BYKdb

Dataset for cluster tadcd of phylum cyanobacteria

[Download (right click)] [Alignment] [Repertoires]

379 sequence(s)

>gnl|bykdb|A0A076HBF2 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Synechococcus sp. KORDI-49] (length=844 residues).
MSNLVAAPGQSPDFDARNVQTVRVHEVGTNEPIGTEDEIDLRELWRALQRRKKLVGVTAGSIIVLAALFTTYQRLFRPVY
EGSFSLLITDPISNEGGGRSGMANVEGTMFEQLARNTTSNDIPTLIEVLQSPVLLQPVADKFELTTDALRSRVDISTGGA
KRKEAEGVLNVRLTGRNPIEDERLLNALSNTYLQAALQQRQQRLADGLAFLNKQAPSLQTRLDQLQGELADFRTRYSLLE
PTAEGGALKKRETAMAAQVLGLEADRNRLLKVRGEIASGTLTARGFQEAIGQNNGGGQANSGLTVSDVDQSLLQQLLKVE
TELAEARSRYNPGSSMVLGLEERLNQLRPLLRQNQLEAADAALSLNAGRLATARMQQATLNQQFLQQPGLIKQYEALQQR
LEIAKQNLAGLVSAREKFQLEIAQRSVPWRVIAEPTINPKPIKPSVPRNLALGTVLGLVAGAAAGLLRDRMDHVFHHAGE
VKDDLGLPLLGHIPHVEFFKGVREDKRFLLQELDRSVTGEDDPEAAKQRRYQRFLYQEAFRNLFTSIRFLNSDQPLRSIA
LTSSLPAEGKSLVNVLLAKTLSEMGQRILLIDADLRKPQMHVRLGLNNLSGLSNVLTEDDQTWRDAVQTVPGYQNWSVLT
AGRRPPDPTRLLSSNRMRSLVNELEASGQFDLVLFDTPPVLGLADAALVAEHCDGLMLLVSLDRVDRSLPKESVSRIRSS
GAPLLGIVTNALKPEKQSAAYGYGKYGYGKYGYGKYGYGGYGGYGYGGYGYAAYDTSAAYAYYANDEDDTQSSDNGDSPA
AVTTRKRRSLQPSSNGNGKVNDKAPNLRDRWRAQRQRLMKWLDN
>gnl|bykdb|A0A0C1NCB0 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Tolypothrix bouteillei VB521301] (length=740 residues).
MEETKGHQEEIDIQKYLLVIQRRWHIVAGVMLVSMVLSGLGIYLQKPKYQATGILLIQSDRTSSLTKAGEKIGHLESLMR
EGNPSDTQAVVVTSAPILQQVIDKLALKNNDGTPLQPEDLEIKVDPVVGTDVLKVSYTAKAPNLAANVVNLVMQAYVNNN
IQSNQEQVLAAGEFIKKQLPYARADLERASEALRQFKTSNKIVELKQEATSAISNVAQLDDTINQAQAELAEVSAEQAKV
LNQLKLAGQDAVEITSLNQIPGVQDVLTELQKVQTKLANERARYTEKHPSVVNLENEEVTLKALLKQRVGETAGSQREIS
TDKLQLGKIKQDMTVEYANLEKKRQGLEEKIKSLSDIRNGYKQRLTVMPNLEKKHGDLERRLDLAQKNYENLTLRLQEIQ
VAEKQTVGNARIIQPAQLPQKPALSKLTLLLPVGGILGGLLLGVAAAFFVDLVDRSLKTAKEAEEFFKYTVLGLIPTFES
STKSSSESSTKSSSDRLMGEATSPRVIVATSPRTVVHEAYQMLQANLKFISHKRLRTIVVTSSVPGEGKSEVSANLAAVL
AQSERKVLLIDADMRLPSQHHIWGLINSVGLSNVIVAQDEFSQAVQEVTSHLSVLTAGVQPPNPLALIDSERMTSLIQMF
SETYDYIVIDTPPLVGTADAAILGKMADGVLLVVRPGVVDSRSATAAKSLLERSEANILGIVANAVKVKHEPNSYFYYAD
PRTGQSVTEAEVESERWVYK
>gnl|bykdb|A0A0C1QS61 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Tolypothrix bouteillei VB521301] (length=708 residues).
MEKSVSSVLGVLKRRSLPAVAAFVATIGGAIAYLAVTPSQYEASARLMLDSKQTSVSELGRNLSQVSSNTPGGPSPLADQ
AELVKSQRVLNRALQIFKSSYKSTTQVKIQDLNKGLGVKIVPATNILQLSYQSKNPKLAAQLLNSVARAMEEESANTIRQ
EAANVRKFLEMEVPKAREKLENAELTENRYRRSSGIISFTKQSESLVDSLAALENQERTLSAQLRELRSQDASLRQITNA
TALKSAYASVRGGQDEQLKELRTKLTELETKLAESRAKYTEDHPDVRSLLYQRNTIRNLYIQGLNRVSSGERPVSPNNVA
ADQVSQNFSAQLIANDIERTAVENKLKSVQTQRANLQLRLAQLPIQQQNLTPLTRQREEAAETLKLLQGKYEEARIAEAQ
QVGNLRIIEEAQPPTSATSPKKPAVLVLATVLGTLLATSIVLLLEMMDNTLRDASEAEELLKLSLLGVLPRLPSKTLVLE
PSQRFLDNMSLVEPYRMLFKTLEFRSDRMRVIVVSSSIAGEGKSIVASHLAAIAGMLSWRTLIIDADLRRPEQHTLFNLA
GKPGVSDVLEGDISLADAVQSTDIENLDVLTCGELHGRPSQLLESIAMKSLVAEASENYDLVILDTPPLSACADAATLAK
QSDGVMLVTRPGFTLKEILSRSVSELTRNRIPVLGVVVNGMTNQTEKYYQYSVNGYLPRRQLTSSRSK
>gnl|bykdb|A0A0C1XJI7 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Hassallia byssoidea VB512170] (length=725 residues).
MEKGISSLLAVLKRRAFPALVTFTAVIGGAFAYLTVTPRLYEASARLMQDDRRVSVSELGRDLTSVSSGAPGGPSPLANQ
AELVKSERVLERAIALASLKSYNGSPGSQITSGELNQGLDVKIVPATNILELSYKSKDPELAAQLLNAVSQAMIEENTKT
ISSEATKVREFLETSEIPNAYKRLREAENKESQYRHISGIISFEEQTKSTVESLATLEDQERSLTAQLQEAKGRDASLRQ
ITDAKSLDKAYASVRGGQDEQLKTLRAKLTELNTKLIEARLRLTENHPSVISLVEQRDNLNKLYTEQLGRVSSANSSVAT
NSVAGDQISQDLTSKLLANETERSAIENKLKTVQAQRTQLQSRLAKLPLQQQPLIALTREREDATASLKSLQSKLEEARI
TEAQKVSNLRLIEAAKPPTIASSPKRSAVLALATVFGTVLGTGVMLLLEVLDNTLKDASEAEELLSLPLLGVLPRLPAKT
LVLEPADRFLDDIGLVEPYRMLLKTLEFRSTDKVQVIVVSSTLSGEGKSIVASHLAAISAMLSRRTLIIDADLRRPMQHT
LFNLAPKPGITDVIEKRRSLNQAVQLTDVDNLHVLTGGEFHGRPSQLLESPAMKSLVAEAAENYDMVIIDTAPISACADA
ATLARQSDGIMLVTRPSITIKEVLQRAVSELNNNQIPVLGVVVNGMTEQTEKYFRYPVDNDRPLGGRLPRRLTAVDSGRK
NYDNG
>gnl|bykdb|A0A0C1XVC4 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Hassallia byssoidea VB512170] (length=728 residues).
METKNYPEEIDVQKYLLVLKRRWLIASGVFAVFATLGGINFVMQPPVYEGSGKLLFQSNQTSSLTGVGEKIGHLESIKRE
ANPLDTQAIVMQSEPVILDVIKTLNLKDKKGNPLSPDAISIKTEAVVGTDVLKVSYTSDNPESAKAIVDQVMKSYIANNI
LSNRTQAISAGGFIEKELPRAKAQLEKAAEALREFKLKNQILELAEETRASVKNISDVENELAKARSELADASAQEIQIR
RQMNLPVDQAVDITSLSQIPAVQGLLAELQKVETQLAALKARYTETHPAVVDLESQEANINSLLQQQISQSLGYKAAIAP
GKLQMGEIKQNLTSDFVRLQSQRLGLEKKVEALSAIIASYKRRADVMPNLEKQQGDLERGLSIAQKSYENLLTRQQEIQV
AENQTVGNAKVVEYAKVAPSPAVKRKRFVITLGSGFVGLLLGVASAFFVDLIDRRLKTTKEAEALFGYTLLGLIPKFENN
NTSTPLDSSLEKVSQRIIVATSPRTVIHEAYQMLQANLKFISLDRKISTIVVTSSVSGEGKTEVAANLAAVMSLAGRRVL
LVDADMRQPSQHHLWGLINSVGLSNFMVGENKFTNSVRKIANNLSVLTAGVMPPNPLALIDSERMTSFIDILSKTYDCVI
FDTPPLIGSADAAVLGNMVDGVLIVVRPGVVDSNTATAAKSLLARSEANILGIVANAVNVKHEPDNYFYYNNSRTENGVE
KVDTASIP
>gnl|bykdb|A0A0C2LBE2 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Scytonema tolypothrichoides VB-61278] (length=735 residues).
MSAMEPVPNSEEIDFQKYWLILQRRWLPAVGVCGVVVSLASLLAFSSKPTFKAEGSLLIKTNRTSSLTGLGEAIGRLDTL
TMESNPSETQAKIVASVPVIQETIAELDLKDDKGKAITIEELTNTLKISSLKGTEILQVSYIDKDPKLAAKVVNKVMQAY
IKNNIEANRQEAVSARKFIQKQLPTTEVSVKQAESALRQFKENNKIITLQEEASAAVQAIAKLNEQISQAQAQLEDVTAR
SQKLQNQAKIDSQQTVTNSSLTQASGIQQVLTQLQEAQSQLAVERSRLKPEHPIIVNLEEKVAALNSVLQQRMKQVTGSN
QQISLGNLQNGSLRQKLLEDYAGTEAQRVGLVKQIATLSNQRTVYKERANILPKLEQTQRELERKLKAAQTTYETLLTRL
QEVQVAENQNIGNARVISPALVPDKSTGSGKILIIGAGGILGVLFGAVAAFALDTIDPSLKTVKQAKELFKYTLLGVIPL
TGRNQKKSLRVPEVDQSIPKVIGRDIPHFPVGDAYQMLQANLKFLSSDREPRVIVVTSSVSGEGKSEVAANLAMAMTQVG
HRVLLVDADMRHPVQHHVWNLTNAVGLSHVIVNPDTLNVALQEAMPNLDVIPSGVVPPNPVALLDSKCMAALVSSFTEEY
DFVIFDTPPLGGIADAAVLGNLVDGILWVVRPGVVDFASANAARDFLKQSGLNVLGMVINGVNVKSEPDSYFYYTKEAVE
SSRSVSRNSVVVRRN
>gnl|bykdb|A0A0C2LFH0 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Scytonema tolypothrichoides VB-61278] (length=740 residues).
METRGYQEEVEIQKYWLVLKRRWPIVVGVLLASIGFSSFLIFLQKPEYQASGMLLFKSDRTSSLTKVGEKIGDLESLMRE
GNPLETQAVILKSEPILKEVIDTLGLKDKKGNALDPESLKIKVEPIVGTDVLKVSYTSENPELTASVVNQVMKSYVAKNI
QYNRTQVVAAGEFIKKQLPQARVELNQAAEALREFKTRYKIIELPEEASAAVQNVASIDEEINQARAALADTSAQEEKIR
SQLNLAGSQAVEITSISQIPGVQEVLTELQKVQTKLANERARYTSEHPAITELKNKEITLNALLQQRVEQVLGPSGVKQV
LGTQQNVAPGKLQIGKIKENLTTQYALIQAQRQGLENKIQALSNIRGTYKQRLSALPNLEKKQGDLERRLSIAQKNYENL
VTRLQDIEVAEKQTVGNAKEIQLAQVPKRPSVSKITFLLAGGSVFVGLLLGTAAAFFVDLIDRTLKTVKEAETFFGYTLL
GLIPKFESKKTSAPVNLMSDKASARIIVATSPRSVVHEAYQMLQANLKFISHRKVRTIVVTSSVPGEGKSEVSANLAAVL
AQAGRRVLLVDADMRKPSQHHLWGLVNSVGLSNVIVGQDQLPQTVQTVTKELSILTAGVQPPNPLGLIDSDRMATLIETF
CDRYDYIVFDTPPLAGTADAAVLGKMADGVLLVARPGVVDSASATAAKSLLERSEARILGMIANAVNLKQESGNHFYYSN
VRGGQDVIETAKGNEQWVYK
>gnl|bykdb|A0A0C2LVR7 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Tolypothrix campylonemoides VB511288] (length=741 residues).
MESKPNFEEIDFQKYLLVLQRRWVPAVGVFGAVVTLVSLYAFSLKPTYNAEGSLLIKTNRTSSLTGLGEALGRLESLGVN
NNPSDTQAKIVASVPVIQETITELDLRDKRGKPLTIQELSKKLKIKGDKGTEVLEVSYTDTNPTLAAKVVNKLMQAYIKN
NIRANREEAVSARKFIQKQLPATEISVKRAEAQLRRFKEENKVIALQEEATAAVNEISKLEEQISQAEAQLADVTAKSQK
LQNQAKIDSQQGVTFTSLSQTPGIQQVLTQLQEAQSQLAVERTRLQPEHPIIINLEEKVAALNSLLQQRLKQAVGNSRQI
PTLNLQTGELRQKLLEDYARSEAERVGLERQIITLSSKRSAYKQRANVLPKLEQNQRQLERKLKAAQTTYETLLTRLQEI
QVAENQNVGNARIISPALIPDKPAGSQKILVITGGGVLGILLGVIAAFSLDLIDRSVKTVKEARELFKYTMLGVIPSINS
NSKKSSFLPGVDQPIPRVIGTDIPQFPVGDAYQMLQANLMFLSSDNQLKAIVVTSSVAKEGKSEVAVNLAVAMAQVGRRV
LLVDADMRHPVQHHVWGMTNAVGLSNVIVDELPIDIAVQEAIPNLYVLPSGVVPPNPMALLDSRRMAALVNTFVKDYDFV
IFDTPPLAGTADAAVLGKLADGILLVVRPGVVDSASANAAKEFLTQSGQQVLGMVINGVNVKREPDSYFYYTKESDEPGV
VSRNSVIVRQNRREAIGRGDV
>gnl|bykdb|A0A0C2MDK7 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Scytonema tolypothrichoides VB-61278] (length=727 residues).
MEKGISSVLAVLRRRSLPAVAAFVAVMGGAIAYLAVTPSKYEAYARLMLDDKRVSVSELGRDLTQVSANAPGISPLADQA
ELIKSQRVLERAIAIAFPQTKGNLSLSPVSTAELSHNLKVKIVPATNILELSYQSRDPQLAAKVLNAVSQAMVEDNVKSI
GLEATKVKQFLEQKQVPEAEKKLLQAEDLENKYRKSSGIVSVEEQTKSLVQSIATLEHQERTLSAQLQEIKTKDASLGQI
TNAGNLNNAYSSVRSGQDDEIKKLRAKLSELENKIIEARLRFTENHPVVANLVGERDALRKVLSEQLARVSTKDQSVSTK
NFAGDQLSQELNSKFILNRIEESAVKERLTLLQKKEADLQNRLAQLPIKQQQLTILTRKREEAAASLKFLQGKLEEARLT
EAQKVSNIRAIENAVAPSSPSQPKQKVVLALAAAFGTMLAVGVVLLLEVMDNTLRDATEAEELLQLPLLGILPRLPAKTL
VLEPANQFLDNMELIEPYRTLFKTLEFRRSEQLRAIVVSSTISGEGKSVVASHLAAVVGMLSWRTLIIDADLRRPSQHTL
FNLAPGPGITDVLEGNISLLDAVQPTDIENLDVLTCGELHGRPSQLLESIAMKSLMAEAAENYDLVIIDTPPLTACADAL
TLAQEGNGLMLVTRPGFTDKEVLSRCVRELTQNRISILGVVVNGMTHLTQNYRYPTYRYRPRLPKSQKQLIGAGDSSRNS
ANGMRQR
>gnl|bykdb|A0A0C2PT44 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Tolypothrix campylonemoides VB511288] (length=742 residues).
METKGYQEEIDIQKYWLVLKRRWPIVAGSVLTSIGLTTFAVFLQKPEYQATGMLLFKSDRTSSLTKVGEKIGDLESLMRE
GNPLETQAVILKSEPILEEVIKTLELKDKKGETLDSESLKIKVEPIVGTDVLKVSYTSENPELAASVVNQLMKSYVANNI
QSNRAQVFAAGEYIKKQLRYARAELERSAEALRQFKTRYKIIELPEEASAAVQNLGQIDQEINQARAALADVSAQEAKIN
TQLNLAGDQAVEVASISQIPGVQEVLGELQKVQTKLANEKARYTSEHPDIAELKNQEVTLNALLQQRIEQVLGAKGIKQV
LGTQQNVPPGKLQVAKIKENLTSEFAKIQAQRQGLESKIQALSKIQASYKERLAMMPNLEKKQGDYERKLSISKKNYENL
VTRLQEIEVAEKQTVGNAREIQPAKVPKKPVLSKVVLLLAGGGVFVGLLLGVAAAFFVDLVDRSLKTVKEAETFFGYTML
GLIPKFESNSTSAATKLMSEGVSARVIVATSPRSVIHEAYQMLQANLKFISHKKVRTIVVTSSVAGEGKSEVSANLAAVL
AQAGRRVLLVDADMRKPTQHHFWGVINSVGLSNLIVCQAEFPQGVQTVTKDLSVLTAGVVPPNPLALIDSDRMASLIKMF
SDKYDYIVFDTPPLVGTADAAVLGKMADGVLLVVRPGVVDSASATAAKSLLERSDANILGMVANAVNVKHEPDSYFYYSS
PRVGQSVVETEVGTEQWTHKSI
>gnl|bykdb|A0A0C2QLT0 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Tolypothrix campylonemoides VB511288] (length=726 residues).
