAILRQLAKDYTAFSLTQRQAAVNSGVRFLDQQAPAIEARVQKLSNEMLRFRERNNFVDPATAAGQILGA
RDGLVNQLRDLQNEQVQLDSQLQSIQSGKLQFSSSGAPTAIQQLGRNSVLVPGRANQNQGAEVAKGTPTPLDLLNQFEQE
LATAKGTYKQNSPIVQSLLARRNQLLPVVQRQASDAVKARLLSNLAQQDEINRQILLLNQNFRNNPQKLSEFENINQRLS
IAREQYSSYIQARERYRLEMARSITPWEVIGPPDFGASPVEPDIQRNLLRAIMIGLLAGLGAAILRERTDNVFHTPMEVE
KELQLPVLGLIPYLPLEPGVDIATSISKMSSSERFAIKESLRSLFTTFRLLRADNNIRMVGITSSTQGEGKSTAVTVFAS
TLADLGLKVLIIDSDMRLPMQTRYLGVEPGDGFSTLLSDSSRKTTDLIQTIAENMDVLPAGPKPPDPAKLLNSSRCKEIM
DEIRALPGYDIIIVDAPPCLMLADPILLGEKLDGILFLVGLGKVSRELAPQASRRIKATGVDVLGIICNQVNFPSRLNDY
GYEYGYYYHYAYASASGYAKSANQGKSYGGFGSYVQRYRDSYMKGAPSNAYFNAHQQNGDLDVRSYYQQEDGSGASAATR
PPSEDSKGSGVSIRSSLPDSGRESTGSHAGDSQGVRKGASQGPIGWLRQRFGRGSQR
>gnl|bykdb|A0A0A2B4S6 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Prochlorococcus marinus str. SB] (length=723 residues).
MLISDPLNNNKNNSANSIGGVFEQLALNSTDNDLPTLIELLKSPILLNPISKDYGIPFNKFSKSLKISTPGGLRTQSMAQ
GVLRISFKGENPRIVNSMLVSISKAYLKSALDQKQQRLSDGLIFLNNQSPKLEGKNKQVQKELSDFRERNQLIEPTVEGQ
ELKTRLDYLENELDNIKNERVKLNNLLNSIENGSLTAYGFKQAITTDLNLNERIPTEGVSFINLDLELLDQYILVKQKLA
IARTKYLEDSEIVKGLKYRVEQIEPTLKSNQISALISAREIIDKNIQNAKIKIKSLKEKFEKQPKLISEYKTLQQKALLA
AKNLEGLSSAKEKFQLEIAQRSVPWSIIAPPKVYPVPVSPDIPLNLSLSLIFGPVLGLIVGLIRDKVDHVYHSPDEVKEN
LNLPLLAELPYIESFVNLRENNESIFNVEDKLNATKNEKSSESYLGYQRFFYQEAFRGMYTSIKFINTQNSLKILSISSC
IPSEGKSLISTMFAKTISELGLSVLLIDTDLRKPQVHARLGLDNLIGFSNLLIDSSDNYKKYIQSVPTQDNFDVITSGSI
PPDPTRLLGSDSMKKFIETIRSENKYDYVILDTSPILSISDSTLIAQYCDSLLMVVSLNNVDMDLPLLAKNKLKKTNRPL
IGFVSNQIKKPKTFSKNRYYGYSNYSNNYGYNSNYISYYADNKIRDKFTKRNLTFENSKDNFLISKIKKFRNKVLDFISW
LDR
>gnl|bykdb|A0A0D6KL48 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Tolypothrix sp. PCC 7601] (length=485 residues).
MKLNTDTAVELTTLSQSPGVQQVLTEYQKVQDELAVARTRLTEDNPKIINLENQAVALKNQLEGRVAQTIGNSEYMPEQN
LQIGNLKQTLTENLVKSEVERLALTNQVAELKQVLLVNKNRLDSLPRLEQQQLQLQRQLKVAQVTYEQLSKQLQEVEVVE
NQNVGNARVISEALVADKSVSPIIPLNLALGGILGIILGAGTALVLESIDNSLKTVEEAKRLLDYPLLGAIPQAEKAKGS
EGVGEVELPVLNNPYSPVSSAFEMLQTNLSFSISDKMLKVIAISSSIPGEGKSFVAANLAVAVAQLGRRVLLVDADMRRP
RQHKIWEQNNLVGLSNILVGQTELQTTSKEALMTLDIITAGTIPPNPAALLNSQRIATFIKEATQEYDFVIIDCPPLTLV
ADALMLSKLVDGILLVVRPGVANTGSVNATKMLLEQSGHQVLGMVANGVTPESSYGGYYAKSYYGAKQSHKNGKVDASIS
KIRIL
>gnl|bykdb|A0A0V7ZGW0 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Mastigocoleus testarum BC008] (length=681 residues).
MKVSAIIQRLWLPLLGLNGVIVGSVIMIATFSQKTWTANAQLILPDTTTNLDASLGTLGQLKEQGVAFTNELNPLKVLTS
IITSDDAIRPVLLSDPEKDKFRSLSSYKKLFKVKPTDQSTNIQLQVTASEPELAKQRAKRLIESYQERLNELRQGTANAR
EQFTQRQLKDAERNLQLVKSKLAQFKKSTGFVSDEEQTKNLVTAINTLRTTQTDVLAQAKATATRSQELSRTLGMAPQQA
INSLRLSENKEYQALRQKLTEVNTEIAVNRGTLTEEHPTVRALLQQRQKLLMALNRQLNAVVPSADGIDANFGGNNFKDA
TIELIAQLIQVESESKGLQQQVLIIQNKLERLQTELKNISTLQAQLLDLQRQYDIAEGVYKGIVAQLEQSKIAAFNAYPN
LQVLDQPTVDPKPTSPKKSLIAIGGILTSVFASLALILFSESRNPLLKQKDLQDIELPLLARIPIFKSAPLGLTMESDAQ
IPFQRLASTISLMSLENHRLMVTSSTAGEGKTTVTLGLAKALMVLGFRVLMVDGDFRKAKLSRQFGHVMHPQSNDLPQPM
QISPGLDILPTAPNQNNKVMEFVARGGFEKYLNTIQTNGNYDYVIVDTAPVTSTSETALMAKVIANVLPVIRLGISDRYM
VQETIEQLMRHNANIIGLALNGIEQRSEGYIYKHDSSQVNS
>gnl|bykdb|A0A0V7ZMP6 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Mastigocoleus testarum BC008] (length=675 residues).
MKKATKIAVRHWKFVLAWNKIILGIAVANIALLPRVWISKSLLILPTSTSNVDADLDNSDDLKTKEVGFSQQVNPLNVIS
SIATSDNVLKKVWEQDPQKTSYKQLSEYRGLFDVSPENDSTVISLSVEGSTPKLATERAQNLIASLKERLQELRQDRVIS
QSEFIQDEVRQAHRKLMDAQKKLNKFKEAGNVISDEHDAKQKVITINALNKSRVEALAEAKAAQAQTRILSARLSLPPQT
ALKSLQTKGTETSLSIREKLSKVNISLQEAQTYLTDNHPRIENLKFQQEELRNELQEDRVSDNSVSSVAINPNLADRHIV
HKLILAESQAEAMSSKAQQLQIQINYLREQLKKLPTKQGILMDLQRRYDMTKKIYNGLVTQAEKVRLSAFDTYPSFQLLD
EPFVNNEASSPNIQLIILGAVLISIFGSVAIILLQERRDPLISPKDIQQKNFPVLASVPYMKGLDTSMGEGINEKVEFQR
LASAISLLHLENKSLMIASANSGEGKTTVTLGLANALLELGFRILIVDADFRKCELTQSLGYYGQSIGDLQLRPINVFEN
VDLLAMRVPEERIAEFVARGGFEQRLNAIKNSAQYDYILVDSPPVALTSEAAIIGKIIHNILFVVRTGISSRNCFHDSVE
QLKRYRAEVIGLTVNDVDSHNEKYIYSYNVNQQIQ
>gnl|bykdb|A0A1B7WWU1 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Aphanizomenon flos-aquae WA102] (length=378 residues).