MEKGISSVIGVLRRRSLPAIAAFVAVIGGAIAYLAVTPSKYEAYARLMQDDKRVSVSELGRDLTQVSSNAPGISPLADQA
ELIKSQRVLERAIAIAFPEIKGNLQRSPVTTTELSRNLKVKIVPATNILELSYQSKDPRLAAKLLNAISQAMVEDNTKAI
SSEATKVKKFLEEKQVPEADKQLRLAEATENKYRKLSGIVSLEEQTKSLVQSIATVEDQERTLSTQLQEIKARDASLRQI
TNTENLNKAYSSVRSGQDDEIKKLRANLSELENKIVEARLRFTDEHPNVTNLVGQRDALRAMYSEQLARVSSQNQTTSAN
NFAGDQLSQELNSKFILNSIEESAVNNRLKLLQVKKANLQARLAQLPITQQTLTVLTRKREEAAASLKFLQSKLEEARLT
EAQKVSNIRVIENAVAPSSPSEPKPKVILALASVFGTMLAVGIVLLLEVMDNTLRDASEAEELLQLPLLGVLPRLPGKTL
VLKPANRFLDNIGLVEPYRTLFKTLEFRSPEQVRLIVVSSPISGEGKSVVASHLAAVAAMLSWRTLIIDADLRRPVQHTL
FNLTGKPGITDVLEGNVSLLDAVQPTDIENLDVLTCGELYGRPSQLLESIAMKSLVAEAAENYDLVIIDTPPLSACADAS
TLAQQSDGVMLVTRPGFTEKEVLSRSVSELTRNRIPILGVVVNGMTNQTEKYFRYPVDGYQPRLPKSQKRLIGVGGSGKN
SANRSR
>gnl|bykdb|A0A0D6KV51 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Tolypothrix sp. PCC 7601] (length=721 residues).
MVKRQWIPAASIFASTVALSVVATTLLKPSYEAEGKLLFKTPTFNVVGSELLPSESQARGDLRPLVSTQNPITTQIEVIT
SPLLLQKTIDELQLKNKEGKPLTPEVLKKALNIKIIGGTDVLLVSYQSPNPQEAAAVVNNVMNLYLENDILTNRAEAEAT
RKFMAKQLPNNRSAVQDAEAALRIFKQKYNIVDLAEETRSAVAIIGNLDSNINGVKADFDQATAQTNELRQKVNLNSQEA
LSASAVSQSPAVQGILTQLQDIDRQLASERSRFLDDNPVIINLEQRKTNLQALLKQEIGQTGAGPVNYPPKTLQIGETKQ
NLIRDFLQSEVQRRGLEQKLTSLYNSRSVYEQRVRIIPQLEQQQRDLERRLEVAQSTYQTLLKKVQELQLAENNNTPNAR
IIAKGSVPIKPTLGLKPFILVLGVLLGAFLATTAVIFLETRDRSLKTLKEIREIFGYTLLGIVPSSTKKIRSRYRETEIA
TQEIAVIDSPSSLTSEIYRMIQANLRFLSSDKVLKTIVVSSAVPKEGKSTVSANLAAAIAQLGRKVLLIDADMRVPTQHH
LWQITNTAGLSEVLVGEAEFKTAASNVIENLDVLTAGVRPPNPLALLDSKRMATLIQEFSNQYDFVIIDAPPLLLAADAV
TLSHMTDGILLVARPGVIDSNSANNAKELLQRSGQNVLGLLVNGINEKNESSNDFYHAKEYFSADTVTTESGAGVRTWSQ
R
>gnl|bykdb|A0A0D6Y7R4 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Mastigocladus laminosus UU774] (length=727 residues).
METNSYTQETEIQQYILVLKRRWQLIASIILASIGLSGLALFMQKPEYQADGILLFKSDRTSSLTKVGEKIGDLEALMRE
GNPLETQAVIVNSHPMLQEVITALDLKDEQGKIIDPELLKINVKPIVGTDVLKVSYTSNDPELAAAIVNQLMKSYVENNI
QTNRAQVSAAGDFIKEQLPNSRRELERAAEALRQFKIQNRVIQLAEESSAAIDIISKLDQEMNQIKAALADVTAQEAQIA
SQLNVSENQAVTVASLSQIPGVQEVLTELQKVQTKLANARAIYTERNPIIIDLKNQQATLNSLLQQRTQQYSGIPLVSPS
KLQIGKIRESLVDNYVQLKAERQGLEKKFRTLFNIRVNYQQQLAMMPSLEKQQQSLERKLESAKNGYENLVTRLQEIQVA
EKQTIGNARIVQPAQIPKKPVISKTKILLASGSIFAGVLLSIAAAFFVDLIDRSLKTVKETETFFGYILLGLIPKYKPNN
FVSAVQDIEDGVYPQVITTTSPRTLVHEAYQMLQANLKFISHRKVRKIVVTSSVSAEGKSEVSANLAAVIAQSGKRVLLV
DADMRKPTQHHLWSLINSVGLSHLLVGQAVFSEAVHKVTEFLSVLTAGVIPPNPLALIDSEGMTSLVDVFAENYDYVIFD
TPPLVGIADAAVLGKMADGILLVTRPGVLDSPSAAAAKSLLERSEANVLGIIANAVNVKQEPNSYFYYSSLRDRKSVADL
ERLAKIQ
>gnl|bykdb|A0A0D6YBN8 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Mastigocladus laminosus UU774] (length=740 residues).
MNMVSPALGSGAPEPVYNEPQQKMVNASPVGESIPGIRQYLRMALRWRFVILGAIALCLIIGLIVTLLMTPQYTAGATIE
ISRESNQVTDFQGVERESGFADQEFYQTQYGLLQSRVLAERVAVQLRLVDDPSFFERFGVDQDDPAFDEINGRYAAGGRL
ARQRIAGETLLDNMSIAPSRLSRLVGVNFTSPDPDFSMRVANAWAENFIQTNLERKVQATSYGRNLLERELAQAKQRLDD
SQRQLVSYAEQQRIINLPSQGANENTTAERSIVADELASLNSALSQATADRISAEARVRAAGQAGQSTEALRNLAINSLR
QRRAELAAEHQRLLVQFEPNYPPARALQSQIDQLDRSIAREESRISGSIQSEYNQAASRENALRARVERLKSSYLDLRRR
SIQYNIYQQEVDTNRALYDGLLQRFKEIGVAGGVGINNVSVVDPADIPQKPSSPRLLINLLVSLLAGMALGVGLAFALEQ
MDEAIADPEEVERRLGLSLLGSVPRVEGIEPREALLDRKSDLVDAYLAIQTSLGFTTEHGVPRSIAITSTRPAEGKSTTA
LAVATMLARSQKKVILVDGDMRSPSIHHLGGVDHERGLSNFLTGHDNIQDLTFEMRDLGFTAMSAGPIPPNAAELLTGHR
LQMLVARLLESYDHVVIDSPPVMGLADAPLIASRVEGVVYAVESHGIRSSLVKTALQRLRAANAYILGGVLTKFEARKAH
YGYGYDYGYGYGREKADQGR
>gnl|bykdb|A0A0D6YFE2 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Mastigocladus laminosus UU774] (length=731 residues).
MKESEFKVEEIDFQKYLLVLQRRWMTAVGICGVVLSLALLYAFSLKPTYTAQASLLIKTNRTSSLTGLGEDIGRLESLVR
ENSPVDTQAKIVISVPVIQETITSLSLKNNEGEPLTVEELLENLKVEGVKGTDVLEISYTDENPELAAKVINKIVDTYIQ
QNIQANREEATSAGRFILQQLPKTEEAVQKAELALRRFKEKNKVIVLQEEATAAVNSISKLEDEIAEAQAQLVDANARLE
KLQNQARVSSQEAVSAVDLSQVAGTQEVIKQLQEAQTELAVARTRYLPGHPTVSQLAEKVSALKNLLQQRVEQVGGNNQQ
ISTANLQMGEVRQKLIEDLANTDKERAGLEQRIADLRNTWSLYKQRANVLPRLEQTQRELERKLKAAQTTYETLLTRLQE
INVAENQSIGNARIISPALVPDEPSGMRKALIVFGGGILGILLGIITALASDLIDRSIKTVKEARELFQYTLLGVIPSVS
RSGKSSYSVEGLDRPVPRVVGRDVPYFPVGDAYQMLQANLKFLSDKQLKAITVTSSIPKEGKSEVCANLAVAMAEVERRV
LLVDADMRHPIQHHIWQLSNKKGLSNLIVDKVALETVVHEVMPNLHVLTSGVIPPNPVALLDSDRMATLVANFTEDYDCV
IFDAPPLAGTADAAVLGKLVDGILLVVRPEVVDFASANAAKEFLTQSGQKVLGMVINGVSVKRERDSYFYYAKDSMESSS
VSKSSIMVKNR
>gnl|bykdb|A0A0D6YL98 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Mastigocladus laminosus UU774] (length=698 residues).
MEKGLSSLPFILKRRALPALVTFAAVIGGAIAYLLITPRLYEISTRLILDQKRVSVSELGRDLTQLSPGTSGNSNPLADQ
AELIKSQRVLQKALAKVAAESGFSSPENELTVGQLSRNLKVKIVPATNILEVSYLNKDPTLATKVVNAVSQAMVEDNTQV
IRQEAANVRKFLEKKVPDARKRVEEAEQKENKYRQSSGIVSFDEQTKSLVNSLATVEEQENTLVAQLQELRSKEGSLRQV
TDAKALNQAYAAVRGGQDEELKALRTKLAEIETNLVEARLSLTDSHPTVMNLLGQRNGLRALYFQGLARVSPRSKSISSS
SVAGDKISQDLTSELIINDVERLAVEKKFRSVQANRNNLQARLAQLPIKQQQLTPLTRKREEAVESLKLLQSKLEEARIA
EAQLVGNIQIIEAAQPPKKPSLPNKKAVLAIAIVFGTALATGIVLLLELMDHTLKDASEAEDLLKLPLLAVLPSLPADAI
ALEPSGQFLDHLGLVEPYRTLLKNLEFRNPESLRSIVVSSTITGEGKSVVASHLAVISAMLSRRTLLIDADLRRPMLHTL
FNLAPQPGITDVIDSQRSLEETVQRTHIANLSVLTCGDLYGRPSHLLESEAMRSVIIEATRLYDFVIIDTPPLGACADGQ
TLGRQSGGILLVTRPNFTIKEVLQKAVSELTHNQIPIIGVVVNGITQQTERYYRXLQI
>gnl|bykdb|A0A0D8ZUV2 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Aliterella atlantica CENA595] (length=728 residues).
MEFIDADIHKLWLILKRRWLPAAGVFSCVVGLSVVAAMMPKSSYQAEGKLLLKRVNETSAATGLGSQIGELDTLAQQTNP
LKTEAAVLSSIPLAQQTITALNLKDNDGEVLLPEGFLKKQNIKQLAATDVLEVTYKSNDPQEAAAVVNKLMSLYIENNVL
SNRTAAVEASKFIANQLPKTEARVRQAEAALRQFKEQNQIVSLDEEVKSAVGIIKELESQINTTEAALANANARYATLQQ
QVGMSSAQAVATNSLNQAGGIQKLLEESQQLEDRLATERTRLQEDHPTIVNLKLRQAALKALLDKRVANTNSPVQGANLQ
IGESKQKLNEELVQSEAERLGLAKQLALLSSTQDTYKQRANVFPKLEQNQRELERQLQASQSTYQSLLQKLQELKVAENQ
NTGNASIVEPALVPDKASIKLRVMILGLGVIVSALLAGATIIILEVRDTSVKTLKEAQELFGYTFLGTIPMLGKKANSRG
KDAEATIPELPVRDMPRSPLSEAYRMLQANLKFLSSDKPLRVIVVTSSVPREGKSTVSANLATAMAQLGYRVLLVDADMR
RPVQHHIWKLNNITGLSDVIVGQSEFKTSVRTAIKNLDVLTAGVMPPNPIALLNSQRMATLIDDFSATYDFVIVDAPPLL
VAADAVTLGKMTDGILLVARPGVLDSRAAGAAQESLERSDQNVLGLVVNGVIVENESDSYFYFGKEYYSDEDVPSLKVSN
KERSVEGI
>gnl|bykdb|A0A0D8ZYV0 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Aliterella atlantica CENA595] (length=742 residues).
MVRGIENNPNVANETEPGYGQLFAVLSRRRYWLLGVLGGVLTIATALTLTAEPTFQSTMQILIEANYQGRKDIQPGADSE
FTDANVEIDYATQINVMRSTLLLQRAVDLLKPEYPDMTVKELKQTLVLTPLVEENSNTKYTKIVEANYVSNDPVKTQKVL
QTIYQVYQSYNREQQEQRLKKGLKFINEQIPGVRNQVAQSEAQLEKFRTNQNLIDPEQQAAAINNSLNAVVQQRQVLRAQ
FQDTEARYRVLQQQVGSTPQVALSSSRLSQSPRYQSLLNELQRTDLLLAARRGTFTDADPGVQKLIELRQSQQALLQAEQ
ARVVGANVAQANAAGDLLSQGQRGGLDLNITAQLAEVQTSLSALQAQDVSLAKTEQGLRSQLNRFPKLLEEYNRLLPIVQ
INREKLQQLLRAQQELSLEIARGGFEWQALEQPVLGLQVGPNIKQNLLLGLVAGLMLGGVAAFLREATDDAVHTSDELEK
QVSIPLLGMTPEMPQTKASEPVVSLPFGKPNVLAPWTVQVSNWPPSWESLDLIYKNIQLLNTAVASLQSIMVTSAVAGEG
KSTLALGLALSAARLHQRVLLIDADLRRPNLHQMLNLPNEEGLSTLLASDANVPSNAGIQSSGSYIDILTAGPMPADPAN
LLSSERMRELMAKFEDTYDLVLVDAPPVLGMVDAILSASFCSGVVLVSRMGKVTRTELTQATAMLSKLNMIGVVANQGHG
VSHSYANYGKEQGVVLQQSWGQ
>gnl|bykdb|A0A0F5YE28 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Limnoraphis robusta CS-951] (length=735 residues).
MEDRESIDLDIGKYLQTVKRYWLIVISVFLLCVGLSVYGTKYLKPTYAASGKLLFKVDRTSSLAGIGEGLGELKALLADQ
TPLSTQIEIISSNRLLNQVIEQLNLVDDEGKLIDPESIRKSLEVKIIGGTDIVSLSYESPDPLEAANIVNTLMEVYIQTN
VNMNQDEAREAREFISQQLPPVQQEVFRAEQALRSFKEKNQVLDLEEEFRTAVLEQAELNRKITVLESELSGVNALAESL
QTQAGFDLEEAIAINTLSQSPVLIGILTELENVESELVNERKRFKDQNPRIIALKQKRDSLNAALQEQVEQVLGSQAVVP
EGLLQVPQGQKNNQLERFIANEIQRVELTRQLDSLYASRINYEQRSQNLPQLEQEQQELQRKVQVAQVTYETLLKNLEEV
QVAENKSTNNARVIEEAIVPEEGSTAKTKLIALGIMLGLVGATTSVLILAMGDQNIRTVEEAKKTFGYTLLGIIPMFKNK
RFSDYFQGERASQQIPVVEASDSFISEIYRMLQANLKFLSSDKRIKTIVVTSSVPKEGKSTVSANLAATLAQLGYRVMLI
DADMRQPSQHHLWGLTNAVGLSDILVGQAELSSVIRQGIERLDIIPSGVTPPNPLALLDSKRMTSLIRNFSEDYDFVIID
TPPLILAADALTLSQMASGVLLVARPKVLDRGSANSAKEMLERSGQRVLGLVVNAISKNESAQYFYHAKRYFPSRKSNRR
DLNQLNSQVNYYSKK
>gnl|bykdb|A0A0K2M5H0 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Anabaena sp. WA102] (length=735 residues).
MSINQEDQDSPIDIQQYWLIFKRRWPVASVVFAFVFGVTALVTYSTKPVYESEGKLVFTKKSGASSLSSLSQQMGELGAL
TNLSNPVDTESEIIRSYPIVIKTITTLKLTDNQGKQLSLEVFLKKLKLKTVRGTDVMQLSYRSTNPQEAADVVNSLMKYY
LESNVRTNRTEARSAREFLSKELPEVEHRVTKAEMNLRRFKENNRVVALDVEAKTGLESLGKLNEAITQSQGELAAALTR
SVALQNEMKLGTQQAVDLSTLSQSPGVQQVLTEYQKTQSELAVARSLYTGDNPKVVDLVMKEASLKNVLEQRVSQTVGSS
EFLSKQNLQIGELKQALTQDLVKSEVERLALTKQIEELQRVFIVNRRRLDSLPRLEQQQQQLQRQLTVAQITYQEFLKQF
QLVQVLENQNVGNSRIISGALVPERPISPKIPLNLALGGFLGVILGAGTALVLESMNQSLKNIEEANRLLGFPLLGTIPQ
YGEKNPKNRQEGRQELPLLDDPYSPVSTSFEMLQTNLGFTCSDKELRVILVTSATPGEGKSFVAANLALAAAYVGRRVLL
VDADMRLPRQHRVWEIHNLLGLSNILAGQAQLENAVQEVSPLVNMLPAGKIPPNPVALLDSQRMAALVEEASKDYDFVII
DTPPLTAVTDPLIVGKYVDGLLLVVRPGAVEYSAVTAAKSLLEQARVPILGMVVNGIGKESGYGGYYYASGYYGGKEDKK
KSSEANVRSGFFGRV
>gnl|bykdb|A0A0M0SFT2 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Hapalosiphon sp. MRB220] (length=729 residues).
METNNYTQETEIQQYILVLKRRWRLIASIVLAAIGLSGLALFMQKPEYQADGILLFKSDRTSSLTKVGEKIGDLEALMRE
GNPLETQAVIVNSHPMLQEVITALDLKDEQGKLIDPELLKINVKPIVGTDVLKVSYTSNDPELAAAIVNQLMKSYVQNNI
QNNRAQVSAAGEFIKEQLPNSRRELERAAEALRQFKIQNRVIQLAEESTAAIEIISKLDQEMNQIKAALSDVSAQEAQIA
SQLNVSENQAVTVASLSQIPGVQEVLTELQKVQTKLANARAIYTEQHPIITDLKNQQATLNALLQQRTQQYSGIPLVSPS
KLQIGKIRENLVDNYVQLKAERQGLEKKFRTLSNIRANYQQQLAVMPSLEKQQQGLERKLESAKNGYENLVSRLQEIQVA
EKQTIGNARIVQPAQTPKKPVISKTKILLASGSIFAGVLISIAAAFFVDLIDRSLKTIKETETFFGYTLLGLIPKYKPNN
FVNAVQDIEDGVYPQVITTTSPRTLVHEAYQMLQANLKFISHRKVRKIVVTSSVSAEGKSEVSANLAAVIAQSGKRVLLV
DADMRKPTQHHLWSLINSVGLSHLLVGQAVFSEAVHKVTEFLSVLTAGVIPPNPLALIDSESMTSLVDIFAENYDYVIFD
TPPLVGIADAAVLGKMADGILLVTRPGVLDSPSAAAAKSLLERSEANVLGIIANAVNVKQEPGSYFYYSSPRDRKSKSAA
DLERVARMP
>gnl|bykdb|A0A0M0SHU3 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Hapalosiphon sp. MRB220] (length=732 residues).
MKESEFKEVEEIDFQKYLLVLQRRWMTAVGIFGAVVTLALLYAFSLKPTYTAQASLLIKTNRTSSLTGLGEDIGRIESLV
RENSPVDTQAKIVISVPVIQETITSLSLKNDEGEPLTVEELLEDLKVESVKGTDVLEISYTNENPQLAAKVINKVVDTYI
KQNIQANREEATSAGRFILQQLPKTEEAVQKAELALRRFKEKNKVIVLQEEATAAVNTISKLEDEIAEAQAQLVDANARL
EKLQNQARVNSQEAISAVDLSQVAGTQQVLKELQEAQTKLTVARTRYLPGHPTVSNLEEQVSALKNLLQQRVEQVGGSNQ
QMSTASLQMGEVRQKLIEDLANTDKERAGLEKRIAELKQTWSLYKQRANILPQLEQTQRELERKLKAAQTTYETLLTRLQ
EINVAENQNIGNARIISPALVPDEPSGARKALVVLGGGVLGALLGIIAALAADLIDRSIKTVKEAREVFQYTLLGVIPSV
SRTGKSGYSVEGLDRPVPRVIGRDVPHFPVGDAYQMLQANLKFLSDKQLKAITVTSSIPKEGKSEVSANLAVAMAEVERR
VLLVDADMRHPIQHHIWQLSNKRGLSNIIVDQVPIETVLHEVMPNLHVLTSGVMPPNPVALLDSERMASLVANFTKDYDC
VIFDAPPLAGTADAAVLGKLADGVLLVVRPEVVDFASANAAKEFLIQSGQKVLGMVINGVSVKRERDSYFYYAKDSVESS
SVSKSSILVKNR
>gnl|bykdb|A0A0M0SU69 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Hapalosiphon sp. MRB220] (length=714 residues).
MEKGLSSLPFILKRRALPALATFIAVIGGAIIYLQITPRLYETSTRLILDQKRVSVSELGRDLTQLSSATPGGSNPLADQ
AELIKSQRILQKALTKVAAESGFSLPENELTVGQLSQNLKVKIVPATNILEVSYLNKDPTLATRVVNAVSQAMVEDNTQV
IRQEAANVRKFLEKKVPDARKRVEEAEQKENKYRQSSGIVSFDEQTKSLVNSLAIVEEQENTLVAQLQELRSKEASLRQV
TDAKALNQAYAAVRGGQDEELKALRTKLAEIETKLVQARLSLTDSHPTVINMLGQRNGLRALYFQGLARVSPGNTSISSS
SVAGDQISQDLTSQLIVNDVERLAVEKRFRSVQAHRANLQARLAQLPIKQQQLTPLTRKREEAVESLKLLQSKLEEARIA
EAQLVGNIQIIEAAQPPKEPSLPNKKAVLAIATVFGIALATGIVLLLEFMDHTLKDASEAEELLKLPLLGVLPRLPADAI
ALEPSGRFLDHVGLVEPYRTLFKNLEFRSTEPLRSIVVSSTVTGEGKSVVASHLAVISAMLSRRTLLIDADLRRPVLHTL
FNLVPQPGITDVIDSERSLEETVQRTHIANLCVLTCGDLYGRPSHLLESEVMKSLMTEATQRFDCVIIDTSPLSACADAQ
TLGRQSDGILLVTRPDFTIKEVLQRAVSELTHNQIPVMGVVVNGITQQTERYYRYSVNDYRSLLSRGLSEGSSA
>gnl|bykdb|A0A0M1JWX9 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Planktothricoides sp. SR001] (length=785 residues).
MQTAPNSQPSSFDQNGKQPQIVPLSYLAEVPDADEEELDLGQLFAVIRRRAFVILGVAIAVTGAVWVWTDNQTPQYEGKF
QLLVEPVTGEGANSLSSRLGALAGGLGMGIPGSSGSGVDYQSQIALLRSPKLMEPIIQQLKPKYPEVEYKTLVTGEKPPL
IIEQKKEATKIIEVRYQDEDPEKIDFILKKLAENYLRYSFEDRQTNTRKGIQFIEEQLPQLRQRVDTLQGQLQKFRQDYN
LIDPKIQGEQLAGQITKIDDQLLEAQTALIQQQQLYTTLRQQVGLDPDVAIASSVLSEAPSYQSQLSKLRELENQIAKEL
TRFTINSPQIQTMLEQRQQLEGMLSQEAQRALGREIVTVARVPEAQAFQNSVRVGLIQQMVAAASQIEVLKMRNQVLAQA
AGMLSEYREQFPIVIRQYTDLMRELEVASQTLNQLLAQREQLRLEAAQSETPWEIIALPEIPRNEDGELIPFSPNLLRNL
VLGAMLGLMLGFGAALLVEQLDFVFHNPEDLKQATDKPLLGLIPISDRAKQLASSSWIADSNGRERLQDDRDFGFLEAFR
ALNTNIRFLSTDQPIRAIAVASAVAAEGKSTAAVNLAQAAATMGQRVLLVDGDLRRPQVHAKLGILNRQGLSNVLATDLQ
AKDAIQRSPIEENLFILTAGTLPPDPIRLLSSQKMQQLMQQWSREFDLVILDTPPLKNVVDGRVLAGYTDGVVLVVSMRQ
TNRNTILQTLAELKTCGIKVLGTIANGVKPRSVSWYDYSYQYNAQNDAAFLSENTVKQSEKMDNG
>gnl|bykdb|A0A0N7Z489 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Leptolyngbya sp. NIES-2104] (length=739 residues).
MTSMNIETKRYSEDFDLQSYWLVLKRRWLVAAGVFAATVGVAGLATSLQRPNYEANGRALVQSNRTTSLTGVGERVGTLE
ALRREGNPLDTQAAVVTSYPILQRVIDTLQLKNAQGRPLEPDELSRQIKVEPVPTTDILDVKYADDDPEMAANVVNQVLK
AYIDNNLKTNQEEANKAGRFIDNQIPPAEEALNRASEDLKNFRARNGIVDLERESAANINSAAVLQDQLSQARAQLADVG
RQERAVADQLGLELGQAIDLASLSQSAGVQDVLSQLQTVESRLVTESSRFKDTTPQIQTLKQQRDDLNALLQARVSEAVG
SSVQVSPNRLQVGDIKRNLAAALSTLQSQRAGLEGRITTLSGLLINYSSRAARTPALIQQESELERRQEIALTAYQNLNA
RKQEIEVAKNQQVGNARVLQSAMVPTRPAGRMRLILLAAGAMVGLLLGIAAAFLVDTIDKSLKTVKDAEAQYGYTLLGLV
PRFETSDTPTILSPGADDISPRVIAMSTPRSMIHEAYQMLQANLKFMSLDKPVKTIVISSAVPREGKSEVAANLAATMAQ
SGRRVLLVDADMRNPSQHHLWGLVNSVGLSNVVVDQSELRQAVKPITSNLSVLTAGVMPPNPLSILDSEAMTAFLETVSR
DYDYVVFDTPPLAGTADAAVLGKMADGVLIAVRPGVADAGSVAAAKSLLDRSEPNILGLVANGVNVRYEPDSYFYYTSPR
EQVADRPERGERTRSLLTK
>gnl|bykdb|A0A0N7Z5K9 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Leptolyngbya sp. NIES-2104] (length=737 residues).
MAQGNITLFNPSPPAQEPDPGYGQLFGVLMRRKIWFLGAVAGTIALAAAVTAFMPPTYRSTMQMLVESNYRERRAPGDNS
PSFADPNVESDTATQVNLMRSTQLLQRAVDELQPRYSDIDVDRLRNRLNIAQVQELRGSERVNTSIVEMSYIDYDRVKTR
EVLKSLQRVYQDYNLEQQRNRLAKGLSFIDRQIPQVQEKVNKAEADLERFRKSSNLVDPEDQSRALIESLRELQKDQQSN
RGELASAQARFLALQQQLARSPEQATIASRLSQSNQYQALLAEIQKTEVALAQQQTRFTSKTPFVQQLLDQRQRQVALLQ
QEAQRVLGADAGAIAGSDSALFSTGQLGENDLKFASDLTQAQVDFFAARARDQTLAAEAQRLQSQLQRFPTLLAEYNRLL
PTVKLQRDTLDQLEKARQGLGLEIARGGFDWQIVEQAKVGRQVGPNWLRNLLIGGAAGLMLGSVAAFLRESADKSIRTSE
DLTKQASIPLIGMVPELPMSELMPTTNFAFGRSTGDTSMLQVLHWAPFRESLDLIYKNLQLMTDGDPMRSLVVTSALAGE
GKSTVALGLAISAARLHQRVLLIDADLRRPGLHEQLQLPNEHGLSTLLTSDRALTQAAIQPASTYSDLPISVLTAGPTPT
DSVKLLSSKRMRDLMTVFEQHYDLVILDCPPVLGIVDALLAASFCDGTLLVGRMGHVDKNEVSQAVGMLSRLNLVGVVAN
CSESGHSYYYRSATQTA
>gnl|bykdb|A0A0P1C0L3 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Chrysosporum ovalisporum] (length=710 residues).
MQPSIADRGNYPDTPADYREDGLHIDLARYWIEARALRFWIAAIIALALIAGLVVTLLSTPLYRAGARIEISQISANVTS
LDPLENESRVSELQYLNTQYELLESRFMATRVADAASLETDPAFIEAFDLDEETPVTRRDVEQVLLDNIKVTPISQSSLV
DIEFSSPSPEISSKISNLWADEFIRANYEKRFGANIDAREFLNKQIEELRERLSISERDLVEYANENEILVLETGNREEG
SGTASQTLIATDLAALNEALAQAVTDRISAEASVLSGEFPAADARNSLRADLAKAEAQLATLNANYGPMYPPLVEKAAEV
ASLRASLGGEARAALKAASTREREIRKKLEEAKNKFLGQQTLTIQYGILKREVETNRQIYDALLQRYKELGAAGAGQNNI
KLIDKADAPLFPYAPSLLQNLLVALITGLIGAGALIYGRVVLSQTIKDPQDVTRELGLSLLGTIPKSDAADVLKDLINSA
SDLSEAYQATRANLAFLTSDGAPKLLMLTSSVLAEGKSVSSLALAASFARLGKRTLLIDGDLRNSRLMALLGGEGADTAG
LAALLTTNDASLESQVFSSDLFAIDVLPAGRTPPNPVELLASPRIGHILTQARDQYDQVVIDSAPMLSLADAVELSRFVD
GVLYVVESNRMKVRALDNALRRLRKSGAQIYGAIVTKLDANSAGYGYGYGYGYGYGYGYGGAAKPDEQDS
>gnl|bykdb|A0A0R0M9H9 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cylindrospermopsis sp. CR12] (length=729 residues).
MAINQEETDVIDLQVYWLILKRRWLVILLVMASVLGAAISYTYSQKPVYQAKGKLLFEKKDGVSSLTSLATSVGELGGIG
NNSNPIDTEAEVIRSHPLITKTINQLGIKNTKGEPIEIDRFLKQLKLQTIRGTDVMELSYNSTNPQEAADTVNTLMKYYL
DNNILINRSEATAARKFLSQELPRIEKQVIKAELELRRFKEINRVVALDAEAKVGIETLGKIDEVITQAQGQLAAASTRS
LALQNELQLSTQQAVALSNISQIPGVQQVLTEYQKTQQELAIAETTYTSDNPKVVNLQLKEQALKKQLQERVSQTLGNAE
VLQQSNLQIGELKQGLTQDLVRSEVERLALANQVKALQSVFIINRRRLDSLPRLEQQQLQLQRQLQVAQGTYQQLLKQLQ
EVQVLENQNVGNARVISSALVPEIPISPRTALNIGIGALVGLVLGVGTALLLETLDKSVKNIEELNRILDLPMLGTIPQY
ENTKRRKNQEQEENQRELPVLDNPYSPVSTSIEMLQTNLGFATDKELRVILLTSSSPSEGKSFVSANLALAASHLGKRVL
IVDADLRRPRQHKVWGLPNFVGLSNVLVAQTQLENCLQDVSSVNVLTAGKVPPNPVKLLDSQSMASLIAAARQDYDFVII
DTPPLTAVADALIVGKLVDGVLLVVRPGQVESSAVKASNSLLIQSKVPVLGMVVNGVSEDSGYGGYYYYRGYYGDLKDKR
EGDSLAIKR
>gnl|bykdb|A0A0S3TIS7 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Fischerella sp. NIES-3754] (length=732 residues).
MKESEFHVEEIDFQKYLLVLQRRWMTAVGVFGVVFTLALLYALSTKPTYTAQASLLIKTSRTSSLTGLGEDLGRLESLVQ
DNSPVDTQAKIVTSVPVLQATITSLSLKNDEGEPLKVEDLQKKLKVEGVKGTDVLEVSYTHQDPQLAAKVINKIVEEYTK
QNIQANREEAISAGKFMLQQLPKTEEAVQKAELALRRFKERNKIIVLQEEATAAVNTISRLEDEIAQAQAQLVDVNARLE
KLQTQARVNSQEAVSAVDLSQVPGTQKVLTELQEAQSELTVARTRYQPGHPTVANLEEKVSALRSLLQQRVEQVGGNNQQ
ISTANLQMGEVRQKLIEDLANTDKERVGLERRIAELTNTWSVYKQRANILPKLEQTQRELERKLKAAQTTYETLLTRIQE
INVAENQNVSNARIISPALVPDEPSGTRKALIAAGGGVLGIMLGIIAALAVDLIDRSIKTVKEARELFQYTLLGVIPNVS
RNTKNSYSVQGLDRPIPRVVGRDIPHFPVGDAYQMLQANLKFLSYKQLKAITVTSSIPKEGKSEVSANLAVAMAQVERRV
LLVDADMRHPIQHHIWQLSNNQGLSNIIVDQVPLETIVHEVMPNLHVLTSGVMPPNPVALLDSDRMATLVASFNQKYDCV
IFDAPPLAGTADAAVLGKLADGILLVVRPEVVDYASANAAKEFLTQSDQTVLGMVINGVSVKREPDSYFYYAKDSVESTG
VSRKSILVRNHR
>gnl|bykdb|A0A0S3TL97 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Fischerella sp. NIES-3754] (length=714 residues).
MEKGLSSLPSILKRRALPALVTFAAVIGGAIAYLQITPHQYQTSTRLMLDQKRVSVSELGRDLTQLNSGTPGGSNPLADQ
AELIKSQRVLQRALTEVTAESGFRSPENELTVDQLSQGLKIKIVPATNILEVSYLNEDPILATKVVNAVSRAMVEDNTQV
IRQEAANVRKFLEKKVPEARKQLQEAEQKENRYRQSSGIVSFDEQTKSLVESLATLEQQENTLSAQLQELRSKEASLQQV
TDAKALNQAYAAVRGGQDEELKALRNKLAEIETQLVQARLSLTDNHPTVINLLGQRNGLRALYQQGLARVSPRNQSISSG
SVAGDQISQDLTSQLIINDVERLAQENKLKVVQTNRANLQTRLAQLPIQQQQLTPLTRQREESAESLKLLQSKLEEARIA
EAQLVGNIQIIEAAQPPTKPSLPNKRTVLAIAIVFGTALATGIVLLLELMDHTLKDASEAEELLKLPLLGVLPRLPGHAI
ALEPSAQFLDHVGLVEPYRTLFKNLEFRSSEPLRSIVVSSTITGEGKSVVASHLAAISAMLSRRTLLIDADLRRPILHTL
FNLAPRPGITDVIDSERSLEETVQRTNIPNLSVLTCGELHGRPSHLLESEAMKSLLIEAVRQYEFVVLDTPPLSACADAH
TLGRQSDAILLVTRPGFTIKEVLQRAVSELTHNQIPVMGVVVNGITDQTERYYRYPVNSYSSLSSRRLSKGSSA
>gnl|bykdb|A0A0S3TP66 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Fischerella sp. NIES-3754] (length=728 residues).
METNSYTQATEIQQYLLILKRRWRLITAIILASIGLSGSALFMQKPEYQADGILLFKSDRTSSLTKVGEKIGDLEALMRE
GNPLETQAVIVNSHPMLQEVITALQLKDDQGKLIDPELLKVNVKPIVGTDVLRVSYASNDRELAAAVVNQLMKSYVENNI
QTNRAQVSAAGEFIKEQLPASRQELERAAEALRQFKIQNKVIQLAEESTAAIDIISKLDQEINQVKAALADVSAQEQQIA
SQLNVSENQAVTVTSLSQIPGVQEVLTELQKVQTKLANARAIYTEVHPTITDLKNQQATLNSLLQQRTQEYSGIPIVSPG
KLQIGKIREELTDKYVEFKAERQGLEKKIRTLSNIRANYQQQLAMMPSLEKKQQALERRLEAAKTGYENLVTRLQEIQVA
EKQTIGNARIVQPAQIPKKPVISKTKILLAGGSIFAGVLLSIAAAFFVDLIDRSLKTVKETETFFGYTLLGLIPKYKLNN
SVSGVQEIEAGVYPQVITTTSPRTVVHEAYQMLQANLKFISHRKVRKIVVTSSVTAEGKSEVSANLAAVIAQSGKRVLLV
DADMRKPTQHHLWGLINSVGLSHLLVGQGVFSQAVQKVTECMAVLTAGVIPPNPLALIDSEGMTSLVDIFAENYDYVIFD
TPPLAGIADAAVLGKMADGILLVTRPGVLDAPSAAAAKSLLERSEANVLGIVANAVNAKQEPSSYFYYSNLRDRNSTADL
ERVPQQLK
>gnl|bykdb|A0A0S3TXC5 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Leptolyngbya sp. NIES-3755] (length=741 residues).