TKQVEELQRVFIFNRRRLDSLPRLEQQQLQLQRQLTVAQITYQEFLKQYQLVQVLENQNVGNSRVISEALVPELPVSPKI
PLNLALGGFLGVLLGAGTALLLESMNQSLKNIEEANRLLGFPLLGTIPQHGEKNPKNPQEGRQELPLLDDPYSPVSTSFE
MLQTNLGFTVSDKELRVILVTSATPGEGKSFVAANLALAGAYVGKRVLLVDADMRRPRQHRVWEIHNLLGLSNILAGQTQ
LKNAVQEVSPLVKMLPAGKIPPNPVTLLDSQCMADLVEEASKDYDFVIIDTPPLTAVTDPLIVGKYVDGLLLVVRPGKVE
YSAVNAAKSLLTQAKLPILGMVVNGIVKESGYGGYYYSSGYYGGKGERNKQNAEASVR
>gnl|bykdb|A0A1D8TTM0 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Moorea producens PAL-8-15-08-1] (length=676 residues).
MNRLIAIAIRHWKPVIGLNIVLSAIALYNASKVTEVWAARAKLIIPKSSSDLNANLGTLGDFRDRGVSFSQQVNPLNNLS
SIMTSNDTISQVWEFDPEKSLYPRLSGYKSLFDVSPEGESTIISLSAEGSTPELARQRTAALIEAFQQRLNELRLDDAVQ
RSQFMRKELEQAAENLRQTQAALVAFKASSNLVSAEDQTREMVTAINTLTTEQAQVLAQAQASKAQVETLSARLELNPQQ
AIRSLSLGENQDYQFFRQELSEVEALLTETQAKFTNENPQVQALLEQREELQNQIEGYIFQARAAQPGVNATIGQESAAL
IRELILAESQTQAYYSQGKQIQTQIDQLGSILKTLPAAQARLVQLQQQYDIAEGVYNGLVAQVQQSKLNAFSSYPSVQVF
EEPRADSKPSGPGRRPIALGTILASVFGSAAIVLFLESRNPLLSLQDLQAISIPVLRSIPPFKHLVLDVDPSFGTAIEFQ
RLASAVSMKPLKNRRLMISSATSGEGKTTVTLGLASALITLGFRVLVVDGDFRKAELSQRLGWDRYAMSEVPSTPVQIRP
GLDLLSLRPDEDKIAEFVARGSFEECLSAAQGSGHYDYILIDSAPVSLTSEAALMASVVPNVLLVVWLGKSNRNPFRDTL
EQLMRHRAQILGLVVNGVDTQPEGYLYGHKIAEVSS
>gnl|bykdb|A0A1D8TWE6 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Moorea producens PAL-8-15-08-1] (length=675 residues).
MKKVAGILNRHWTFLLVFNSLVLGASFGAFSLLKPFWIAKAQLILPETGKLQASLGTLGSLTKGDSKLATKSHPLNMQAS
ILTSDALMSRLLESDLEKTDFQRLVQYKKLFAISPDQESTTIWLNARGDSPELARDRVKALISAYQDRLNELRQADGSTR
VEFNKKALERAKQKLDQSQEALAKFQESSGLVNSKAQTEGLVRAITDLSISQAQAQAQAQASQHQLQILSTRLGLTPKQA
IRSLGLAENRDYQFVRQQLTELEATLVKAQTTYTYAHPEIQNLLLQREQLQQQIQQYIFLAAGDTLVDPTLTDSAQGRAM
LIQQLILAESAASGQQQQAEQLQQQIDQMKSTLTVIPVHQSRLLELKRQYDVAAGVYNGLVAQIEQVNLDAFSAYPNVQV
LDPPTVDEKPAGPKKLLIIANGFLASAVGSIALVLLLERRNPLLSPKDLQAIKFPMVVNIPHLRHAGMGLELGTETDVEF
QRLASVISLRSGEDRRILITSAMVSEGKTTVTLGLATALVDLGFRVLVVDGDFRQATLSQRLGHHHDPLKPGQPVKIQPS
LDLLPTSHKKGKIVELVTQGKFEHSLATAEASGDYDYVLIDSAPVSMTSETALMAAVIPNLLFVVRPEISKRDFVSDSLE
QLAQHNAQLLGLVVNGVETKSKPYLYRSSDSLVKS
>gnl|bykdb|A0A1D9G3S3 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Moorea producens JHB] (length=675 residues).
MKKVAAILNRHWTILLVFNSLVLGASFGAFSLLKPFWIAKAQLILPETGKLQASLGTLGSLTKGDSKLATKSHPLNMQAS
ILTSDALMRRLLESDPEKTDFQRLVQYKKLFAVSPDQESTTIWLNASGDSPELARDRVKALISAYQERLNELRQADGTTR
VEFNKKALERAKQKLDQSQEALAKFQESSGLVNSKAQTEGLVRAITDLSISQAQAQAEAQASQHQLQILSTRLGLTPKQA
IRSLGLAENRDYQFVRQQLTELEATLVKAQATYTYAHPEIQNLLLQREQLQQQIQQYIFLAAGDTLVDPTLTDSAQGRAM
LIQQLILAESAASGQQQQAEQLQQQIDQIKSTLTVIPVHQSRLLELTRQYDVAAGVYNGLVAQMEQVNLDAFSAYPNVQV
LDPPTVDEKPAGPKKLLIIANGFLASAVGSIALVLLLERRNPLLSPKDLQAIKFPMVVNIPHLRHAGMGLELGTETDVEF
QRLASVISLRSGEDRRILITSAMVSEGKTTVTLGLATALVDLGFRVLVVDGDFRQATLSQRLGHDHDPLKPGQPVKIQPS
LDLLPTSHKKGKIVELVTQGKFEQSLATAEESGDYDYVLIDSAPVSMTSETALMAAVIRNLLFVVRPEISKRDFVSDSLE
QLAQHNAQLLGLVVNGVETKSKPYLYRSSDSLVKS
>gnl|bykdb|A0A1Q8BLE0 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanobacteria bacterium 13_1_20CM_4_61_6] (length=211 residues).
MRAVSRIVITSPGPEEGKSTTAANLAIAFAQQGHRVLLVDCDLRRTRIHKIFDETNLPGLTSVLVGGETIASAIRQTRVP
GLNILPSGPLPPNPAELLGSAQMTALLDKLSENYDLLILDTPPLLAASDAAIVSRIVDGALVVVRAGRTERSALQTAVQQ
LATVGARVLGTVLNDPDAEVPKYARYYGYYYNNYYDYSNATEYSNGNGAKA
>gnl|bykdb|A0A1U7JBN8 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Phormidium tenue NIES-30] (length=762 residues).
MPFPPSSTHEINGNGHGHAKPGFMTVMAPPSLVEQRDEVDFNQLVGVFRRRAGIFFGVAALSLAGFTLWHLSRPPAYSGS
ASLLVEPVTAVNTPGLETVTGAPSPSGSGLDYTSQIRVLRGPAVINPILAKIQQRYPDITYNSLLNGLNIVQEGESKVLR
ISYSNADPAVAAFVLNQVVEGFVNYSVQDRQGDLRRGLTFLDEQLQEKWQEVAAIEGDLSEFQKRYDLVDVNATSESVTQ
RLNQMLADQEQLRVELSALAPLYENLREQVGFDPNTAIRVANLNESPTYQALLGDLREIEQTIAAESARFQADTPMIEAL
TDQRQQLLPLLEAEAQRLVGSAVEAETLGYQGSVSQDLMQQLVNTANQMQVLQTQDQAIGQAVQLLRAEIQRLADLSRSY
QQISRELTVAETSLDQLLASRQDLRFQMARQASPWELISPLNETSIAQTSNLPRNLLLSTVLSLMLGGVAALLRDRLDQA
FHSVDDLVKATQLPNLAGVPNAPALQKQPLLMVPNLSATMADVLTQNQSPHKLYTSFSFAEAFYSLEANLRMLSSDTPIQ
VVALTSSEPGEGKSTICAHLAIAAANMGRRVLLIDSDLRKPSQHLIFGHANRQGLSDLITQPLDDPMDLVQVIPGNPNLH
LLTAGARPPAPGRLLSSRKMQQIAEQYRCHFDLIILDTPPLAGGMVDAKLAAAHADGLLLVARLNRSERTEIQRVLADLG
NTVQAPLLGLVVNGVPHSRQSGYDYYYGYYGRPRVAAGIEDG
>gnl|bykdb|A0A1U7N3U5 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Moorea bouillonii PNG] (length=675 residues).
MKKVAAILNRHWTILLVFNSLVLAASFGAFSLLKPFWIAKAQLILPETGKLQASLGTLGSLTKGDSKLATKSHPLNMQAS
ILNSDALMRRLLESDPEKTDFQRLVQYKKLFAVSPDQESTTIWLNATGDSPKLARDRVKALISAYQERLNELRQADGTTR
VEFNKKALERAKQKLDQSQEALAKFQESSGLVNSKAQTEGLVRAITDLSISQAQAQAQAQASQHQLQILSTRLGLTPKQA
IRSLGLAENRDYQFVRQQLTELEATLVKAQTTYTYAHPEIQNLLLQREELQQQIQQYIFLAAGDTLVDPTLTDSAQGRAM
LIQQLILAESAASGQQQQAEQLQQQIDQIKSTLTVIPVHQSRLLELKRQYDVAAGVYNGLVAQMEQVNLDAFSAYPNVQV
LDPPTVDEKPAGPKKLLIIANGFLASAVGSIALVLLLERRNPLLSPKDLKAIKFPMVVNIPHLRHAGMGLELGTETDVEF
QRLASVISLRSGEDRRILITSAMVSEGKTTVTLGLARALVDLGFRVLVVDGDFRQATLSQRLGHHHDPLKPGQPVKIQPS
LDLLPTSHKKGKIVELVTQGKFEQSLATAEESGDYDYVLIDSAPVSMTSETALMAAVIRNLLFVVRPEISKRDFVSDSLE
QLAQHNAQLLGLVVNGVETKSKPYLYRSSDSLVKS
>gnl|bykdb|A0A254WHZ5 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][cyanobacterium TDX16] (length=689 residues).
MKQIFSIARKHWLPLLGFNSAVLAATIYAAFYASTSIPPVWTANAKLNLPQTGGLSANLGPLGSTQTSALNFKDVSPLDV
QLAILTSDAVMERVRVIDPEKSLYSKASSFSQLFVVTPQPATTLIEVEAQGSRPDLAYKRLFTFLEVYQQRLNELRRKDA
EVRVQYTQEELEQARLNLNQAQANLSNFQRSTGLVDSPEQSKGLISAINNLKTTQATLIAQGQANATQAQAAAVSLGITP
QQAMNSLRLGENKEYQATRTQLSQLESTMAVTRSKYRDDSPQVQSLLQQRQQLLRQLNQQIAVAIPGANAAQIDTTLGNG
PNDSRLELMVELIRNQTLAQGAQQQAKQIQKQVDKLNTELNFITKNQAQLLDLQRKYEIAEGVYKGIIAQSEQSKTNPFN
AYPNVQTLNEPTIDPRPSIPNLRLITTGGMLAAIFGSMALIFFLENRNPLLKPKDLQQVELPVLGSIPHLKQPSMERNLA
AEIDIEFQRLASSILMLEHPCLMVTSATAGEGKTTVTLGLALALVNFGFRVLVIDGDLRKAEMSRRLGKNRLENPANASP
PMPVSVSPGFDLLPALSIPKQKIPEFFARGSFERNIKAMRDSGGYDYVLIDSPPVGLASETNLMSAVVCNILFVLRSGTS
DRYPVMNSLEQLTRYNARIMGLVVNGSDSHTSVYRYGYGRQRELLENEA
>gnl|bykdb|A0A2N6LHT1 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Fischerella thermalis CCMEE 5318] (length=534 residues).
KQLQEAEQKENRYRQSSGIVSFDEQTKSLVESLATLEEQENTLSAQLQELRSKEASLQQVTDAKALNQAYAAVRGGQDEE
LKALRNKLAEIETQLVQARLSLTDNHPTVINLLGQRNGLRALYQQGLARVSPRNQSISSGSVAGDQISQDLTSQLIINDV
ERLALENKLKVVQTNRANLQARLAQLPIQQQQLTPLTRQREESAESLKLLQSKLEEARIAEAQLVGNIQIIEAAQPPTQP
SLPNKRTVLAIAIVVGTALATGIVLLLELMDHTLKDASEAEELLKLPLLGVLPRLPGHAIALEPSAQFLDHVGLVEPYRT
LFKNLEFRSSEPLRSIVVSSTITGEGKSVVGSHLAAISAMLSRRTLLIDADLRRPILHTLFNLAPRPGITDVIDSERSLE
ETVQRTNIPNLSVLTCGELYRLPSHLLESEAMKSLLIEAVRQYEFVVIDTPPLSACADAHTLGRQSDGIILVTRPGFTIK
EVLQRAVSELTHNQIPIMGVVVNGITDQTERYYRYAVNSYEPLSSRRLSRGSSA
>gnl|bykdb|A0A2N6M0S2 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Fischerella thermalis CCMEE 5319] (length=541 residues).