MIVAQGNITLFNPSSPMQEPDPGYGQLFGVLMRRKIWFLGALAGTIALAAGVTAFMPPTYRSTMQMLIESNYRERRTPGD
NSVSFADPNVETDTATQVNLMRSTPLLQRAVDELKPRYSDIDVDRLTRRLNIVQVQELRGNERVNTNIVEMSYIDHDRVK
TREVLKALQRVYQDYNLEQQRNRLAKGLSFIDRQIPQVQAKVDKAEADLEQFRKSSNLVDPEDQSRALVESLRELQKDQQ
SNRGELASAQARFSALQQQLARSPEQATIASRLSQSRQYQALLAEIQKTEVALAQQQTRFTAKTPFVQQLLDQRERQVAL
LQQEAQRVLGSEASSIAGSDAGLFSTGQLGENDLKFASDLTQAQVDFFAARARDQSLVAEAQRLQAQLQRFPTLLAEYNR
LLPTVKLQRDTLDQLEKARQELGLEIARGGFDWQVVEQSKVGRQVGPNWMRNLMVGAAGGLLLGCVAAFLRESADKSIRT
SEDLTKQASIPLIGMVPELPLSELMPTTNFAFGRSTNAGDTSMLQVLHWAPFRESLDLIYKNLQLMTDGSPMRSLVVTSA
LAGEGKSTVALGLAISAARLHQRVLLIDADLRRPGLHHQLQLPNDHGLSTLLTSDRALTQSAIQPASTYSDLPISVLTAG
PTPTDSVKLLSSKRMRDLMTVFEQHYDLVILDAPPVLGIVDALLAASFCDGALLVGRMGHVDRNQVSQAVGMLSRLNLVG
VVANCSESGHSYYYRSAPTPA
>gnl|bykdb|A0A0S3TXS2 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Leptolyngbya sp. NIES-3755] (length=738 residues).
MTSMNIETKRYSEDFDLQSYWLVLKRRWLVAAGVFAATVGLAGLATSLQRPNYEATGRVLVQSNRTTSLTGVGERVGTLE
ALRREGNPLDTQAAVVTSYPILQRVIDTLQLKNSQGRPMEPEELSRQVKVEAVPTTDILELKYADDDPEMAANVINQIVK
AYIDSNLKTNQEEANKAGRFIDSQIPPAEEALNKASEDLRNFRAQNGIVDLERESAANINSAAVLQDQLSQARAQLADVG
RQERAVADQLGLELGQAIDLASLSQSAGVQDVLAQLQSVESRLVTEQARFKDTTPQIQTLKQQRDDLNALLQTRVSDAVG
ANVSVAPGALQVGDIKRNLAAALSTLQSQRIGLEGRISTLAGLLANYRSRAAQTPALIQQEGELQRRQEIALTAYQNLNA
RKQEIEVAKNQQVGNARVLQSAMVPTRPAGRMRLILLAAGAMVGLLLGIAAAFLVDSIDKSLKTVKDAEAQYGYTLLGLV
PRFETSDTPTILSPGADDISPRVIAMTSPRSMIHEAYQMLQANLKFMSLDKKVKTIVISSAVPREGKSEVAANLAATMAQ
SGRKVLLVDADMRNPSQHHLWGLVNSVGLSNVVVDQSELRQAVKPITSNLSVLTAGVMPPNPLSILDSEAMTVFLETVSK
DYDYIVFDTPPLAGTADAAVLGKMADGVLIAVRPGVADAASVAAAKSLLARSEPNILGLVANGVNVRYEPDSYFYYTNRE
QVSDRGERGERTRSLLTK
>gnl|bykdb|A0A0S3TYD7 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Leptolyngbya sp. NIES-3755] (length=761 residues).
MKQPQNPSQTPASDAIELDLRKTFMMLTRYWLPATLAFSLVTVPAAVFLMTRKSSYQATGAVLVKKQASTTSVLGLQVDV
GEIESLDKSGPLTTQAELIKSLPIVQRTIEDLNLQDDDNAPLKVEDFLKRLKVTPVNRSDILRVEYRSNDPMEAAEVVNH
LMQLYVQDNLTANRAEAKSAREFIQSQLPEVERNVRQVEGEIRAFKENNQIVALDQEQRNSVEITSDFNKRIEDTRAKLV
GAIQKVNALKNQVGTSNEIGVAQVALSQSTGVQETLKRSQELQNQLAVTLGRYRAGHPKVTELQRQVSELQELLQQRVAT
VVGQTTAPRATEDDLQMGQFRQQLVTELVMAEIEQMSLEGQVESLSGALSAQQQRASTLPRLSTRQAELERRLRASQSTY
ESLLSKLQEIQVAEQQQLGNARITSKALIPEKPTLLTSALGRSLLLAGSGGAGLLLAFAATVLAYLLDRRIRTVQDLKDV
FDYPVLGMIPSFTDSGLSQVMESLTKNLQKLGNLNVVDTELVVRDAPRSAPAAAYQMLQSNLKYVSSDREARAIVVSSCI
PSEGKSTVSANLASAFAQIGKRVLLIDADLRRPRQHHVWSLGTNDVGFSDVLVGVSTLEDALCPVMENLWLLPAGKIPPN
PIALLDSERMSFLMQVFLERYDYVIFDTPPLSGIADATILGKRADGLVLVSRLGVINFDTAKNAKEYIRQAEQKVLGIVV
NDVNPKDEPDSYFYGSYYYYGSENSGAIQNGRTPVGSNRQR
>gnl|bykdb|A0A0T7BPJ4 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Calothrix sp. 336/3] (length=717 residues).
MAKGISSLVAVLKRRGLPAAAAFVAVMGAAGAYLLLSPKLYEASARMMLDDKRVSVSDLGRDLTQVTSTTPGGPSPLADQ
AELVKSEKVLEKAIAATYPPGVKDSITPEKLRKKLKVKIVPATNILEFKYEARDAQLAAKLLNVIAQTMVEENTRTISSQ
ATKVREFLEKKEVPAAQRNLTVAEANENRQKQASGIVSFDEQSKSVVTSLASLEDQERTALAQLQELRSRAASLEKITKT
TSLDKAYSAVRTGQDEEVKKLRSKLTELEQQVIQAKLKFTEEHPTVTKLVQERDAVKAMYEQEVARVSPDGQSQTTNFAS
DDLTKDLTAQLITNQTESLAVQKKLRVIQAERANLQARLGKLPLQQQSVAALTRKREEAAESLKTLQRKLEEARIAEAQK
VSNLSIIEFAKPGTSPSSPKIPVVLVVATVFGTVLATGIILLLEAMDNTLRSGWEAQDLLKLQLLGVLPRLPGSTLKLQS
ADTFLDDIGSVEPYRMLLKNIEFRNLEDLNSIVISSTISGEGKSVVASHLGAVSAMLSRKTLIIDADLRRPEQHRIFHLE
HKPGVADVIAGNLSLMEAVQPSGTENLSVLTCGEMHNRPSQLLESPEMKALIAEATAKFDLVIIDTPPLCACADASTLSR
YSDGMVVVTRPGFTLKEILQKAVVDLTHNGVKVLGIVVNGMTSDTDLYYRYPVTGYQPKLTPTNKSFTALSGGKNSK
>gnl|bykdb|A0A0T7BPZ0 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Calothrix sp. 336/3] (length=740 residues).
MSNPEHIEEIDLTKYWLILQRRWLPTLGIVGIALTMAFGYVLSIKPTYKAQGSILIRTNRTSSLTGLGGDIGRLESLTQT
NNPVETQAKIVASVPVIQKTIRSLDLKDNQGKPLTIEDLTKNIKVEVVKGSEVMQISFTHENAQLAANVVNQVMDNYITE
NIRANRAEAESARKFIISQLPISESSVRAAESAFRQFQERNKIIILQEQESNAVKMISSLEDEIAQAEIKLTEVNAQLDK
LRSQAKIDTWQAVTLTELSKEPRTQQMLTQLREAETKLAVEQNRYLPGHPTLVNLQEQIASLKKLLQQRIKQVAGESTKL
SIQNLQIGDVRYELIADIVKTERERVVLERKLAKQKSTWAKYRERANALPKLAQTQRELERRLKASQTTYETLLTRLQEI
HVAENQNMGNARIISTALVPDKPGNSRKLLILGGAGFFGLLVGIIAALALDLLDQSVKNVKQAKEIFGYTLLGVIPQMNR
SSKSSSGTTEIDRQIPRVIGRDVPSFPMDEVYQMLQANLKFLSDRRIKAIAVTSSIPKEGKSEVSANLAVAMAQVGRKVL
LIDADMRHPIQHHIWGITNAKGLSNIIVDQVPFNTLMREVMPNLFVITSGVLPPNPVALLDSQGMESLVINFAQEFDCII
FDTPPLVGIADAAVLGKLADGILLVVRPEVLDLGSAQASKEFLQQSHQRVLGMVLNGVNVKHEPDSYFYYSKEPIPSGLV
RNYSTQEVNLNAKNNQTLEK
>gnl|bykdb|A0A0T7BUI3 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Calothrix sp. 336/3] (length=731 residues).
MEKQKALEELDIQQYFLVLQRRWKILLALIITSVGFSGFAILRQKPQYQATGMLLFKSDRISSLTKAGEKIGDLESLIRE
NNPLNTQAVIVNSQPVIKEVIKTLNLKDNQGKFRNPETLLIKVEPIVGTDVLKVSHASDNPKLAAKIVNQVMATYAENNV
ESNRTQVTAAGEFIKKQLPSSRKELESAAEALRQFKNKNKIVQLEQESSSAITSMAKLDEEINQATANLAETLAQESQVG
NQIKTVKNQAIEITSLNQIPGVQEVLSELQKTQSRLALERVKYTNNHPNVVYLENQEKTLKSLLNRRTQEITGNQLEVSL
SNLQVGKIREDLANQYVQLKTKRQGLQKKIAALQGVQQIYQKRLNAIPNLEKKQSDLERKLSVAKLNHENLNARLQEIQV
AEKQTIGNAKIIQPAQIPETPMLSKKSLMLALGSLFAGSLLGIAGAFFVDLIDRSLKTVKEAENFFGWTLLGLIPRFEAN
HKSVAANITDDGISERVIVNSSPRTIIHEAYQMLQANLNFISHKKVRAIAITSCVPGEGKSEVSANLAAILAQAGRRVLL
IDADMRKPSQHHLWGLINSVGLSNVIVGQNDFPQAVQRITSNLFVLTAGVQPPNPLGLIDSEGMTELIRNFAQDYDYILF
DTPPLAGTADAAVLGKILDGVLLVTRPGVVDSVSATAAKSLLERSGANILGMIANGVNLKQEPDSYFYYSKPRWGQSTSE
TDTKDEQWIYK
>gnl|bykdb|A0A0V7ZFJ4 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Mastigocoleus testarum BC008] (length=734 residues).
MTHNSFDFNQEDDDFIDLQQYWLTLKRRWLPALIVSSSVFGMAAFNTLKQEPIYSAEGKLRFNSDRVSALTALNSQMGEV
AAITGKGNPLATEAQIIRSRPIIQKTISKLNLRDSKGKLLKPSVLISKLRVNAVGDTDILNLSYESNDPQKAAAIVNSLM
KDYQENNISTNTAEARSAREFLNKQLPEVEQRLIRAEAELREFKEKNGIVALEQEAQTGVEALKDLSEEIVKAQAYLGEV
TTRSEGLQKQLQLETQEAVAISTLNQSPIVQEALTQYQKVQDELAVAQTQFTSEHPMVISLLGKEQALRNQLGKRVGQLI
DNGNSISERNLQIGEIKQNLTAELVKSEVERLAAANRVGILRKNFITQQGRLRSLPKLEQTQRQLQRKLEVAQLTYTELL
KKLQEVQVVENRSVGNATIISEALVPEHPISPNITRNLLLGGIGGILLGVGTALLLERTDKSLKTVDKIKQLLDYPLLGT
IPKTPKTTKGSTDNQEIELPVLDNPYSSVTSAFEILQTNLAFTVSDKTLKVIVVSSSNPNEGKSFVSANLAVTLSQLGRK
VLLVDADMRRPRQHRIWRRPNLIGLSNVLVGQSKLQDTLQKALPALDVLLVGKIPPNPLKLLESQRMSSLIEEAKGKYDF
VILDTPPLTAVADGLMLSKLADGILLVVRPEAVDSDTVKVVRNRLKQSGQQVLGMVVNGVTPKNGSAYYYYNKGYYGEPS
KSKEKVEVFQVSKH
>gnl|bykdb|A0A0V7ZNJ9 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Mastigocoleus testarum BC008] (length=724 residues).
MTSSPQVEREDTDYIDLEQYWLILKRRWVPASVVAGSVVGLAALVTFMQKPIYEAKAELLFNKQSNVSSLTGLSGAVGEL
SGITNLSNPLETEAKVIRSNPIIQKTIDKFNLRDDDNEPISIEDFLKQLKVKSAKGTDVLEISYKGTDPQQAAAIVNSLM
QDYIDNNIRVNTAEARAAREFLNNQLPEVESRVVKAEAELRKFKEENKVVALKEEAQFGVEGLKDSLQELNQAEAKLAAA
NERSQALQRELDIEKQKAVELSELSQSPAVQQALQEYQKVQDRLAVARTRLTNQHPTVIDLSNKERALRNQLEKRVGQVV
NNNSNDSSITEDNLQVGEIKQTLTSELLKSEVERLAVAKQVGVLRKAFALQQARLTVLPKLEQQQRQVERKLQIAQLTYQ
NLLKKLQEVQVIENQNIGNARIISEALVPDKKISPRIALNLLLGGFLGILLGAGTALILETMDKSLKTVDQAKRLLNYPV
LGTIPQFEGKGFDGNPELPTLNNPYSVESSAFEMLQTNLSFTSSDKTLKVLMVTSSVPGEGKSLVSANLAVTISQFGQRV
LLIDGDMRRPRQHKLWKIHSFSGLSNLLVGKAELQNSIQKPLATLDLLPAGKIPPNPGALVDSQSMVSLLEEAKKEYDFI
IIDTPPLTAAADSLIFSKLVDGTLLVVRPGIATSDAVSAAKNQLEQSGQRVLGMALNGINRDSQYGGYYGQSYYGNNIKE
KVSV
>gnl|bykdb|A0A139WSU3 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Scytonema hofmannii PCC 7110] (length=676 residues).
MNKLVTISTKHWKSLIAFNVLVVLATAVAVSNAKPVWIAKTQLILPKTTSNLDANLGTLGSLRNGDSAFSSEVNPLNVQA
SILTSDTLLEKVLASDPERGKFNSISRYRQLFKVTPQEQSTIMLLTVSGSSPKLANQRAIAITEAYQNRLNELRQANSRT
RQKFSQIELEQAKLKLAQAQSKLTIFKQSSGLINNEDQAKGIVDSISTLTTVRAQVLATAEASENRAKALSIRLSLTPNE
AIRSLGLGENKEYQFVRQQLSEVEASLRQKQAIFTDVHPEVKTLLAQRESLQRKIQEHIRQTSAGTKVDTTVATDSQGRA
ALIQQQVLAESEATAQRRQAQQLNNQITQLQTTLKSFPVNQARLVELQRQVDVTEGVYKGLIAQIQQSNIDAFDAYPNIQ
VLDAPQVDPKPVSPKFLLMAVNALLASIIGSIALVLFLESRNPLLNLKDLQGQKFAIVQSIPRIKHSDPKIEMTSVSEVE
FQRLASAISLQPLNNRRLLVTSATQGEGKTTVAIGLAYGLVDLGFRVLLVDGDFRSAELSRSLGYAEDSTIEQLQRSIQP
NLDLLPTLPKRGKIVETIKRGRFEQALTACEARGNYDYVIVDSAPVSLTSETALMATLISNVLFVVRPDSSYKNSVNESF
AQLSQHNVEILGLVVNAVESKKKPYSYHSDSSLVNT
>gnl|bykdb|A0A139X3R8 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Scytonema hofmannii PCC 7110] (length=708 residues).
MEKSVSSVLSVLKRRSLPAVAAFVAAIGGAIAYLAVTPSQYEASARLMLDNKQTSISELGRDLSQVSSNTPGGPSPLADQ
AELAKSQRVLNRALQIFQSSHKTNTQVKTPDLSKGLGVKIVPATNILQLSYQSKDPILAAQLLNAVSRAMEEESANTIRQ
EAANVRKFLATEVPKARQNLEDAELKENKYRQSSGIISFTKQSESLVDSLATLENQERTLSAQLQELRSQDASLRQITNS
TAVKSAYASVRGGQDEQLKELRTKLTEFETKLAESRAKYTENHPDVQSLLYQRNSVRNLYIQGLNRISSENQPVSPNNVA
ADQVSQNFSAQLIANDIERTAVENKLKSVQAQRANLQTRFEQLPFKQQQLTPLTRQREEAAETLKLLQSKYEEARIAEAQ
QVGNIRIIEEALPPTVATSPRRSSVLVLATALGTLLATSIVLLLEMMDNTLHDASEAEDLLKLSLLGVLPRLPSKTLVLE
PSHRFLDNVSLVEPYRMLFKTLEFRSDQMRLIVVSSSIAGEGKSIVASHLAAVAAMLSWRTLVIDADLRRPEQHTLFNLS
GKPGVTDVLEGDISLADAVQSTDIENLDVLTCGELHGRPSQLLESVAMKSLVAEAAENYDLVIIDTPPLSACADAATLAK
QSDGVMLVTRPGFTLKEILSRSVSELTRNRIPILGVVVNGITSQTEKYYQYSVNGYQPRKQLASSRSK
>gnl|bykdb|A0A140K2P2 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Stanieria sp. NIES-3757] (length=743 residues).