KKVPEARKQLQEAEQKENRYRQSSGIVSFDEQTKSLVESLATLEEQENTLSAQLQELRSKEASLQQVTDAKALNQAYAAV
RGGQDEELKALRNKLAEIETQLVQARLSLTDNHPTVINLLGQRNGLRALYQQGLARVSPRNQSISSGSVAGDQISQDLTS
QLIINDVERLALENKLKVVQTNRANLQARLAQLPIQQQQLTPLTRQREESAESLKLLQSKLEEARIAEAQLVGNIQIIEA
AQPPTQPSLPNKRTVLAIAIVFGTALATGIVLLLELMDHTLKDASEAEELLKLPLLGVLPRLPGHAIALEPSAQFLDHVG
LVEPYRTLFKNLEFRSSEPLRSIVVSSTITGEGKSVVGSHLAAISAMLSRRTLLIDADLRRPILHTLFNLAPRPGITDVI
DSERSLEETVQRTNIPNLSVLTCGELYRLPSHLLESEAMKSLLIEAVRQYEFVVIDTPPLSACADAHTLGRQSDGILLVT
RPGFTIKEVLQRAVSELTHNQIPIMGVVVNGITDQTERYYRYAVNSYEPLSSRRLSRGSSA
>gnl|bykdb|A0A2P8QV10 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Chroococcidiopsis sp. CCALA 051] (length=689 residues).
MKQIFSIARKHWLPLLGFNSAVLAATIYAAFYASTSIPPVWTANAKLNLPQTGGLSANLGPLGSTQTTALNFKDVSPLDV
QLAILTSDAVMKRVQAVDPEKSLYSKVSSFSQLFVVTPQPATTLIEVEAQGSRPDLAYKRLFTFLEVYQQRLNELRRKDA
EVRVQYTQEELEQARLNLNQAQANLSNFQRSTGLVDSPEQSKGLISAINNLKTTQATLIAQGQANATQAQAAAVSLGITP
QQAMNSLRLGENKEYQATRTQLSQLESTMAVTRSKYRDDSPQVQSLLQQRQQLLRQLNQQIAVAIPGARPAQIDTTLGNG
PNDSRLELMVELIRNQTLAQGAQQQAKQIQKQVDKLNTELNFITKNQAQLLDLQRKYEIAEGVYKGIIAQSEQSKTNPFN
AYPNVQTLNEPTIDPRPSIPNLRLITTGGILAAIFGSMALIFFLENRNPLLKPKDLQQVELPVLGSIPHLKQPSMERNLA
AEIDIEFQRLASSILMLEHPCLMVTSATAGEGKTTVTLGLALALVNFGFRVLVIDGDLRKAEMSRRLGKNRIKSAANASP
PMPVSVSPGFDLLPALSIPKQKIPEFFARGSFERNIKALRESGGYDYVLVDSPPVGLASETNLMSAVVCNVLFVLRSGTS
DRYPVMNSLEQLTRYNARIMGLVVNGSDSHTSVYRYGYGRQRELLEHEA
>gnl|bykdb|A0A2S6V636 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Chroococcidiopsis sp. TS-821] (length=688 residues).
MNHIVNIIRRHWMPLLLLNGVVLAATLYSVIYTKTNVAPVWKATAKLNLPQPTTRLDTNLGTLGQIQNTALGFTRELNPL
QIQMAILMSDTVMERTLAVDPEKSLFPRLSDYKLAFSATPQEQSTIINLQVKASSPDIAQRRLSNLINIYQLRLNELRHQ
DTNVRKQFSQTDLEEAQAQLAKAQAELASFQQATGLTEVAEQTRALIAQQRELRTTYTNVLSQAQANQAQAQAASERLGI
NAQQAMNSLRLGENREYQAIRQKLSDAETALAEARSRYTDESPQVQSLLSQRQELMQLLNQQIAIAAPGASANQIDPTLG
GNGTRDSRIEMIAELIRAQNNAAGLQQQANQIASEINRVNAELNNIAQNRAQLINLQRQYEIAEGVYKSILAQVEQTKTN
PFNVYPNVQTLDAPAIDPKPEEPSKRAIALGGILAGLFGSISLIFFLEKRNPMLRPKDLEQVEFPVLGRISRLKRADMER
NLSGEVAIELQRLASAVLMLEHQRLLVTSSTSGEGKTTVTLGLALALVNFGFRVLIVDGDLRQAELSQRLGQPQKKLKDG
QPSPVSVCLGLDLLPAPALSKGKIPEFFARGSFQQYLDQIQADGGYDYVLVDSPPIGLASETNLMSSVVRNVLFVVRSGK
SDRYAVMDGFEQLAQHHAQIMGLVVNYVEPKDVGYRYGRQRELIETEA
>gnl|bykdb|A0A2T1CC83 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Pleurocapsa sp. CCALA 161] (length=391 residues).
VGALYNSQQDLIKRAKVLPQLEQKDRELVRQAESAGKTYETLLNNLQEATIAANSKSGNADVVEYAAVPDKGNSGRAVLM
GMGLIMGAFLANLSVILLEMQDRSISSLAEIKKKFPYQTVGITRLEPPMYQGKIVTRDEPDSFSSEVYRMIQANLKFLTN
DKPPKVILVTSSVPEEGKSTVTANLAAAISQLGRSVLLVDADLRRSSQHHLWGVDNQKGLKDIVVDNVSPLSVIRQPMPK
LSLLTSGMVESNPLAILDSPKMSDFIGRSRREYDLILIDVPPLPVTADVLTVSKLVDGILFVTRPGIVEHESAELAQEAL
ATTGQKILGMVVNGVKANEFDRYSYHGRYGKKYFEKGNVQYESQNNLNGSQNLSNMPEGNNANSSVSRAKL
>gnl|bykdb|A0A2T1DKP1 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][filamentous cyanobacterium CCP2] (length=456 residues).
VEQTRYRSGHPAIANLERKVDALNALLQERIGQVVSNGGPVPTGNLQLGDLQQGLISDLVRSEAERVGLSERLSSLSNAQ
SAYRARANALPRLEETQRELERRLKAAQTTYEVLLSRLQEVQVAENQNIGNARALSSAIVSERSSNRKMGLALGGGVGIL
LAVAAAFAADLLDRSVKTLKEVKDLFGYTLLGVVPLLNGKPVRQRSHFEGTAHPIPRVYVRELPFSSAAEAYQMLQANLR
FLRSDKEIKTVVVTSSVAQEGKSEVAANLAASMAQVGRRVLLVDADMRYPVQHHVWDLVSTIGLSNVIVEQFVPDVAIQE
VAPNLYALPSGIIPPNPIALLDSKRMASLVEGFARDYDLIIFDTPPLAGKADAAILGKMTDGILLVVRPGIIDSASANAA
KEFLKQSGQNVLGMVINGVDVRSEPDSYFYHTRERGKRNVAALDTITDSIPTEVER
>gnl|bykdb|A0A2T1EZA0 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Aphanothece cf. minutissima CCALA 015] (length=901 residues).
MFWEEKPPKDINRITTIDARVKGHSLRVAIIIGSTFPAVHNVTTTGAPPEAFPGGTARPLSLPGTGASGPGLFDPSSQQS
PLSPMGESQSGGGGLGGIVRTVKRRQSIFLITFALVTGVLAINTLRQRIFSPVYQGGFQMQISNPFDNPGTGGGGGGSVE
SIARSEIKTDVPSLIVLMRSPLLLGPVAQRQGVPLRALESNLSINQESARVDNVLNVSLRWPDPAKGKAILRQLAKDYTS
FSLTQRQAAVNSGVRFLDEQAPAIEERVQKLSQEMLKFRERNNFVDPAAAAGQILGAREGLVNQLRTLQNEQVQLDSQLK
SIQTGKLQFTPSGAPTALEQLGRNSVLVPGRGDSAAEAASGTKTPLDLLNQFEQELATAKGTFKENSPIVQSLLARRNQL
LPVVQRQAADAVKARLLANVAQQDEINRQILLLSENFRNNPQKLAEFENINQRLSIAREQYSSYIQARERYRLEMARSIS
PWEVIGPPDFGSSPVEPNIQRNLLRAIMIGLLAGLGAAILRERTDNVFHTPMEVEKDLQLPVLGLIPYLPLEPGVDIATS
ISKMSSSERFAIKESLRSLFTTFRLLRADNNIRMVGITSSTQGEGKSTAVAVFSRTLADLGLRVLVIDSDMRLPMQARYL
GVEQGDGLSTLLSDSSRKPTDFIHSIAENMDVLPAGPKPPDPAKLLNSSRCKEIMEEIRALPGYDIIIVDAPPCLMLADP
ILLGEKLDGILFLVGLGKVSRELAPQASRRIRASGVDVLGIICNQVNFPSRLNDYGYEYGYYYHYAYASASGYAKSASEP
STGGFGSYVQRYRDSYMKGAATNSYISARYNEGESDVKTYFREDEDQATAPVATNGGIGPSASSTSPLPPADSVPSRRHR
PSREGGGGPMGWLRRRFGNRG
>gnl|bykdb|A0A2T1FMA8 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanosarcina cf. burmensis CCALA 770] (length=689 residues).
MKQIFSIARKHWLPLLGFNTAVLAATIYAAFYASTSIPPVWTANAKLNLPQTGGLSANLGPLGSTQTTALNFKDVSPLDV
QLAILTSDAVMKRVQAVDPEKSLYSKVSSFSQLFVVTPQPATTLIEVEAQGSRPDIAYKRLFTFLEVYQQRLNELRRKDA
EVRVQYTQEELEQARLNLNQAQANLSNFQRSTGLVNSPEQSGGLISAINNLKTTQATLIAQGQANATQAQAAAVSLGITP
QQAMNSLRLGENKEYQATRTQLSQLESTMAVTRSKYRDDSPQVQSLLQQRQQLLRQLNQQIAVAIPGANAAQIDTTLGNG
PNDSRLELMVELIRNQTLAQGTQQQAKQIQKQIDKLNTELNFITKNQAQLLDLQRKYEIAEGVYKGIIAQSEQSKTNPFN
AYPNVQTLNEPTIDPRPSIPNLKLITTGGMLAAIFGSMALIFFLENRNPLLKPKDLQQVELPVLGSIPHLKQPSMERNLA
AEIDIEFQRLASSILMLEHPCLMVTSATAGEGKTTVTLGLALALVNFGFRVLVIDGDLRKAEMSRRLGKNRIKSAANASP
PMPVSVSPGFDLLPALSIPKQKIPEFFARGSFERNIKALRESGGYDYVLVDSPPVGLASETNLMSAVVCNVLFVLRSGTS
DRYPVMNSLEQLTRYNARIMGLVVNGSDSHTSVYRYGYGRQRELLEHEA
>gnl|bykdb|A0A2T2S1W0 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanobacteria bacterium QS_8_64_29] (length=249 residues).
MSFLPVRDAPRSPLSESFRMLQANLRFSQADRRLQAIAVASSVPGEGKSTLVANLGLALAEVGQHVLIVDADLRNPSQHG
IWEYANAVGLSNLLVGESSLEQACHPASEGLDLLTAGQVPPNPVALLDSQRLATLLQQWRQAYDYVLLDVPPLQAATDAV
IVGKLTDGTLLVVRPGVAECDAVEASRDTLARLQQPVVGMVANGVNPRNERSSYYHYYNYGNNNGGPPRQGWRRWLPGNP
FARNGKGSQ
>gnl|bykdb|A0A2W4VXF4 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Leptolyngbya antarctica] (length=766 residues).
MPFSSKPAAREVNGNGNGQGHASQSFVPVTAPPSPLIDDGDDFDLNHLVAVLGRRAGIFWGVAALSFGGLTLWHLTRPPV
YNGSANLLVEPVTVVNTPGLEAVMELPGARSASGLDYTSQIRVLRGPDVIKPILVNIQRQHPEITYTTLLNDLVISQEGE
SKVLRISYSDADPEVVTTVMSEVVKGFVAYSVQDRQGELRRGLEFLDEQLQEKWQEVDTIESDLSEFQKRYDLVNVTTTA
ESVAQRLNQMLSDQEQLRVQLTSLGPLYENLRSQVGFEPSVAIGVANLNESPTYQGLLGDLREIEQTIAAESARFQSDTP
MIEVLVDQRQQLLPLLEAEAGRLVGSAVDANTLGYQGSVSRELVQQLVDTANQMQVLETQDQAIAQAVQQLRAEIQRLAD
LSRSYQQIDRELTVAESSLDRLLTSRQDLRLQMARQTAPWELISPLDESSVTEMTNLPRKLLLSTVVGLLLGGVAALVRD
RADTAFHSADELVKATQLPNLALVPNAPALQKQPLLMVPDLTATMADVLTQNQSPDNLYTSFSFAEAFYSLDTNLRMLSS
DTPMQVIALTSAVPGEGKSTICAHLAIAAANMGRRVLLIDGDLRKPSQHLIFSQRNHQGLSELITQGLENPTDLVLAIPG
NPNLHLLTAGARPPPPGRLLSSRKMQQITEQYRRHYDLIIFDTPPLAGMIDAKLTAAHADGLLLVVRLNQSERSEIQRVL
ADLGNTAQAPLLGLVINGVPQSRQRGYSYYGYYGRPAVASGIDERG
>gnl|bykdb|A0A2W6ZN45 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanobium sp] (length=804 residues).
MLTEAGSPTPHSPFGTGSTQVAASALSPTANQPDDASTNVLFKLIRSLKRRQALFLFVFFVTTALLAANALRQRIVAPVY
IGGFQMLITDPLANVGPSTPSSGVVESLAKTTSLGNSDVPTLIQLLTSPVVLKPIAEAQAIPLGSLIGSLAIGSTRADSQ
GVLNIQLRWSDPVQGRKILTALADSYPKYALIQRQEKLGQGLEFLGQQAPALQQRVNSLQRTLKQFRESNSFLEPLAQGG
SIISSRDGLLGQLRTLQVEQAELETQLASVRSGKLITLPSPGSSGSGVVGQGSPAAGNPQLGLATRPRADSVAPSSNTVV
TPQQQLSQLDQQIATARATFKSDSPQLQTLLAQRNRIKPLVQSQGIDQLSSQLFANQAQQNELNRQILLLNKNFKQSPEE
IRKYEELQQKIEVAQANYLSYIQARENFRLEVAKQTVPWQVISPPVFGDVPIEPDLSREFLRALFIGLAVGIAAVLLREK
TDDAYHTPKEASQELGLPILGLIPYLPIVSSDSILKSLKELPGTERFAIKESLRSLFTTFRLLRADREIRLVVITSSTQN
EGKSTAASVFGNTLADLGLHVLLVDADMRLPVQHKHFAVDNVKGLSDYLGDTDDNIQDYIKPITSNLSLITAGSRAPDPA
RLLNSLRCSDMVQHLRALPGYDLIIFDTPPCLLLSDPVILGEKVDGILYLVGLGRVGREIAPQAIKRIKATGVDILGLMC
NQVAYPTRLNDYGYEYGYHYNYSYAGYRDTYSQRLASKDVAEALPDNPSDQAQSSAASGSAAKPDSNQSGSSGGLNRLKG
WFRR
>gnl|bykdb|A0A2W7AI98 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Leptolyngbya sp] (length=766 residues).