MTNNYPANNSNNYNYPSETLSASREAIDVNISQYLIKLRRRWKLALAVFLLTAGITTALSLLLQKTYQAQGKLLFKQNST
ASLTGVGKNVGELKPLLVNQSPLSTQIEVITSDPVLQQTIDQLKLVDDQGKPIKPKDFEKKLSIELVGGSDVIEITYAHP
NPKVAADVVNTLMNTYINEQIRTNQSEPASAREFINKQLPQIESQVSQAESELRNFKESNQVVNLTKEAESTVMQMAEMN
SEISKVAAQLQGTMAQSEALQSQLNLNLNQAIAANQLGASPVVDGLLKEMATVESELAKEKQRFLDNHPSIQSLEEKKAS
LNKELKDLISQNVGQGVEISEGLFNNDGLKENQLEKFITLEIDKINQQRQLSSLYQTQESYLERAQKLPSLEQKEKDLIR
KVKAAQNTYETLLTSLQEVQLAENQQNGNAQIIELAKLPEKGSSGRMAFMLVGILLGLLLSNLSVLLVEMQDRSLKTVAE
IKNKFGYKVLGLVPKHAAEENQGIIVQKQPDSFASEVYRMIQANLKFMSLENSTQVILVTSSVPEEGKSTVSANLAAAIA
QLGKRVLLIDGDLRKPSQHRLWNLENFVGLRDVIVAQKPLSLAVSKPLEKLDLLTAGELQSNPLALLDSEAMSELITQSR
KKYDLILIDAPPLPVTADVLTLSKLVDGIVFISRPGVVEHESAELAQEALANSKKTVLGMVINGINSKEFDRYSYYAKYA
KGYFPSQSKQGNEVNGNHSQARV
>gnl|bykdb|A0A140K3H3 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Stanieria sp. NIES-3757] (length=798 residues).
MNNQLVNPNSLYLPTPETESAFSLTELKQTLSRQWKPALLVASTVCAGIFLSTVLQNPKYQSQTLILLENQKTQQSASVS
PEQQSLATGYYNLKDLSTEVLVLRSYPLIAKAVKQVQQKYGDLTVTDVMENLSITQAAVNEMPTDVLVVSYTDTNPERAK
AVLDALGSTYVEYSLNRQRSQAGNAINFIDEQLPKAQAELNEVAKAIRNFRQTYNIVDPDEYALRVIQFRDGLEQQEKQA
EIALARTQRQYQEINRQLRDLGQNPETIVAYTLLSQDQVYQSLASQLKELETQYALGSVNFYDSYHVMEDIKLKQAELRT
LMQERSQQILGDAVSQVNLEAIIVSQGSTSQVMGINGADTQAQALNPGQPVDSQGASTQVSGTISTIQSLASMRSQVETE
QAALQSQIAGIQQAKTKVEKTFKQIPQLQQYYAEVKRQFDIKSKAVDYLMQRRQELYIEQAQENAPWQILEAPPLPSIPI
SPNLERGILLALVAGSLMGVATAFLLQKLDQRVKQVEEVKQMVRLPLLGTIPKVEKPLIQVNGETNTKAHYYNYSSFTEG
LRTLAMNLRYTLTEKGKINSLALTSATSAEGKTTVTYNLGIVLAELGLNVLIIDADMRKPKIHKLAKLPNDEGLSEAITT
ERPWTDFVQIGVVENLHLITSGSTSPNPIALLNSDKMKQLLQQWQEAYDYVLVDTPPIGVVADAKSLANQVDSVLFVVGI
EKATRRAINNSLEILRNSQCNIAGFTANLVDREFDYYSYSYYDSYYNQSTNGNGNGNGNGHHSEGRMQQLLQQFRRRE
>gnl|bykdb|A0A140KB14 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Stanieria sp. NIES-3757] (length=745 residues).
MSNFTGMSNGQTPENLSLNNSYTASRESIDVNLYNYLQKLSRRWKPALAVFLLTVGSMAALSTLLKKSYQAEGKLLFKQN
NTASLTKVGQGVGELKPLLNDQSPLKTEIERMKAEPILVQTIEKLKLKDEEGKALKPEVLNNKLKIEIIGGTDVISVRYQ
DQDPYTAADVINTLMKLYLDEQVKSTQAETANADSFISNQLPQIEQKLSKAESDLRRFKEANRVVNLAKEKETLVLELGN
LNQQIANVAAQYQGTQAQTATLNQQLGLNLNQALAANQLGGTPVVESIFKDLADVETELAQQRQRFRDNHPMIQSLLEKK
QDLNQKLQGLITETVGSNTKISEGLLRSDGNKENQLEKYISLEIDRISQQRQLASLYQSQQAYLQRARQLPQIEQQQQDL
VRQVEAAEKVYQNLLDSQQELQLLQNQKSGNAQIIELAQLPEEGSSGRLALMVLGVILGLLLSNLSVLLLEMQDRSLKTM
SEIKQRFPYKVLGLIPQYSDDEPNGIVVQREPDSFNSELYRMIQANLKILNQDNPPQVILITSSVPGEGKSTVAANLAAA
IAQLGRRVLLIDGDLRRATQHHLWSMSNHLGFKDVLTHKTSLQEVVARPLDRLDLLTVGVVPPNPLALLDSKAMNELIVQ
AKQDYDFVLIDAPPLPITADVLTLSKLVDGLLFVSRPGVVEQESAAFAQEILATVNKRVLGMVINGVKPSEFERYSYHAK
YAKGYFSKKKLTSNKERTETEVAAV
>gnl|bykdb|A0A140KBA0 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Stanieria sp. NIES-3757] (length=739 residues).
MESNLYIDEYLDFKKYWLVLKRRIVPASITCLGVMTLSLVTALSLEQVYQAEGQVMIKTNKSAKLTGLENDIGKIEVLTN
ESDPLTTEVEVVSSRPIIDRVIKELDLRNKQDELYRYKDLINKLEIKPVTGGNVIKISYEDSDAERAALVVNKIIELYQE
KDTENNRSEAIAARQFISEELPEVEAKVAQAEADLRNFKNENQIANLSEETTTLIETSKLVDTQIDQVAAELGDVNARYT
SLSSQLGMNVSEAAAISSLNQSVAVQKALTQLQNVKVELASKRNLFGENAPQIISLKEQEAELTALLEQQIRQTLGSQSA
SSVAQLNILGLGRLKQEQISEFASLGLKKTGLEQKLANLKQTKTDYQQRLSVLPNLEKRQKELERKTKAAQATYQTLLGK
LQETQVAEKQNIGTVRVLANAIPPDEPTGPSKKLIVAAGGLLGGLLGIAVAFLLDLKDNSLKNSQEIEEIFGYPLQGVIP
DLAKEGSPNLLVGDVVDTLPQLPAGQNDSSHHRHALLPIREAYQILQANLKLLSLSQARKVIAVTSCVPQEGKSHVSANL
AIAQNQVGKRILLIDADMRRPSQHKIWSIPNYLGLSNVLKGEAEWQEAIKTIKPGLDILTAGDLPDNPVPLIDSERMKYL
IETAALTYDHVIFDTPPITGMADTRILGRMVDGLLMVVRPGVANYGSVSVAKKLIETTGQPIIGVVANGVNLRNEAYGYD
YYYYPNYEYDDSYSLNQGK
>gnl|bykdb|A0A166IWU6 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nodularia spumigena CENA596] (length=730 residues).
MPSYQEDQDEIDLRQYWLAVKRRWLLIVIIIGSVFGITSFVTFNQKQIYEAEGKLIFDKQNSVSSLTGVSEGVGELSGLT
SSSNPLETQAEIIRSHPLIQKTIVDLQLKDQEGEPLRIDNFLGSLKVNAVRGTDVLQLSYRSVDPELAKAIVNKLMNVYI
DDNVMTNRSQATAAREFLNKQLPLVEKQVAESELALRQFKEKYEVVLLEEEAKQGVERLYQISNQLTLLRARLIDASSRS
DALQNQLALNTQKATALSTLSQSRAVQQVLSEYQKVQDQLAVERSRLTDEHPVVVNLLNKEQALKEQLEGRITQTLGSSQ
PIPEQDLQIGELKQALTANLVQVEVERLGLENQVGVLTNAFKQDRARLRILPKLQQQELQLQRQLQVARITYEQMLRRLQ
EVQVAENQNVGNARIVSQALLPEKSVSPRINLNLALGGFLGILLAVGSALFLDALDKSVQTAAEAEQLLDYPLLGKIPKM
IRDDNTSELPLLNNPYSSVNTAFEMLQINLGFTISDKELKVIVVSSCLPGEGKSFVAANLAVATAQMGRRVLLIDADMRR
PRQQELWQVRNLMGLSNILAGQTDLTQISQEALVNLDLLTAGTIPPNPAALLDSQRMHELVQQASQDYDCVIIDTPPLTF
IADASIIGKMADGILLVARPGILNSDAIRTTKALLENSRLSVLGMVLNAVSSDSGYYYNNYNYYHYKNGAEKKHTVESQF
KEIAGKWLKK
>gnl|bykdb|A0A168TT23 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Leptolyngbya valderiana BDU 20041] (length=790 residues).
MSNYGIHDGRHLKPIEDQNTALAQYDPYQSKANEDDDAIDLLEIWRTILKRKWVVVSILAVFIATAALSSWLTIPVYRAT
AVVQINHETANILRIEDFEAAPRSWQGVEQFYQTQYEILRGRQLAENVVEKLEVWDHPELSGEISQRNLYRELRALPGRL
VQLIRSDPPSAQPAAVQSPEAARAAAIRSAGGRLRARISVSPRENSRLVYVSVNSFDPAFAAQLANAVVEEYVRSTMQRR
YDAGQEAREFLEGQLADMRIALERADQNLIDFAQANGVADLEERVDMSQSSVRTLNDRLSAARGDLVQLRAFSQLIDQGR
GDSIRPVVNDGQIAELRSRKAELETEISGLLQRFMEDYPVIVELRSQINEIDTQIRERADTIIGNVLAEYSNLEAEVAAL
EDEIAANEERILALNQQGVQYNILRREFETNRELYDGMLQRLKEIGVAAGAQENNIAVIDSALRPGYPVLPDISRNLSIA
LLLGLVVGVGLALLLEFLDSTVHRTEDVEKLVGRPVLGLIPIVKLSEQRKKSGTTTRAEDRAVSHYSELHPKSAVSEAFR
SLRTSLMFSTPQGMPKTILMTSPGPGDGKTTNAINLATVLAQNGARVLLIDADLRKPRLHRDFSIQQAPGVTNRIADVGS
QEVATSSIIPTTTEGLFVMPSGNQAPNPAELLSSDRMRKIINMSARAFDHVIIDSAPILGLADALVLSRCVDGVILVTSA
GKTSKESIRTSTRRLVQVQAPLLGVVMNRIDMESPDYAYYSSYYYNYSHDEDEKAEGGNKKAGKNLEATA
>gnl|bykdb|A0A1B7UTR1 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Anabaena sp. AL09] (length=729 residues).
MSINQEDQDSSLDIQQYWLTFKRHWLVTSIVFASVLGVTALLTYSAKPVYESEGKLVFTKRSGASSLADISQSMGELGGL
TNLSNPVDTESEIIRSYPIVIKTITTLNLTNDQGKQISLENFLTKLKLKTIRGTDVIQLSYRSTNPQEAADVVNSLMKYY
LESNIRTNRTEARSAREFLDKQLPEVEKRVTKAEMTLRRFKENNRVVALDVEARTGLESLGKLDEAITRSQGELAAAYTR
SVALQDKMKATTQEAVDLSALSQSPGVQQVLTEYQKTQYDLAKARTLYTSDNPKVVNLVMQEASLKDLLEKRVAQTIGSS
KSLPQQNLQVGELKQALTQDLVKSEVERLALTNQIGELRKVFIINRRRLDSLPRLEQQQLQLQRQLSVAQITYQEFLKQF
QLVQVLENQNVGNSRIISEALVPERPVSPKIPLNLALGGFLGILLGVGTALLLESMNQSLKNVEEANRLLGFPLLGMIPL
YGGKNPKNQEESRGELPLLDNIYSPVSTSFEMLQTNLGFTLSDKQLRVILVTSSTSGEGKSFMAANLSLAAAHVGRRVLL
VDADMRRPRQHRIWETPNLLGLSNILAGQAQLKNTVQEVSPLVDLLPVGKIPPNPVTLLDSQRMADLVEEASNNYDFVII
DTPPLTAVTDPLIVAKYVDGLLLVVRPGKVEYSAVKSSKSLLNHGKVPILGMVVNGVSEESSYGGYYYQRGYYGEKVDSK
KKSSQANLR
>gnl|bykdb|A0A1B7UVJ4 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Anabaena sp. LE011-02] (length=729 residues).
MSINQEDQDSSIDIQQYWLTFKRHWLVTSIVFASVLGVTALLTYSAKPVYESEGKLVFTKRSGASSLADISQSMGELGGL
TNLSNPVDTESEIIRSYPIVIKTITTLNLTNDQGKQISLENFLTKLKLKTIRGTDVLQVSYSSTNPQEAANVVNSLMKYY
LESNILNNRTEARSARQFLAKQLPEVERQVTKAEMSLRRFKENNRVAVLDVEAKTGLESLAKLDQAIIESQGELVAASTR
SLALQYEMKLDTRQAVDLSTLSQSPGVQQVLTEYQKTQYDLAIARTLYTNDNPKVVDLIMKEASLKTVLKERVAQTVGSS
DALSQQNLQIGELKQSLTQELVKSEVERLALTNKIGELQRVFIVKRRRLDSLPRLEQQQLQLQRQLSVAQLTYQEFLKQF
QLVAVLENQNVGNSRIISQALVPERPVSPKKPLNLAMGGFLGILLGAGTALLLESMNQALKNVEEANRLLGFPLLGMIPL
YGGKNPKNQEESRGELPLLDNIYSPVSTSFEMLQTNLGFTLSDKQLRVILVTSSTSGEGKSFMAANLSLAAAHVGRRVLL
VDADMRRPRQHRIWETPNLLGLSNILAGQAQLKNTVQEVSPLVDLLPVGKIPPNPVTLLDSQRMADLVEEASNNYDFVII
DTPPLTAVTDPLIVAKYVDGLLLVVRPGKVEYSAVKSSKSLLNHGKVPILGMVVNGVSEESSYGGYYYQRGYYGEKVDSK
KKSSQSNLR
>gnl|bykdb|A0A1B7VSH4 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Anabaena sp. WA113] (length=729 residues).
MSINQETQDSSVDIQQYWLIFKRRWLVASIVFASVFGATALVTYLTKPVYESEGKLVFTKKSGASSLSGLSQQMGELGAL
TNLSNPVDTESEIIRSYPIVIKTITTLNLTDDQGKQLSLEVFLKKLKLKTVRGTDVMQLSYKSTNPQEAANVVNSLMKYY
LESNVRTNRREATSAREFLSKQLPEVESRVTKAEMNLRRFKENNRVVALDVEAKTGLESLGRLNEAITQSQGQLAAALTR
SVALQNEMKLDRQQAVDLSTLSQSRGVQQVLTEYQKTQSELAVARTLYTDDNPKVVDLVMKEASLKKLLEERVGQTVGNF
ESLSQQNLQIGELKQTLTQDLVKSEVERLALTKQVEELQRVFIFNRRRLDSLPRLEQQQLQLQRQLTVAQITYQEFLKQY
QLVQVLENQNVGNSRVISEALVPELPVSPKIPLNLALGGFLGVLLGAGTALLLESMNQSLKNIEEANRLLGFPLLGTIPQ
HGEKNPKNPQEGRQELPLLDDPYSPVSTSFEMLQTNLGFTVSDKKLRVILVTSATPGEGKSFVAANLALAGAYVGKRVLL
VDADMRRPRQHRVWEIHNLLGLSNILAGQTQLKNAVQEVSPLVKMLPAGKIPPNPVTLLDSQCMADLVEEASKDYDFVII
DTPPLTAVTDPLIVGKYVDGLLLVVRPGKVEYSAVNAAKSLLTQAKLPILGMVVNGIVKESGYGGYYYSSGYYGDKGERN
KQHAEASVR
>gnl|bykdb|A0A1B7W126 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Aphanizomenon flos-aquae LD13] (length=729 residues).
MSINQETQDSSVDIQQYWLIFKRRWLVASIVFASVFGATALVTYLTKPVYESEGKLVFTKKSGASSLSGLSQQMGELGAL
TNLSNPVDTESEIIRSYPIVIKTITTLNLTDDQGKQLSLEVFLKKLKLKTVRGTDVMQLSYKSTNPQEAANVVNSLMKYY
LESNVRTNRREATSAREFLSKQLPEVESRVTKAEMNLRRFKENNRVVALDVEAKTGLESLGRLNEAITQSQGQLAAALTR
SVALQNEMKLDRQQAVDLSTLSQSRGVQQVLTEYQKTQSELAVARTLYTDDNPKVVDLVMKEASLKKLLEERVGQTVGNF
ESLSQQNLQIGELKQTLTQDLVKSEVERLALTKQVEELQRVFIFNRRRLDSLPRLEQQQLQLQRQLTVAQITYQEFLKQY
QLVQVLENQNVGNSRVISEALVPELPVFPKIPLNLALGGFLGVLLGAGTALLLESMNQSLKNIEEANRLLGFPLLGTIPQ
HGEKNPKNRQEGRQELPLLDDPYSPVSTSFEMLQTNLGFTVSDKELRVILVTSATPGEGKSFVAANLALAGAYVGKRVLL
VDADMRRPRQHRVWEIHNLLGLSNILAGQTQLKNAVQEVSPLVKMLPAGKIPPNPVALLDSQCMADLVEEASKDYDFVII
DTPPLTAVTDPLIVGKYVDGLLLVVRPGKVEYSAVNAAKSLLTQAKLPILGMVVNGIVKESGYGGYYYSSGYYGDKGERN
KQHAEASVR
>gnl|bykdb|A0A1B7WTD1 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Anabaena sp. CRKS33] (length=733 residues).