MPFSSKPAAREVNGNGNGQGHASQSFVPVTAPPSPLIDDGDDFDLNHLVAVLGRRAGIFGGVAALSFGGLTLWHLTRPPV
YNGSANLLVEPVTVVNTPGLEAVMELPGARSASGLDYTSQIRVLRGPDVIKPILVNIQRQHPEITYTTLLNDLVISQEGE
SKVLRISYRDADPEVVTTVMSEVVEGFVAYSVQDRQGELRRGLEFLDEQLQEKWQEVDTIESDLSEFQKRYDLVNVTTTA
ESVAQRLNQMLSDQEQLRVQLTSLGPLYENLRSQVGFEPSVAIGVANLNESPTYQGLLGDLREIEQTIAAESARFQSDTP
MIEVLVDQRQQLLPLLEAEAGRLVGSAVDANTLGYQGSVSRELVQQLVDTANQMQVLETQDQAIAQAVQQLRAEIQRLAD
LSRSYQQIDRELTVAESSLDRLLTSRQDLRLQMARQTAPWELISPLDESSITEMTNLPRKLLLSTVVGLLLGGVAALVRD
RADTAFHSADELVKATQLPNLALVPNAPALQKQPLLMVPDLTATMADVLTQNHSPDNLYTSFSFAEAFYSLDTNLRMLSS
DTPMQVIALTSSVPGEGKSTICAHLAIAAANLGRRVLLIDGDLRKPSQHLIFSQRNHQGLSELITQGLENPTDLVLTIPG
NPNLHLLTAGARPPPPGRLLSSRKMQQITEQYRRHYDLIIFDTPPLAGMIDAKLTAAHADGLLLVVRLNRSERSEIQRVL
ADLGNTAQAPLLGLVINGVPQIRQRGYSYYGYYGRPVVASGIDERG
>gnl|bykdb|A0A328V843 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Arthrospira sp. O9.13F] (length=541 residues).
QYFKQRNYVVDLGTEFAISVQEMAQLNRNITTLEAELNAVQSLVNSLGNQVGLNLEEAIAVNTLSQSPVVRAALQELENV
EGELAQEQRRFRDENPRIISLKGKRDNLENLLQREIQVYLGSSRPFSRGLLRVMDVKNNKIEEFVNAEIRRLDLTKQLDS
LYEARDGLERRARILPQLEQQQQELERKAEVARLTYRTLLQNLEEAQVAANKITNNARIIETANVPDEGKTAKVPLLALG
VMGGLVASTTLLLLMEMGDKSLRTVAETRDLFGYTLLGIIPSFAAPPFYRYLTGGDRSSVQVPVVDTPGSLISEIYRMIQ
ANLKFLGSDRKVRVIVVSSSVPQEGKSTVSANLAAAIAQLGHRVILIDGDMRQPIQHHIWGLTNAVGLSDVLVEEATLSE
AVKPGIDQLDILTAGVTPPNPLALLDSRRMTSLIRNFSEEYDFVIIDTPPLLLAADALTLANMASGVLMVARPRILDRDS
AKAAKEILGRSGQRILGTVINGISKNESTKYFYHAQRYFPLQKSHRRDRSAPPKISSRSSS
>gnl|bykdb|A0A355DPN1 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanobacteria bacterium UBA11162] (length=710 residues).
MLGVFCGVLAIAIPIALNKEPTYQSSMQLLIEPYVQQKQEGKPQTEEQFTDSNVEVDYATQLNLMRSSQLIQKAVDRLHP
KYPEIQVTDIKESFSLTGVQEEDTDIKDTQTKIVKVVYTSNDPIKTQDVLAAIQTVYQDYNLQQQQVRLTEGLAFINDQL
PTARDNVIQAEKALEQFRETQNLIDPVQQATTITDALSTVEQEQQAIRAQYQETQARYRVLQQQLERSPQEALTSSRLSQ
SPRYQALLNELQKTELAIAQQRVKFTDAEPRVEQLLEQRQRQLALLQEETQRVLGETSTQIAFSTQNLLTEGQLGSNDLT
LSSQLAEAQTTLQALQARDRSLAITQQQLRAKLNRLPELMAEYERLQPEVQIRRDTLQKLLEARQELGIEIARGGFKWQV
VEPPKPGKQMGPDTRRDLMLSVVVGLFLGGLAAFGREALDDAVHSSEELKRQVALPLLGIIPELPRTGGSGLLVHLPFRR
TQVAAASTLPMVYWLPFRESLDLIYKHIQLLNSAATLRSIVVTSALPSEGKSTFVVGLAFSAARLHQRVLLIDADLRRPS
LHKQLNLPNEQGLATLLVEDSSIPSPQRLSLSGSEIDVLTAGPIPPDPVKLLSSQRMRQLMAGFEQSYDLILVDTPPILG
MVDALQAASFCNGVVIVGRISRVTQSELTEAIAMLSHLNAIGIVANGANGSTNRYIAYAEQNGSPLFQLN
>gnl|bykdb|A0A355DU96 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanobacteria bacterium UBA11162] (length=319 residues).
ASIPEAPVSPKKKLILVGGIVAGSLLYIVTAFVLDLMDPSIKTAKEIRQLFKYTWLGMIPESRKKGLFWQQKINGNVPQL
VVRDVPHGITSEAYRMLEANLKFLSPDQVLKRIVVTSSVAQEGKSTVSANLAIAMAQVGRRVLLVDADMRHPMQHHIWDL
ANTVGLSEVIVHQTQFEFAVREVMDNLDVLPSGVIPPNSLALLNSKRMASLVEYFSQKYDFVIFDTPPLVLTADAMTLGK
MTDGILLVARPKVVDRVSATASKEFLLRSGQQVLGLVINGVSVEGEPDSYFHHAKAYYKEELITSTIPDSKTKKNHIRF
>gnl|bykdb|A0A433W046 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Chroococcidiopsis cubana SAG 39.79] (length=689 residues).
MKQIFSIARKHWLPLLGFNTAVLAATIYAAFYASTSIPPVWTANAKLNLPQTGGLSANLGPLGSTQTTALNFKDVSPLDV
QLAILTSDAVMKRVQAVDPEKSLYSKVSSFSQLFVVTPQPATTLIEVEAQGSRPDIAYKRLFTFLEVYQQRLNELRRKDA
EVRVQYTQEELEQARLNLNQAQANLSNFQRSTGLVNSPEQSGGLISAINNLKTTQATLIAQGQANATQAQAAAVSLGITP
QQAMNSLRLGENKEYQATRTQLSQLESTMAVTRSKYRDDSPQVQSLLQQRQQLLRQLNQQIAVAIPGANAAQIDTTLGNG
PNDSRLELMVELIRNQTLAQGTQQQAKQIQKQIDKLNTELSFITKNQAQLLDLQRKYEIAEGVYKGIIAQSEQSKTNPFN
AYPNVQTLNEPTIDPRPSIPNLRLITTGGILAAIFGSMALIFFLENRNPLLKPKDLQQVELPVLGSIPHLKQPSMERNLA
AEIDIEFQRLASSILMLEHPCLMVTSATAGEGKTTVTLGLALALVNFGFRVLVIDGDLRKAEMSRRLGKNRIKSAANASP
PMPVSVSPGFDLLPALSIPKQKIPEFFARGSFERNIKALRESGGYDYVLVDSPPVGLASETNLMSAVVCNVLFVLRSGTS
DRYPVMNSLEQLTRYNARIMGLVVNGSDSHTSVYRYGYGRQRELLEHEA
>gnl|bykdb|B0BZC6 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Acaryochloris marina] (length=707 residues).