MSINQEDQDSIDIQQYWLILKRRWFVASVVMASVISATAFMTYTQKPVYESQGKLVFTKKDAASSLSSLSDKMGELGGLT
NLSNPVDTEAEVIRSNPIISKTINDLKLKGKKGAPMTTDAFLKTLKLKTIRGTDVMELSYKSTDKQEAANVVNSLMKHYL
ASNINTNRAEAIAAREFLSQELPKVERRVTEAEIALRRFKEKNRVVALDVEARVSLESLGRLTESITQSQGELAAAYTRS
VALQNEMKLTTQQAVDLSSLSQSPGVQQVLTEYQKTQHELAIARTLYTNDNPKVVDLLLKEAAQKKELEARVTETVGNSN
SLPKQNLQIGELKQALTQDLVKSEVERLALTNQVGELRKVFMVNKSRLDSLPRLEQQQLQLQRQLMVAQTTYQELLRQFQ
LVQVMENQNVGNARIISEALVPEIAVSPKKPLNLALGGFLALLLGAGTALLLESMNQTLKNIEEANRLLGFPLLGTIPLY
GEKKTKNPVEGLLEVPLLDQPYSPVSTSLEMLHTNLGFTISDKELQVILVTSSTSGEGKSFVAGNLAVAASHVGKRVLLI
DCDMRRPRQHRIWEIPNLLGMSNILAGQNEVKPAIHKVFLNVDMLPAGKIPPNPVTLLDSQRMADLIEKARQDYDFVIID
SPPLTAVTDPLIISKFADGILLVVRPGQVEYSALKSAKSLLNQSKVPVLGMAVNGVSEESGYGGYYYYRGYRGYYREREE
TSKNNRSAEINLK
>gnl|bykdb|A0A1B7WX82 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Anabaena sp. MDT14b] (length=730 residues).
MSINQEDQDSSIDIQQYWLIFKRRWLVSSIVFASVFGITAFVTYTTKPVYESEGKLVFTKKGVASSLTTNISQQMGELGG
LTNLSNPVDTESEIIRSYPIIIKTITTLKLTDDKGGQISLENFLKKLKLKSIRGTDVLQVSYSSTNPQEAANVVNSLMKY
YLESNILNNRTEARSAREFLAKQLPEVERQVTKAEMSLRRFKENNRVAVLDVEAKTGLESLAKLDQAIIESQGELVAAST
RSLALQYEMKLDTRQAVDLSTLSQSPGVQQVLTEYQKTQYDLAIARTLYTNDNPKVVDLIMKEASLKTVLKERVAQTVGS
SDALPQQNLQIGELKQSLTEALVKSEVERLALTNKIGELQRVFIVNRRRLDSLPRLEQQQLQLQRQLSVAQLTYQEFLKQ
FQLVAVLENQNVGNSRIISQALVPERPVSPKKPLNLAMGGFLGILLGAGTALLLESMNQALKNVEEANRLLGFPLLGMIP
LYGGKNPKNQEESRRELPLLDNIYSPVSTSFEMLQTNLGFTLSDKELRVILVTSSTAGEGKSFVAANLALAAAHVGRRVL
LVDADMRRPRQQRIWETPNLLGLSNILAGQAQLKNTVQEVSPLVDLLPVGKIPPNPVTLLDSQRMADLVEEASNNYDFVI
LDTPPLTAVTDPLIVAKYVDGLLLVVRPGKVEYSAMKSAKSLLNQAKVPILGMAVNGISEESGYGGYYYYKGYYGDQIES
KDHPSETNVR
>gnl|bykdb|A0A1D2P6J4 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Scytonema millei VB511283] (length=742 residues).
METKGYQEEVDIQKYWLVLKRRWPIVAGVVLASVGLSSFAVFLQKPEYQATGMLLFKSDRTSSLTKVGEKIGDLESLMRE
GNPLETQAVILKSEPILEEVINTLGLKDKKGATLEPESLKIKVEPIVGTDVLKVSYTSENAELAASVVNQLMKSYVANNI
QSNRAQVFAAGEFIKKQLPYARAELDRSAEALRQFKTRYKIIELPEEASAAVKNLGEIDQEINQARAALADVSAQEAKIN
TQLNLAGDQAVEVTSISQIPGVQEVLGELQKVQTKLANEKARYTSEHPDIAELKNQEVTLNALLQQRIEQVLGTKGIEQV
LGTQKNVPPGKLQIGKIKENLTSEFAKVQAQRQGLESKIEALSNIQASYKQRLAMMPNLEKKQGDFERKLSISKKNYENL
VSRLQEIEVAEKQTVGNAKEIQPAQVPKKPVISKVVLLLAGGGVFVGLLVGVAAAFFVDLIDRSLKTVKEAETFFGYTLL
GLIPKFESNSTSAPAELMSEGVSGRVIVATSPRSVVHEAYQMLQANLKFISHKRVRTIVVTSSVAEEGKSEVSANLAAVL
AQAGRRVLLVDADMRKPTQHHLWGVINSVGLSNMIVCQAEFPQGVKTVTKHLSVLTAGVVPPNPLALIDSDRMATLIKMF
SEKYDYIVFDTPPLVGTADAAVLGKMADGVLLVVRPGVVDSASATAAKSLLERSEAKILGMIANAVNVKHEPDSYFYYSS
PRVGQSVVETEVETEQWTHKST
>gnl|bykdb|A0A1D2PBN3 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Scytonema millei VB511283] (length=740 residues).
MESKPNFEEIDFQKYLLVLQRRWVSAVGVFGVVVTVASLYAFSLKPTYNAEGSLLIKTNRTSSLTGLGEALGRLESLGVN
NNPSDTQAKIVASVPVIQETITELDLRDNKGKPLTIQELSKKLKIKGDKGTEVLEVSYTDTNPTLAAKVVNKLMQAYIKN
NIEANREEAVSARKFIQRQLPATETSVKRAEAELRRFKEENKVIALQEEATAAVNEISKLEEQISQAQAQLADVSARSQK
LQNQAKIDSQQGVTFTSLSQTPGIQQVLTQLQEAQSQLAVERTRLQPEHPIVINLEEKVAALNSLLQQRLKQVVGSGRQI
PTLNLQTGELRQKLLEDYARSEAERVGLERQITTLSNKRSAYKQRANVLPKLEQTQRELERKLKAAQTTYETLLTRLQEI
QVAENQNVGNARIISPALIPDKPAGSRKILMITGGGVLGILLGVIAAFTLDLIDRSVKTVKEARELFKYTLLGVIPSINS
NSKKSSFLPGVDQPIPRVIGTDIPQFPVGDAYQMLQANLKFLSSDKQLKAIVVTSSVAKEGKSEVAVNLAVAMAQVGRRV
LLVDADMRHPVQHHVWGMTNAVGLSNVIVDVPIDIAVQEAIPNLYVLSSGVVPPNPVALLDSRRMAALVNTFVKDYDFVI
FDTPPLAGIADAAVLGKLADGILLVVRPGVVDSASANAAKEFLTQSGQQVLGMVINGVNVKREPDSYFYYTKESPESGFV
SRNSVIVRQNRRGAIGRGDV
>gnl|bykdb|A0A1D8TNX9 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Moorea producens PAL-8-15-08-1] (length=743 residues).
MESRSSIDLDISQYLLLLKRRWLPAVAIFLFTVISAAWSTLFLKPSYEAEGKLLFKIDRTAFLTGLGEEIDQLRPLVDAQ
NPLSTEVEVIYSHPLLQQIIDQLNLTDNEGLPLEPEALKRRLTIKIVGGTDVVRLSYKGNNSDKGAAVINQLMRLYIENQ
ILSKKSEAAKAREFITNQLPQSEANVRQAEAALRQFKERNQVVSLTEEARSLVAVMADLDSQITTVQAQLEEANAQAAGL
RNQVGLNPQQAIAISALSQSTSVQGVLQELQEVERQLAVGRNRYGKNHPIMIRLTKQQRSLTGHLQQQINQILGSQSLAS
TQIQITQGLLEVDQLKQKLINDFIESEVKRQSLAEGLATLAKARIGYEQRVNVLPRLEQTQQQLEQRVQAARLTYETLLK
NLNELKVAENQDTANARIIEPAIVPKKPLGDKKLKVLALGVMLGVTLATTAILLLEMRDRSIKTLKEVKQLLRYPVLGVI
PVFKHKKLSRRRDDLFFGGELPVRDQPHSMVSEVYRMIQANLKFLKSDHPPKVIVVTSSVSKEGKSTVSANLAAAMAQLG
RRVLLIDADMRHPCQHYIWQVMNVAGLSQVLIGEVPLELVICQAMENLDLLTAGVMPPNPLALLDSKQMASLIQEFSTQY
DFVIIDAPPLLLTADALCLSPMTDGMLLVARPGVLDFANANVAKQMLDSSGQTVLGLVANAVIQKDESIGYFYQSQEYFH
HGSVRRLAQRQAQTKKTSNVSRK
>gnl|bykdb|A0A1D8TX52 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Moorea producens PAL-8-15-08-1] (length=760 residues).
MKELDLNAAAETDAGYGQLLAVLWRRRLWIISVLLTSLPIAFYLTIKKEPNYISSLQLLVEPNYIDKTRGIESQFTESTV
DIDYATQLQLMGSSELIQRAVDLLRDDYPDITIRDIRGSLRLAQVLQGKTETKVFQAVYTSNDRIKTQKVLQAIQKVYQD
YNLEQQEMRLNKGLAFINQQLPKARKDLEQAEQQLEQFRKSKNLIDPSQQAVAVSQTLNGIEQERRAIRAQYMETQTRYE
AVQQKLARSPQNALTSSRLSQSGRYQNLLNEIQRIELALVEQSRIYTEAHPSIQKLIEQRQSVFALLQEETRRVLGQVPT
QLVSTGSNLLTEGQLGGVDINLVNELITSQINLVSLQTRDQALIKTEQEIRIQLREFPALIAQYNRLQPQVAIKQNTLQQ
LLQARQELSIELARGGFNWQVVEAPLPGFKTGPNMTQDLLLGAVVGLFLGGVAAFVREAMDDGIHSSDDLKNQVALPLLG
MIPELPEGKISKPVLNLSLSQSERALPMMELLGWRPFQEALDMIYVNIQLLNPGSEWKSLMVTSALSGEGKSTLALGLAL
SAARLHRRVLLIDVDMRRPRLHQQLGLSNYEGLSTLLEDDTALLEDDTATPNPVSISPLGSTIDVLTAGPTPIDPVKLLG
SKRMKNLMAEFQETYDLVLLDTPPVLGMVDALQAASLCQGVVMVGRLERVTQSQLTQATAILRNLNLIGIIANGVKSSNQ
NYAYYGSRNSHGAIEQNQPVSDLQVSPQLERQFSNHVKSR
>gnl|bykdb|A0A1D9FX10 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Moorea producens JHB] (length=743 residues).
MESRSSIDLDLSQYLLLLKRRWLPAVAIFLFTVISAAWSTLFLKPSYEAEGKLLFKIDRTAFLTGLGEEIDQLRPLVDAQ
NPLSTEVEVIYSHPLLQQIIDQLNLTDNEGLPLEPEALKKKLTVKIVGGTDVVRLSYKGKNSEKGAAVINKLMRLYIENQ
ILSKKSEAAKAREFITNQLPQSEANVRQAEAALRQFKERNQVVSLTEEARSLVAVMADLDSQITTVQAQLEEANAQAAGL
RNQVGLNPQQAIAISALSQSTSVQGVLQELQEVERQLAVSKNRYGKNHPVMIRLTKQQRSLRGHLQQQIDQILGSQSLAG
TQIQITEGLLEVDELKQKLINDFIESEVKRQSLAEGLSTLAKARIAYEQRVNVLPRLEQTQQQLEQRLQAARLTYETLLK
NLNELKVAENQDTANARIIEPAIVPKKPLGDKKIKVLALGVMLGVTLATTAVLLLEMRDRSIKTLKEVKQLLRYPVLGVI
PVFKHKKLSRRRDDLFFGGELPVTEQPHSMVSEVYRMIQANLKFLRSDHPLKVIVVTSSVSKEGKSTVSANLAAAMAQLG
RRVLLIDSDMRHPCQHYIWQVMNVAGLSQVLIGEVPLELAICKAMENLDVLTAGVMPPNPLALLDSKQMASLIQECSTQY
DFVIIDAPPLLLTADALCLSPMTDGMLLVARPGVLDFANANVAKQMLDSSGQTVLGLVANGVIQKDESIGYFYQSQEYFH
YGSVRRLAQRQAQTKKTSNVSRR
>gnl|bykdb|A0A1D9G1F2 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Moorea producens JHB] (length=731 residues).
MDTSLSSLPLALKRRLLPALVTFTSVIGGAIAYLVVTPPVYQVKARLMLDNKKVSVSELGDNLSQVPANTPGGADPIATQ
AELVGSERLLQGALDEIALLGSSQEGLTIDTLREDLKVKIVPATNILELSYQGQNPELVTTVLNAVANAMVTESAEGIRS
EARAVREFLEKEVPLRRLEVAAAEAALNKFKQTTGLVSPEEQTQLLVRSLATLEDQERAVSIQLQDAKTRSQELQTITSL
NNTQNAYIAGRIGQDQELQALRAQLVELDRELAKMRSRLTDQNPAVISLVQERYELLTLYNQKLSRLLPTNQSNNQIIAP
GDVASDQLSQDFTSRFILAETERSALEQKLYLVQTERIKLQNRLGQIPVLRQPFASLVRRQEEAIASLKLLQNKLEEARI
AEAQLVSNIQIIERAKLPSSPKEPNPKVVLVIATAAGIALAVGMVLLLEVMDNTLHDASEAEALLKLPRLGVLPKIPAQA
LSLEQPNRFLEDMRLMEPYRLLLTTMELRAQKRLQLIVVSSAVSGEGKSVVASHLGAVSVRFSRRTLIIDADWRHPMQQD
LFGLSPQPKVTDVIDSNQTWLSAVQPTAIPNLSILTCSDLPSGPATFLQSQVIKSILAAAADHYDLVIVDTPPVSSFPDA
HTLSRYSDGLVMVTRPNFTQKDILLQTVSELNDSSTPILGFVVNGISDRTQQYYSDSFYSYQPQSQSRQTHGNEASNNCA
VVSKGVDHADS
>gnl|bykdb|A0A1D9G4T2 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Moorea producens JHB] (length=753 residues).
MKELDLNAAGETDAGYGQLLAVLWRRRLWIISVLLTSLPIAFYITLKKEPNYISSLQLLVEPNYIDKTRGIESQFTESTV
DIDYATQLQLMRSSELIQRAVDLLRDDYPDITVGDIRGSLRLAQVLQGKTETKVFQAVYTSNDRIKTQKVLQAIQKVYQD
YNLEQQEMRLNKGLAFINQQLPTARNNLEQAEQRLEQFRKSKNLIDPSQQALAVSQTLNGIEQERRAIRAQYMETQTRYE
AVQQKLARSPQNALTSSRLSQSGRYQNLLNEIQRIELALVEQSRIYTEAHPSIQKLIEQRQSVFALLQEETRRVLGQVPT
QLVSTGSNLLTEGQLGGVDINLVNELITSQINLVSLQTRDQALIKTEQEIRIQLREFPALIAQYNRLQPQVAIQQNTLQQ
LLQARQELSIELARGGFNWQVVEAPLPGFKTGPNMTQDLLLGAVVGLFLGGVAAFVREAMDDGIHSSDDLKNQVALPLLG
MIPELPEGKISKPVLNLSLSQSEKTLPMMELLGWRPFQEALDMIYVNIQLLNSGSEWKSLMVTSALSGEGKSTLALGLAL
SAARLHRRVLLIDVDMRRPRLHQQLGLSNQEGLSTLLEDDTATPSPVSISPLGSTIDVLTAGPTPIDPVKLLGSKRMKNL
MAEFQQTYDLVLLDTPPVLGMVDALQAASLCQGVVMVGRLERVTQSQLSQATAILRNLNLMGIIANGVKSSNQNYAYYGS
RNNHAAIEPQQPVSDLQESPQLERQFSNHVKSR
>gnl|bykdb|A0A1E2WSV8 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nostoc sp. KVJ20] (length=734 residues).
MTMESLPNFEEVNIQKYLEVIQRRWLPLVGIFSIAVTLGCLYAFSLKPSYKAEGSLMIKTNRSSSLTGLPQDIGRLEALN
VNDNPLETQVRVIGSNPVIEKTINSLKLKDSQGKPLSIPDLAKQLKIEGIKGTDVVQLSYKGGDPELAAKIVNEVIDSYI
DLNIKANQNEALTAKQVLVTEVPKAEEIVRRAESKLRLFKETNKIVVLEQEATAAVDTISKLGNQISQALAQLDDVKGRL
EQLRSEAQVDSQQGVIASDLSQAPGVQKVLIQLQETESQLALERTRFEPEHPTITNLEEKVTALKSLLKERVGQVAGTAQ
ITEGSLQVGQLRQSLIADITRAQAERVGLERQIGTLLRQQDAYIKRANNLPRLEQSQRELERKLQAAQTTYETLLKKRQE
IDVAQNQKIPNARVISYALIPDKAEGPRKILFIVGGGGIGLFLGIIIAFGLDLIDRSVKTVKEAKEVLRYSVLGVIPTQG
RNGKESSSIAGLDRAIPKIIGRDIPYFPVGNAYQILQVNLKFLCSDKPLKSIVITSSVAKEGKSDVSANLAVTMAQAGRR
VLLVDADMRHPIQHHIWGLPNAMGLSNVIIGQASLDTVVQEVMPNLEVLTSGVLPPNPVAMLDSQRMATLISSFGRDYDL
VIFDTPPLSGIADAAVLSTLTDGILLVVRPGVVDLNSANAAKEFLTQSGQKVLGIVINGVNTKNEPNNYFYDNKKRQIEQ
DLVSSSLTKFSKER
>gnl|bykdb|A0A1E2WUR1 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nostoc sp. KVJ20] (length=748 residues).