MNESVSKVIKIIYRNRWTTVGTFLSVFTGIVVYLLITPRLYSAKVRLILDQRPATSISPLGRDIAQTPGDNNKGLATQEE
LVRSKSVLTKAIVLFNQSNQDSAIEKVTLGEVKPEVATEVIPGTQIIEITFRHTDPGVTSSLLNLIASSVIQENAETIRS
EARATRQFLENQIPRRQQELVKVESSISQFKQQYNIVSLEETDNKRLTQSIAEAEKVAEEISANLRQVQARGLALSKVID
QSSGKESYLSAKAGQNPELISLRDQLSNLESQLKIRRESLTDDHPDIQKLITEKDAAQALYQQKLATISPRSRLNSDGTV
QVANEKVTQELSEKLVLSVVERNELRDKLANTRAYISKLDARRKQYPVLEKTLASLQRKKEGATESVNLLRQKLDEARIA
EAQLVSNLRIIEEANKPTLPSYPNIPSFLVLGMMAAVALSAGVTLSAEGMDGRLRDLESIAENTNVPVLGVIPKQKNSRL
FPSLPFAELYNNLPLLESVRALSKNIEYKNSTESKVLVITSAISGEGKSFVATNLAVLSAMLSKRTLLIDADMRRPSIHK
IFQLPQDPGLQDYLRGSVKEGLPAAIHRTSVKNLSVMTSGKFSYDNVFSFETQRAKELFTEVQQHYDVIVIDTPPVMACS
DALVLSQEGRQTVVVARLDVTPKQVLNRSIDILNSNNVNVVGLAINGVTASTDKYYRYLKEDYALAA
>gnl|bykdb|B0CA08 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Acaryochloris marina] (length=710 residues).
MSNYWLMLKRRGLPAGFTFLTVLSLALLQAFQEKPIYEAVGQLKFEESQRSSKLIGLDSAVDDESRQQSSLRWQRSLDTE
ILTMKSPRRLSMLALAIESQGLFSRPSVEQIKSGLDISQFDETNVVQIRFKSYNREFPKNIVNLLMQQYVDNTPKSKQAS
TQSAISFIEKQLPQVKQRVNSAETALRKFKETYQIADLEIAKSANATNLSQLQTALDEIDRELVEVQTQQLSLQNMLKVN
PQQAILGISTAHKNISTSLEEIDKDLAEAKSNFREDHPAVLELLERQAQLKQLLSQKIEKFAQSDAQLNFDSNQEDDLRS
QLIQLDIRRNGLSKQQLKLRQQLSSYRQQARNLPQLEQRQNELERTAKASASTYRNLLEQIQELKVTENQSPLTVSILES
ATDPEPSKTTFISAAMRGGLAGILLASGVVYVLERIDRKLKSKDEIRQVYPYRVLGEIPLFDESEAESLKLPTLSDPASH
LSEAYRMLQSSLKFHGLEHSPRVLMMTSAINQEGKSTTCANLAVSLAQMNHRVLLIDADIRLASQHQIWELGNQEGLTHI
LLNKHFNYHQELPTHKVADNLEIITAGRISSNPLPMLESEQFANFVQVQIEHYDYILIDAPPLVSVADPLIIGKVVDGIL
LVARPGHLEREYAQKAHELLIHSNLSVLGTVINGILNKNELYSYYSRYGHNSNQEKTAIKRNLLKQVISK
>gnl|bykdb|B8HQ70 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanothece sp.] (length=686 residues).
MFQITSTLRRHWKPLIALNTVLIGSTALIAAFYPRTWQASARFVVPINTNQLSADIGTLGQLRPGDGVVPSDLMNPVTLQ
AEIVKSPTLIGQVLAVDPERDQHTLQSFMPLFEAKPQSLSPLMTVEVKGTTPELAHQRLSTWIKLYQKRLTYLRENDAST
RQTLPQQELQEASNNLRRTQTQLSVFRQANNITDINEQIRGLVNSISDLKTEYARALAQAQASNAQQQALSQHLRLTPQA
AMTTLRLGENKEYQLVRDRLAQVEADLATARGTLTDDNPRVQDLLEQRQKLTQLLDQNLRAAIGNSSLAGVDRSLAGSAA
GDSRIALIADLIRTQSTANGQQSQAQQLQQQLGQQVTALNRLSNKQVQLLELQREYSIAEGVYKGVMAQFQQAKISTLSS
YPSVQVLDGPLNSPRPEPRRMLIILGGLMAIAFGSSALVLLLESRNPLLSPADIQKVKQPILAKLPRLKAPSQVWNLDAE
PLLGFHRLASAISFLDLATPRLMITSAMYGEGKTTIAIGLAAALARLGFKILLVDGDLRRARLTEQLSDRYQGSWNPRET
AVVPLSPGLDLMPAPAIPNDRIVNYVAKGGFEQQLQTLQQSGEYDYVLVDTAPITLTSETGLMTTSVNNLLFVVRPGTSS
RYSVLDSFEELSLRKVNVVGVTINGIETNSEEYYYGKQRELAATEL
>gnl|bykdb|K9P6R9 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanobium gracile] (length=818 residues).
MGETQSGGGGLGGLVRTVKRRQSIFLITFAVVTGVLAINTLRQRIFSPVYQGGFQMQISNPFDNPGSGGGGGGGSVETIA
RSEIKTDVPSLIVLMRSPLLLGPVAQRQGVSLGALESNLSINQESAQVENVLNVSLSWPDPAKGKAILRQLAKDYTAFSL
TQRQAAVNSGVRFLDEQAPAIEERVQKLSQEMLKFRQRNNFVDPATAAGQILGAREGLVNQLRTLQNEQVQLDSQLKSIQ
TGKLQFTPSGAPTALEQLGRNSVLVPGRGNSAAEASSGTKTPLDLLNQFEQELATAKGTFKENSPIVQSLLARRNQLLPV
VQRQAADAVKARLLANVAQQDEINRQILLLSENFRNNPQKLAEFENINQRLLIAREQYSSYIQARERYRLEMARSISPWE
VIGPPDFGSSPVEPNIQRNLLRAIMIGLLAGLGAAILRERTDNVFHTPMEVEKDLQLPVLGLIPYLPLEPGVDIATSISK
MSSSERFAIKESLRSLFTTFRLLRADNNIRMVGITSSTQGEGKSTAVAVFSRTLADLGLKVLVIDSDMRLPMQARYLGVE
QGDGLSTLLSDSTRKPTDFIHSIAENMDVLPAGPKPPDPAKLLNSSRCKEIMEEIRALPGYDIIIVDAPPCLMLADPILL
GEKLDGILFLVGLGKVSRELAPQASRRIRASGVDVLGIICNQVNFPSRLNDYGYEYGYYYHYAYASASGYAKSASEPSTG
GFGSYVQRYRDSYMKGAATNSYISARYNEGESDVKTYFREDEDQASVPVATNGGIGPSAGSSSSLPPAESVPSRRHRPSR
EGGDGPMGWLRRRFGNRG
>gnl|bykdb|K9SGV8 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Pseudanabaena sp. PCC 7367] (length=738 residues).