MSEKSMESRESIDLDLNRYLLILKRWWLPAVSIFVATVILSAVSTRFMKPDYEAEGKLLFRLPSFKVAGTNLSPGSSEGG
DSGDLKPLVATQNPISSQIEVITSPKLLQRTIDKLQLKDNEGIPLEVQALKKALNLKIIGGTDVLLISYSSSDPEEAAAV
VNTIMNFYLENDILTNRSEAAAARQFMAKQLPKTQAAVNNAEVALRIFKQKHQIADLSEETRSAVATIGNLDNEMNSVKA
QLNEVNAQTNQLRQKVELNSQEAIAVSALSQSPAVQGVLTQLQETDRQLAVERSRFLDDNPVIINLEARKASLNSLLQQQ
IGQTIGNQAPVPQSLLQIGELRQNLIQNFLQSEIQRFGLTQRLSSLYNSRSTYEQRVKLIPQLAQNQRELERKVEVAEST
YQTLLKKVQELQLVENTNTASSRIIAQALVPKDPVAGKKIIVLVLGVMFGLFFATTTILLLAMRDRSLKTLKEVRDIFGY
TLLGIVPLSVKKLRSRYSDTESTVQTIAVRDTPHSLTSEMYRMIQANLKFLSSDKVLKTIVVTSAVPKEGKSTVSANLAA
AIAQLGRKVLLIDADMRVPSQHHLWQLTNAVGLSEVLVGQAEFDIAVSKVMDSLDVLTAGVRPPNPLALLDSKRMASLIE
NFSSQDNYDFVIIDAPPLLLAADALTLSQMTDGILLVARPGVIDSNSAAAAQEMLERSSHNVLGLVVNGLIDKNESSSYF
NHAKEYFTYQDLTKAVKRQKRIPDKSSV
>gnl|bykdb|A0A1E5QIR9 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Desertifilum sp. IPPAS B-1220] (length=735 residues).
MTHLEDSDAIDLKQYGLVFKRRFFPAAIVFCAAIGATAAITFLQKPTYQAQGELLFKKNNVTTNVTVVGKEVPEIHSPPT
NPLDTEVAIVRSVATSEGVMQALDLRDEEGQPLKRKDFLRRLSISTLKDTDVLQISFKSNDPQEAVDVVNRLMQFYQEND
IQTNRAQAAAVRRFIEEQLPKSEFTVQEAEANLRVFKENNRIVALDQEASATVTLLGGLEGEITQAKVALNSANTRVAAL
RSQTGIDSQQAIALSALSQSEGVQKAIAELQAIENRLELERSRFLDEAPIIIDLETKQARLRGVLERRIIEVLGNSPGAI
APGNLQMGQLQLDLMQQLVNSEVDRLVVNSQLNELLNEYAIHKQRANALPRLQESQRDLERQVEVAQSTYQTLLTRLQEV
RIAEEQNIGNVRVIQAAVFPERPIAPQKKINFGLGGVVGIFLAVVTALVLDAKDTRIKTVREAREYLGYTLLGIIPNFEK
IDKGLSYGKDGERVKAKLPVKDAPRSLISESYRMLYANLKFLGSDRQVRVIAVTSAIPKEGKSTVSANLALAIAQLGFRV
LLVDADMRHPSQQAFWDTPKTVGLSNIIVEQVDPHEAIAEVMPHLFVLTAGSLPPNPLALLNSRRMAALIEDCAQTYDFV
ILDTPPLSAAADARILSAMTDGMLIVVQPQLVDAASAIAAKELLAQSGQNVLGMVINSVSPDNEPDSYFYAKEYPMGVDY
PSPTSSNSRLKGMKL
>gnl|bykdb|A0A1E5QP61 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Desertifilum sp. IPPAS B-1220] (length=745 residues).
MDSTDYTEGIDFQKYWLVLKRHWLPASSVFALIVTLATYKAATADPVYEAQGKLLFKKQNTTSALVTDAGAKIGQLDTLT
QFNNPLDTEAEVISSMPIVKETVEALNFRDDQGKFIPPGDFLSQLNVKKIEGTDVLMIAFKSQYPKEAADAVNKLMDVYI
NNNILVNRREATAAREFIMQQLPDTEETVRQAEAALRAFKEENSVVSLQDEATSAVISISNLDSEVIKAQAQYEDATARS
QALQSQMGLNPQQALAINTLSQSAAIQQVLTEYQKVQDQLAVQRTRYQSQHPIITNLERREAALSDLLQERVAQVLGNNQ
AVDRRDLQIGELQQQLTADLVNAEVQRLGLGSNVSALVRAQGSYRDRANALPRLEQQQRDLQRQLDAAQSAYQILLRNLQ
EVRIAENQNVGNARVISYATLPVNPVAPNKKLLVAAGVVGGSMLYVLTAFLLELMDPSIKTAKELRMLFRYTLLGMIPAT
KKRFGFLGFSSRREIPLLPTRDQPTTYTSEAYRTLQANLKFISPDREIRIIVVTSAVSQEGKSTVAANLAVATAQLGRRV
LLIDGDMRHSTQHQIWNLTNVAGLSDVIANQAKFNIAVREVMENLDVLPSGATPPNPLALIDSKRMASLLEEFRDNYEFI
IIDTPPFLLVADALALGKMTDGLLLVTRPGIIDTASAGGAREILAQSGQNVLGLVVNGVSAGSEPDGAFQRVKAYHKGKY
KDAAIKKVTVPSESSSDPSFPDWDR
>gnl|bykdb|A0A1J5GLS2 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Oscillatoriales cyanobacterium CG2_30_44_21] (length=737 residues).
MTEYPKANYVGKYVDDSFKLAKFFRILRKRWIVIVAVSASVFAGTTYYTFTRVPQYKAGAALLINNSTIAVSDIQIPGLP
GTSSINLGTEIGILRSRPLIEVAVAKMKQSPTASAYREIDAGTIMGGLEIRPEKDALILRLIYTDSDPKRAREVLNALSQ
TYVEYSLSDRRTKSSTAIKFIQEKLPQVKQQLEKSALAVTQFRKSYNIVDPETYAASVYSMREALEKQAQELQIRIAQVE
QQFEILSRQVGKTPDAAISGAILQQDIPYQSLVKQFQEVETNYFLERTRFREDHPNVLALKDRRDELYRLLETRAQSVVG
VGANSRNLTNEPNSLIQQTLATQLFETQTNLAVSEAQLASIRSAQSEVSRAFSGIPQIQQRYVEIQRQLALDTSTYNKLT
EKLEELRISEAQEISSWRVLEPPLIPTRPSSPDIERNLMTGAFVGAVLGILSALALDRLDQRIREVEEVKEIIDVPLLAS
IPITEVTSLSAMVGQSILPSSSYYAFKEALSSLALNLRYLGTDNMMKVIAFTSSVPSEGKSTLTYNLSTILAVLGYRVLL
VDADMRKPTIHKLSKLPNKVGLSTALATPTPWQDLIQSGDEKGNLDVLTSGSIPPNPMMLLESTKMNALIQEWRQEYDYV
LVDTPPVIGITDAQCLTSKVDTFILVAAINRSTRSGISRALEVLASARANVSGLLINMIGTSDSEYHYGYYDQYYLNPSG
DSEEEFEADANTVELGK
>gnl|bykdb|A0A1Q4RTR1 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Calothrix sp. HK-06] (length=723 residues).
MSALNTENDSINFRQAWRILKRRWLAVTIVISSAIGVTGAITFSQTPIYEAEGKLTFNKANLYSSLTGITGGQELEMLGR
GANAGNPLETQAEIIRSQPVIQKTIDILELKNKKGQPLAFEEFSKNLKVSGVKGTDILQISYRSPDKKMAAAVVDSVIKN
YLENDIRANRTEVVSAREFISKQLPEVEAKVRQAEVSLRLFKEKNRVVELQQEAKTSIANQSDLADEIIKTEATLVDTSS
KIISLQNQLGLNSQKAIALNALSQSKAVQQLLDEFRSTQNKLAVERIRFSDEHPTIIDLADKVQVLRQQLQQRIIQTLGG
APQGLNERDLNLDSLKQNLIAELVKLEVERTGLSNRISTLSNALTLYKQRATSLPRLEQNQSQLERDLQVARQTYEQLLR
RFQEVQVIENKTVGNARVVSQALVTDNPVSPKIALNLALGGFLGIILAVGAALTLEALDGTVKTIEEAQELLGYALLGTI
PRLSVSRHYRNRHISTLPIRDNPWSPASAAFEKLQSTLEYTLPDQVLKSIVITSAIPNEGKSFVSANLALAMAQLGRRVL
IIDADMRCSSQHEVWKVENSQGLNEILENKIDLQTAVKNISNNVYLLTAGATPSNPFATLASPRMNALIATAQQEYDFVI
IDTPPVIYAADALILGKLVDGTLVVVRPGAANSAISQEMKTLLTQSTQRVLGMVVNDVMDETDSYYGYGIQKGYYRLPTV
GAK
>gnl|bykdb|A0A1Q4RZJ6 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Calothrix sp. HK-06] (length=708 residues).
MEKGFWSVLSVLKRRGLPALITFTAVIGGAVAYLKVTPRLYESSSRLIFDDRRTSVSELGRDLSQTSITSAGNSPLANQA
ELIKSERILTQALAIAGNSDGGQNGSTKLTVDEFSQGIRVKTIPATNILEISYQSKNPDLAATYANAVAMATIRDNIKSI
SSEATKVRQFLQQQLPQARTQLQAAEVAENNYRQQSSIVDFDEQTKSLVQSVASLEDQQRNLATQLQEANSRLDSLRQVT
QSKGLDTAYESVRGGQDQELQKLRAKLAEQETQLIEARLKFTDSHPTVVKMLQQRDALRSLYAQELSRVAPKAGANNSNN
NIAGDPISQDLTSQLITNEIERAAVAEKLQLTQNNIAQLRNRLTQLPLQQQPLTALIRKREEAAASLKFLQAKFEEARIA
EAQKVSTLQVIQAAKAASIASSPKPNVVLALAGAFGLLLATGVVILLEIMDNTLHDASEAEELLKLPLLGVLPRLPAKTL
ALEPADGFLDNVALVEPYRMLFKSLEFRTSELQLLVVSSTISGEGKSIVASHLAAVSAMLSRRTLIIDADLRRPVQHTIF
NLPGKPGITDIVEGNISLKEAVQPTEIENLSVLTCGGIYGRPSQILESAAMKKLIAEAAANYDFVIIDTPPLSACADTAT
LAKQCEGVLMVTRPNITVKEVLQRAVSELNNNHIPIVGVVVNGMTSQTEQYYRYPMSGYQTKRLKAKI
>gnl|bykdb|A0A1Q4S1H4 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Calothrix sp. HK-06] (length=720 residues).
MEKGVSSLWTVAKRRSLPAFLTLSAVIAGAVTYLAVAPRMYETSSRLMVDDKGVSVSDFGRSITQLNAGTPGGASALGDQ
AELIKSQQVLEKALTALKANSQTASQAEKTTLKKLSRDLKVKIIPATNILELSYKASDPVFAARLLNAVSNAMVEENIKT
ISSEATKVRQFLEKNEVPNAQQRLKVAEIKENKYRQTSGIVSFDDQSKSLVTSLANLEDQERMLFAQLQEARSRDSSLRQ
VTNSSNLGNAYASVRSGQDEQIKNLRARLTELETQIVALQQRFTPEHPELNSLIQQRDTLRAMYQQELARISNGNAVANI
SNDTLSQTLNSQLVTNTVEGTAVANKLRTLQAERVRLQNRLAQLPIKQEPLTALTRAREEAAESFKGLQRKLEEARIAEA
QKVSNIRIIEVANVPTLPSEPQPAIILAIAGAFGILLSTGMVLLLEMMDNRLHDVAEAELLNIPLLGILPRLSKSNLALA
EADLFLDDMGLVEPYRMLLKTLECRSPGKLHLVVVSSALSSEGKSVVVSHLAAVAAMLSRRTLLIDADLRRPKLHRAFNL
QAAPGLSDAISQRSGRLADFVQPTGIENLSVLTCGSMSARPSQLLESNQMKALLTEAAENYDLVILDTPPLSACADATTL
SQLSDGVMLVTRPNYTIKEVLEKAVADLTRDRIPMLGVVVNGISTPSDQYYRLANDEQTASPKGLARIGGAFNSNHTSGS
>gnl|bykdb|A0A1Q4S362 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Calothrix sp. HK-06] (length=727 residues).
MEQQHNRSEDIDIRSYWLVLKRRWLVASGILFTSIALSGFAISLQRPTYQASGKLLFQANRASLLTGVGEKVGDLESVRR
EANPLSTQAEILQSRPILEEVIKKLDLRDKNGELLEPESINIKIEPIPGTDVLNVAHISGESKKAADVVNQIMRSYVNSN
IQNNRQETIAARKFIEGQLPRAEGQLNRATEDLRSFKAANQVINLEKETEETVKNIGELDKQLNEVKGQLAEVTSQQAEL
RSQIKIPSSEAVDRTSLSLIPGVQEALGELQKVQTQIATQRALYTSDNPIMITLREKEASLNKLLQQRASQSLGTNVKVS
PDKLQLGQLKEQLVGESVRLQAQRLGLESKVQTLSGIYEQFKQRAQVLPNLEKKQGDLERRLIVAQKTYETLLGRLQEIR
VAENQTIGSARIVQNAVVSPNPARMRMMLLLGAGGIFIGALLGVAAAFVVDVIDKSIKTVKEAQDVFGYTLLGLIPKFDT
NSASIQQTMEGASPRVIVGTLPRSVIHEAYQMLQANLKFISHKTVRTIVVTSSVPGEGKSEVSANLAAVIAQAGKRVLLV
DSDMRNPSQHHLWGVMNLTGLSNVIVGQDRIRNCIQTVTRNLSVLTAGVIPPNPQALLDSEGMSALIQALSQHYDYIIFD
TPPLAGTADAAVLGKMADGVLVVVRPGVADSASALAAKTLLMRSEANVLGLVANGVNIKHEPDRYFYYNSTRDTDNSSLV
VQSSDNK
>gnl|bykdb|A0A1S1ZVW2 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cylindrospermopsis raciborskii MVCC14] (length=729 residues).
MPINQETTDVIDLQVYWLILKRRWLVILLVMASVLGAAISYTYSQKPVYQAKGKLLFEKKDGVSSLTSLATSVGELGGVG
NNSNPIDTEAEVIRSHPLITKTINQLGTKNTKGEPIEIDVFLKQLKLQIIRGTDVMELSYNSTNPQEAADTVNTLMKYYL
DNNILINRSQATAARKFLSQELPRIEKQVTKAELELRRFKEVNRVVALDAEAKVGIESLGRIDEVITQAQGQLAAAYTRS
LALQNELQLSTQQAVALSSLSQIPGVQQVLTEYQKTQQELAIAETTYTSDNPKVVNLQLKEQALKKQLQERVSQSIGNVE
VLQQSNLQIGELKQALTQDLVRSEVERLALANQVKALQSVFIINKRRLDSLPRLEQQQLQLQRQLQVAQGTYQQLLKQLQ
EVQVLENQNVGNARVISSALIPEIPISPRTALNIGIGGIVGLVLGVGTALLLETLDKSVKNIEELNRILDLPMLGTIPQY
ENTKRRKNQEQEENQRELPVLDNPYSPVSTSIEMLQTNLGFATDKELQVILVTSSSPAEGKSFVSANLALAASHLGKRVL
IVDADLRRPRQHKVWGLPNFVGLSNLLVAQTQLENCLQDVSSVNVLTAGKVPPNPVKLLDSQSMASFITAARQDYDFVII
DTPPLTAVADALIVGKLVDGVLLVVRPGQVESSAVKASNSLLIQSKVPVLGMVVNGVSEDSGYGGYYYYRGYYGDLKDKR
EGDSLAIKR
>gnl|bykdb|A0A1U7GW28 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Fischerella major NIES-592] (length=732 residues).
MKESEFHVEEIDFQKYLLVLQRRWMTAVGVFGVVFTLALLYALSTKPTYTAQASLLIKTSRTSSLTGLGEDLGRLESLVQ
DNSPVDTQAKIVTSVPVLQATITSLSLKNDEGEPLKVEDLQKKLKVEGVKGTDVLEVSYTHQDPQLAAKVINKIVEEYTK
QNIQANREEAISAGKFMLQQLPKTEEAVQKAELALRRFKERNKIIVLQEEATAAVNTISRLEDEIAQAQAQLVDVNARLE
KLQTQARVNSQEAVSAVDLSQVPGTQKVLTELQEAQSELTVARTRYQPGHPTVANLEEKVSALRSLLQQRVEQVGGNNQQ
ISTANLQMGEVRQKLIEDLANTDKERVGLERRIAELTNTWSVYKQRANILPKLEQTQRELERKLKAAQTTYETLLTRIQE
INVAENQNVSNARIISPALVPDEPSGTRKALIAAGGGVLGIMLGIIAALAVDLIDRSIKTVKEARELFQYTLLGVIPNVS
RNTKNSYSVQGLDRPIPRVVGRDIPHFPVGDAYQMLQANLKFLSYKQLKAITVTSSIPKEGKSEVSANLAVAMAQVERRV
LLVDADMRHPIQHHIWQLSNNQGLSNIIVDQVPLETIVHEVMPNLHVLTSGVMPPNPVALLDSDRMATLVASFNQKYDCV
IFDAPPLAGTADAAVLGKLADGILLVVRPEVVDYASANAAKEFLTQSDQTVLGMVINGVSVKREPDSYFYYAKDSVESTG
VSRKSILVRNHR
>gnl|bykdb|A0A1U7GYR5 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Fischerella major NIES-592] (length=728 residues).