MNQLQQYLFIIRRRWPVATLVFVSAVLVTTFHAIFVMKPRYRASGEMLVTPGDQAIAITNVGVSKTVNQPRSLSGGYLNT
EMQIMRSKEVIQRALEIVERPISYGEFLGSFGVNVIPGTDVLRFSYTSGDPKLAVEAANSMMQSYAENNIERNRAAVRAA
RLFIEEQLPKAEQDVENAEQQLRAFREQYNFVSASAEAEATIDRFRSTESRIEDMQVSLAKIDAQSDQLGNLVADEIDSV
EQALLRTALSQSPHTAGVMGELQQTKQAIATQLAIYREDSPQIAVLRDQERNLEQLLRQRAKQVAGIPPSESIDIDALFQ
IGGLQEQSVQQFYSLDNERVGLLEEISALNDVYSNYRERYRELPKLEQEERRLERKVTVAESTYAELLQQLQEVRIAEQQ
NIGNTRILSLASTPIDIVTPRRPRNVSLGLLLGLSAAGGAVFLLEAFDKKIKSTAAARELLGFPLLGVIPNFKKVPLFPV
ASGNRIGRTVPELVVREAPNSPISEAFRMLQTNLKFLSLKKRLKVIVVTSSVPREGKSTIAANLAATIAELGQRVLLVDA
DMRHPAQHRIWQLPNENGLSDLLTGQSPLSEVAHHVMPTLEVMPAGSKPANPVALLNSQATSNLIDYGSSNYDVMIVDTP
PMAVAADASILGKIADGIVMLCRVGVADTNNLTFSKELLEQSGQNILGMVVNASLPEDDPYGYYYSYYYNYSSKPGQRQR
QEASRQDQDQNQQETINQ
>gnl|bykdb|K9TU02 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Chroococcidiopsis thermalis] (length=689 residues).
MKQIFSIARKHWLPLLGFNTAVLAATIYAAFYASTSIPPVWTANAKLNLPQTGGLSANLGPLGSTQTTALNFKDVSPLDV
QLAILTSDAVMKRVQAVDPEKSLYSKVSSFSQLFVVTPQPATTLIEVEAQGSRPDIAYKRLFTFLEVYQQRLNELRRKDA
EVRVQYTQEELEQARLNLNQAQANLSNFQRSTGLVNSPEQSGGLISAINNLKTTQATLIAQGQANATQAQAAAVSLGITP
QQAMNSLRLGENKEYQATRTQLSQLESTMAVTRSKYRDDSPQVQSLLQQRQQLLRQLNQQIAVAIPGANAAQIDTTLGNG
PNDSRLELMVELIRNQTLAQGTQQQAKQIQKQIDKLNTELSFITKNQAQLLDLQRKYEIAEGVYKGIIAQSEQSKTNPFN
AYPNVQTLNEPTIDPRPSIPNLRLITTGGILAAIFGSMALIFFLENRNPLLKPKDLQQVELPVLGSIPHLKQPSMERNLA
AEIDIEFQRLASSILMLEHPCLMVTSATAGEGKTTVTLGLALALVNFGFRVLVIDGDLRKAEMSRRLGKNRIKSAANASP
PMPVSVSPGFDLLPALSIPKQKIPEFFARGSFERNIKALRESGGYDYVLVDSPPVGLASETNLMSAVVCNVLFVLRSGTS
DRYPVMNSLEQLTRYNARIMGLVVNGSDSHTSVYRYGYGRQRELLEHEA
>gnl|bykdb|L8M1L4 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Xenococcus sp. PCC 7305] (length=788 residues).
MNNTIVRSDFVNLPAQETGFSLSDFKQILYRRWKPALALGIMAFGVVLIPKLLSTPQYRSEAKILLKSPQNQQSAEVQLN
ALNSRRNYYNLKDLSTDILVLKSYSLINKAIEKYPETFSGLSAAEVRTKLNIFPAMINDIPTDILNISFVDSAPEVAQGV
LDALSEVYVEYSLERERSQALNAIQFIEEQLPKAEEELNKAAFAIRSFRQKNNLVDPDEYVGRVADFRQSLEEELKRGEI
ALDIAQTKYRTISNQLIELGQDPETIVTTSVLGQDGVYQSLASQLKDLETQYTLASVQFKDNYPMMQDLKLQREQLRNLL
LERSTQILGEGISPAVLDKVLVSYTQTNIVAAGDSGSQVSTSGSTLQQLAEQLLSTQTEYLSLQSQINQINQAKANVEAD
FQRLPQLQEIYTRLQRNIKIQSQAVDYLLQRKQELQIAAAEEITPWQILDKPYLPAQPISPNIQKALVSSLVAGGLWAIA
IAFLLHQLDNRIKLVEEVKRITHLPLLGAVPQVFDPLIVIEDNTVKQSYSYRYSSFTESLRAIAMNISYTVVDTRKIKSL
VTTSSTSSEGKTTVTYNLALALTELDAKVLVVDADLRKPKIHKMAKISNEQGLSEVISDNKHSWTEVVQNVTGNLDVITA
GANVANPIALLRSQIMSELLKEWEAAYDYVLIDTPPIGAMADAQSLVHQVDGVMLVTGINKVNQKAIVNTLEVLQSSNCN
LIGFIANMVEKDLDYYSYSYYSHYYNQPSNGNGNGNGNGNGNGNGNGNGNGNREAGSMNSIMQQFRRR
>gnl|bykdb|X5JJE9 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Richelia intracellularis] (length=676 residues).
MLDDKRVSISQLGQNLTQVSRQYGGPDPVSDQAELAKSQPVLERAIAIAMPKSNKLTMDALTATLDEGLKVKTIPTTNIL
ELTYAHENADLAAKMLNAVSQAMLEENIKNIKSEAKKVKEFLEKTEVPRARERLRLAEAAENRYRQRSGIVSFDEQSRSL
VESLSTLEQEERTLVSQLQEVESREASLRQITQAGNVGNAYNNVRTGQDEDLRKLRAELVEIEQKLIVARNSFTEDHPDV
IKLLQERDGVASLYQQRLGRIAPGNQGTPSSNIAGDQISQELTSQLVTTEVQRVALENRFRVVQNERANLQARLAQLPIK
QQPLTQLTREREEAAESLKTLQRKLEEARIAEAQKVEKLRVIEKAKPPRLPTSPKPAVVLVLATVFGAVLATGIILLLEI
TDNTLQDPLEAEELVKLPLLGVLPRLPESALILKPADQFLDRVGFVEPYRMLFKNLEFRSLEKLRLIIVSSTISGEGKSV
VASHLAATSAMLSRRTLLIDADLRRPVQHNLFNMVPKTGIGDVLQGGMTLQEAVQPTSVENLFILPCGELHGRPSQMLES
EAMQALLIEAQSLYNCVILDTSPLSDCADAATLGQHSDGLVMVTRPSFTIKEVLQRTVSELNKNRIPVLGIAVNGITGFS
ERYYRYPVKGYQPVLEKPVKRLVGSTAVESRTEISE
© 1998-2019