METNSYTQATEIQQYLLILKRRWRLITAIILASIGLSGSALFMQKPEYQADGILLFKSDRTSSLTKVGEKIGDLEALMRE
GNPLETQAVIVNSHPMLQEVITALQLKDDQGKLIDPELLKVNVKPIVGTDVLRVSYASNDRELAAAVVNQLMKSYVENNI
QTNRAQVSAAGEFIKEQLPASRQELERAAEALRQFKIQNKVIQLAEESTAAIDIISKLDQEINQVKAALADVSAQEQQIA
SQLNVSENQAVTVTSLSQIPGVQEVLTELQKVQTKLANARAIYTEVHPTITDLKNQQATLNSLLQQRTQEYSGIPIVSPG
KLQIGKIREELTDKYVEFKAERQGLEKKIRTLSNIRANYQQQLAMVPSLEKKQQALERRLEAAKTGYENLVTRLQEIQVA
EKQTIGNARIVQPAQIPKKPVISKTKILLAGGSIFAGVLLSIAAAFFVDLIDRSLKTVKETETFFGYTLLGLIPKYKLNN
SVSGVQEIEAGVYPQVITTTSPRTVVHEAYQMLQANLKFISHRKVRKIVVTSSVTAEGKSEVSANLAAVIAQSGKRVLLV
DADMRKPTQHHLWGFINSVGLSHLLVDQGVFSQAVQKVTEFLAVLTAGVIPPNPLALIDSEGMTSLVDIFAENYDYVIFD
TPPLAGIADAAVLGKMADGILLVTRPGVLDAPSAAAAKSLLERSEANVLGIVANAVNAKQEPSSYFYYSNLRDRNSTADL
ERVPQQLK
>gnl|bykdb|A0A1U7HGH0 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Chroogloeocystis siderophila 5.2 s.c.1] (length=732 residues).
MEVTELDLHKYWYILKRRWLPAVAAFGTVMGITYLHTLSRVPIYQAQGELLFRQDRSSSLIGLQSATQANPTTQNDTSLA
TEAKVIRSIPILQQALEQINEASQNTTLSLESLRQGLDIVAVEGTEILQVVYRGEEPEQAALIVNQLMNVYVSKNLLNNR
AAAISAGNFITAQLPKVKANLQRADLAVRNFKEKNQLTNIEQSQTALAANIERVGSQIDAVEAQLVDLNSRTQSLQRQLG
MNPQQAMTIATISQSSAIQGVLAELQTVQRQIADARSRYRDDHPILDSLQEREARFQQLLQTQTNQVLQGQTPNGNNQLQ
VGQIQQDLISDLIAAEIERQGLISQQATLTQQQKAYLQKATNLPRLEQQQRELERELSAAQSTYEALLRSLQEIKVIENR
TVGNVQIIEYAQVPSGAINASNTSALAAGSLAGLMIAGGIVYLLELTDKKIKTAKEAREIFEYKLLGTIPLFHNESQTER
EQWRVPVLAEPRSFITESYRMLLANLKFPPSLDRSSRVILVTSSIPKEGKSTTCANLAAVMALLNYKVLIIDADLRHPSQ
HQIWEIANHIGLMNTITKRVGVNKKAIQPVAKNIDVLTTGTSESDLGILIDSRSMSTLITQYAKQYDYLIIDTPPLSIAA
DASILSKVVDGVILVTRPGIADISSSRFAKEYLDQSGQNILGIVVNGIPLDNTLHSYYRHVENNTDAGSDFKPSDFIKIK
DWRNTLRFFRRP
>gnl|bykdb|A0A1U7HW70 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Chroogloeocystis siderophila 5.2 s.c.1] (length=734 residues).
MQSNDTIDIDLKRVWLILKRRWLPAAGVFGVVVAAATAFASMQRPVYEAQGKLLFRKADRTTAISGLKDINVGELEAIAT
KANPLNTEIEIIRSVPFLEKTIASLNLRNDSGSLIKPQALAGKMSARNIPLTDVLQISYQSEDPEEAAAVVNKVMNLYIE
NNIITNRAEASAAGEFIAKQLPQMETTVRQAELALRQFKEQNQVVALDEEAKTAVAAIKQLENQITETQAQLADTTTRSA
TLQQQVGMNPQEGITLTALNQSPGIQKVLAEYQQVEAELAVQQTRFVGDHPTLLGLTERRDALRALLEERVQGAIGGNAA
ATEVSPGNLQMGEIRQELTQNYVNSEIQRLGLTSRLNSLNNTYNAYRQRVNVLPRLEQTQRELERRLEAAQSTYETLLRR
LQEVRVAENQNMGNARIIEFATVPENASVRKKAMILALGNILALILAILTICILELSDRSVKTLREARERLDYTLLGTIP
YFGKRYANRRNQEWSIPELPVINLPRSPISEAYRMLQANLKFLSSDKPLKVIVVTSAVPKEGKSTVSANLAAAMAQLGRK
VLLVDADMRHPLQHHIWELTNAAGLSDVIVSQAEFESVVTEVIPKLDVLSAGVIPPNPMALLDSKRMASLVQYFSDRYDF
VIIDAPPLVLAADAVTLGKMTDGVLLVARPGVLDSSSAAAAKESLERSGQNVLGLVVNGVIPENESDSYFYYAKEYANEK
NFPIEESSTVTTPR
>gnl|bykdb|A0A1U7I8L3 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Phormidium ambiguum IAM M-71] (length=741 residues).
MVNVNTNNLNPAAETEAGYGQLLAILLRRRYWLLGIFSVVLAITAIVTITTKPTYKSSMQLLVEPNYQGKQEGSKNAEND
FADSNVEIDYATQLNLMRSSQLIQKAVDLLRPQYPKIKVKDIKEALVVNQLQEDKVNTKIFEVTYIDNDPIKTQTVLETI
KRVYQDYNREQQQLRLTKGLSFIDAQLPSLRESTVRTEAALEKFRKSQNLIQPELQAKALIESLKDIQYELRTARAQYQE
AQSRFQTLQQQVKRSPQDAVVSSRLSESTRYQTLLSEIQKIELELAKERQRFTDSNPVIQNLLEQRQSQLALLQKEQQLV
QGNNNPLPPTTTNSNLLEKGQLGKLDVNLSSKLLEEQTNVQGWQARVQSLTQKAQQIQAELQRFPGMLSQYNRLEPEVKL
NRDTLEQLLKARQELSLEIARGGFDWQMVEEPQLGLQIGPSMKRNLLLGAVVGLMLGSIVAFIRDMIDDAVHTSDDLKKQ
VDLPLLGIIPQLNPQTRTEPIIHLPFRQQPILTSSTIELISWQPFRESLDLIYQNIQLVNSTGSLKSLVITSALAGEGKS
AIALGLAISAARLHQRVLLIDADLRRPSLHKELNLPNDRGLSTLLTNDVSLRDETNVQISRQHNNISILTAGPTPLDPAQ
LLSSQRMRELMANFEQSYDLVLLDAPPVLGIVDAILAASFCSGAVLVGRIGRVTRTELTQATNMLHKLNVIGVVANGADG
FSNGYSSYSQQDQELLQPRTR
>gnl|bykdb|A0A1U7MYU6 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Moorea bouillonii PNG] (length=743 residues).
MESRSSIDLDISQYLLLLKRRWLPAVAIFLFTVISAAWSTLFLKPSYEAEGKLLFKIDRTAFLTGLGEEIEQLRPLVDAQ
NPLSTEVEVIYSHPLLQQIIDQLNLTDNEGLPLEPEALKRRLTIKIVGGTDVVRLSYKGNNSDKGAAVINQLMRLYIENQ
ILSKKSEAAKAREFITNQLPQSEANVRQAEAALRQFKERNQVVSLTEEARSLVAVMADLDSQITTVQAQLEEANAQAAGL
RNQVGLNPQQAIAISALSQSTSVQGVLQELQEVERQLAVGNNRYGKNHPVMIRLTKQQSSLRGHLQQQIDQILGSQSLAG
TQIQITQGLLEVDQLKQKLISDFIESEVKRRSLAEGLATLAKARIAYEQRVNVLPRLEQTQQQLEQRLQAARLTYETLLK
NLNELKVAENQDTANARIIEPAIVPKKPLGDKKIKVLALGVMLGVTLATTAVLLLEMRDRSIKTLKEVKQLLRYPVLGVI
PVFKHKKLSRRRDDLFFGGELPVTDQPHSMVSEVYRMIQANLKFLRSDHPLKVIVVTSSVSKEGKSTVSANLAAAMAQLG
RRVLLIDSDMRHPCQHYIWQVMNVAGLSQVLIGEVPLELAICQAMENLDVLTAGVMPPNPLALLDSKQMASLIEECSTQY
DFVIIDAPPLLLTADALCLSPMTDGMLLVARPGVLDFANANVAKQMLDSSGQTVLGLVANGVIQKDESIGYFYQSQEYFD
YGSVRRLAQRKAETQKTSKVSRR
>gnl|bykdb|A0A1U7N2U4 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Moorea bouillonii PNG] (length=735 residues).
METSLSSLPLALRRRLLAALATFTSVIGGGMAYLVVTPPVYQVKARLMLENKKVSVSELGRNLSQVPANTPGEASPIATQ
AELVGSQRVLQGALYQIGILGSSPEGLTINTLRRDLKVKIVPATNILELSYQSQNPELATTVLNAVANAMVSESAQGIRS
EARAVREFLEKEVPLRRLEVEATEAALNKFKQTTGLVSPEEQTQLLVRSLATLEDQERAVSIQLQDAKTRSQELQTITSL
NNTQNAYIAGRIGQDQELQALRAQLVNLERELAKMRSRLTDQNPAMISLVQERYELLTLYNQKLSRLLPTNQPTNQLTNQ
IIPPADVASDQLSQDFTSRFILAETERSALEQKLYLVQTERIKLQNRLGQIPVLQQPFGTLVRRQDEAIASLKLLQNKLE
EARIAETQLVNNIQIIERAKLPSSPKEPNPKVVLLIASAAGIALAVGMVLLLEVMDNTLHDGSEAEALLKLPRLGVLPTI
PAQALSVEQPKGFLEDMRLMEPYRLLLTTMELRAQKRLQLIVVSSAVSGEGKSVVVSHLAAVSARFSRRTLIIDADWRHP
MQHNLFGLPPQPKVKDLMDSNQTCLEAVQPTAIANLSILTCSDQPSGPATFLQSQVMKSILAAAGDHYDLVIVDTPPVSS
FADAHTLSRYSDGLVMVTRANFTQKDILLQTVSKLKDTSTPILGFVVNGISDRTRQYYSDSFYSYQPQSQSRQTHGNEAS
NNCALVSREVDHADS
>gnl|bykdb|A0A1U7N5X9 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Moorea bouillonii PNG] (length=753 residues).
MKELDLNAAAETDAGYGQLLAVLWRRRLWIISVLLTSLPIAFYLTLKKEPNYISSLQLLVEPNYIDKTRGIESQFTESTV
DIDYATQLQLMRSSELMKRAVELLRDDYPNITVGDIRGSLRLAQVLQGKTETKVFQAVYTSNDRIKTQKVLQAIQKVYQD
YNLEQQEMRLNKGLAFINQQLPKARKDLEQAEQQLEQFRKSKNLIDPSQQAVAVSQTLNGIEQERRAIRAQYMETQTRYE
AVQQKLARSPQNALTSSRLSQSGRYQNLLNEIQRIELALVEQSRIYTEAHPTIQKLIEQRQSVFALLQEETRRVLGQVPT
QLVTTGNNLLTEGQLGGVDINLVNELITSQINLVSLQTRDQALAKTEQEIRIQLREFPALIAQYNRLQPQVAIQQNTLQQ
LLQARQELSIELARGGFNWQVVEAPLPGLKTGPNMTQDLLLGAVVGLFLGGVAAFVREAMDDGIHTSDDLKNQVALPLLG
MIPELPEGKISKPVLNLSLSQSEKALPMMELLGWRPFQEALDMIYVNIQLLNSGSEWKSLMVTSALSGEGKSTLALGLAL
SAARLHRRVLLIDVDMRRPRLHQQLGLSNQEGLSTLLEDDIATPSPVSISPLGSTIDVLTAGPTPIDPVKLLGSKRMKNL
MAEFQQTYDLVLLDTPPVLGMVDALQAASLCQGVVMVGRLERVTQSQLTQATAILRNLNLIGIIANGVKSSNQNYAYYGS
RNSHGAIEQNQPVSDLQVSPQLERQFSNHVKSR
>gnl|bykdb|A0A1W5CKM3 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Anabaena sp. 39858] (length=727 residues).
MGKGISTLLGVLGRRGFPAVTVFASVIGASFAYLAVTPRLYETSARLMLDDKKASVSELGRDLTQINSTAIGRNPLADQA
ELLKSQTVLQLAISKLNPPIKDSSTQKPLTASDIRSNLKVIIVPATNILDLRYQSPNPNQAAQILNAVSQAMVEENIKTI
SSEATKVREFLAEKVPIARQRLLQAELAETKYRQQSGVVATDDQTRSLVNSLAELENQERILAVQLQETRSRDASLRQVT
DAKNINTAYASVREGQDEQLKVLRTKLTDIETKLIEARTKYQEAHPTVLDLVQQRDEIRALYGQQMARVSSSNQTANFNN
LSNDQISQTLISDLITNDITRLAVENKLNAIQKMRANIQSRLALIPIQQQPLTVLTRQREEAAESLKFLQSKLEEAQIAE
AQKVSNIRIIETAVAPELPTSPKRTVVLVIAGFFGSILAVGLVLLLELMDNTLRDATEAEELLQLPLLGVLPRLPATKLS
LEPAEQFLDDLGLVEPYRMLLKNLEFRNVDNLQVIVVSSPLAGEGKSVIVSHLAAVSAMLSRRTLIIDADLRKPSQHTLF
NLPPRPGITDVIDGTRPLLSAVQSTTIENLSVLTCGELRGRPSQILESAAMKALVAEAAQRYDLVIIDTPPLSACADAST
LSQMSDGVILTTRPGFTLKEVLQRAVSELNQNRIPVLGVVVNGMTSGTEKYYRYPSEEYPSILSRPLRRLTSLGSSARNS
ANDSRSN
>gnl|bykdb|A0A1W5CNX3 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Anabaena sp. 39858] (length=736 residues).
MPSHQDDQDLINFQQYWLIAKRRWLLIATIMGSVFGVTGLLTFSQKPIYEAEGKLLFNKQSGVSSLTGVSEQLGQLSGVT
NLSNPLETEAEIIRSNPIIQKTIAESQLKDEQGQPLEIDDFLRSLKIKSVRGTDILQLTYRSANPEEATAIINRLMNTYL
ENNVRNNRSEATAAREFLSKQLPLVEAKVTEAEAALRRFKEKYEVVSLQEEAIQGVKRLNDLSGQVTQLRAQLVDARTRS
GALQNQLALNTKQAMALSSLSQSNAVQQVLSEYQKVQDQLAVERSRFTEEHPVIANLLNKEQALKEQLEGRVSKTLGSWQ
PIPEQDLQIGELKQTLTANLVQVEVERLGLENQVGVLMKAFVLYQARLRVLPKLEQQQLQLQRQLQIAQTTYEQMLKRLQ
DVEVVENQNVGNARIVSEALLPKTPVSPRIVLNLALGGFLGFFLAIGAALLLEAGDKSVRTQEEAQQLLDYPLLGTIPAF
DQKARLARGESITELPVLNNPYSSVNAAFEMLQINLGFSFSDKKLKVIVVSSCVMNEGKSFIAANLAVATAQMGRRVLLI
DADMRRPRQHEMWQQPNLMGLSNVLVGQATLAEAAKEVVINLELLTSGTIPPNPAALLDSQRMNGLLQQAAEDYDYVIID
TPPLSVLADASIIGKMADGMLLVARPGVLNSAAAKTTKTLIEHSRVSVLGMVVNCVATDSNDYGYYYSHKNTGDNNSGKK
DRIKSNLSKITGLRLL
>gnl|bykdb|A0A1W5CPC7 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Anabaena sp. 39858] (length=734 residues).
MTMDSLQGFEEVDIHKYVEVLQRRWLAVVGIFGLSLTLGCVYAFSQKPSYKAEGSVMIKTNRTSSLTGLPQDIGRLEPLN
VNDNPLETQVRIIGSNPVLEQTIKALNLKDKNGKPLSIRIFAKQLKIEGIKGTDVVQLSYKSNDPALAAKVVNKVIDNYI
ALNIKANQDEALTAKQVLIAEIPKAETSVKKAESELRIFKEINKIIALEQEATVAVDTVSKLSNRISEAQAQLNDVTGRL
EQLRAQAQVDSQQGVIASELSQAPGVQKVLAELQETESKLAVERTRFESEHPAITSLEEKIVVLKNLLKDRTGQVAGTAQ
VTQGSLQVGQLKQSIIADITRAESQRVGLERQISTLLQQREAYIKRANYLPKLEQNQRELERRLQAAQGTYETLLKKRQE
IDIAQNQKIPNARVISYALIPDFPEGPRKILFIIGGGVAGIFLGIIAAFSIDLIDRSVKTVKEAKEVLRYTVLGVIPTLG
RNTKDDIPIPGLDRAVPKIIGRDIPYFPLGDAYQILQVNLKFLCSDKPLKSIVVTSSVPKEGKSEVSANLAVTMAQAGRR
VLLVDADMRHPIQHHIWDLSNAIGLTNVLIGQVTLDEAVQEVMPNLEVLPCGILPPNPVAMLDSQRMATLMSNFARDYDF
IIFDTPPLTGIADAAVLSTLTDGILLVVRPGVVDFNSANAAKEFLTQSGQKVLGIVINGVNIKNEPNGYIYSSKYRQLEP
NSISSSLSKLSRKS
>gnl|bykdb|A0A1X4G3D5 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cylindrospermopsis raciborskii CENA303] (length=736 residues).
MPINQVNQEESDVIDLQLYWMILRRRWLVVLLVMASVLGGAISYTLFQKPVYQAKGKLLFEGDRVSSLTRLGGLAELAQL
TGATGSGGSGLENEAEVIRSRPMLEQLVETLELQDDEGKPLDPDVILGNLKLQTVRGTNVMEFTYDSKIPDEAAKIVNGL
MNEYLLSNIVINNSASSKARQVLAKKLPRVERELAKAETDLRQFKESNEIISLEAEAESGMKNVSTVDAAINQAQAELAV
VYTRSSALQNELQLNKQQAVLVSTLSQIPGVQEVLKEYQKNEQELAVAQTTYTNDNPKVVSLTAKGQVLKKQLQERIYQS
VGNVGALGERSLYMPSLKQGLTEELVKSEIEKLTLSSNINALQNVLSIYKRRLTSLPRLGQQEARLRLRLEIVVTTYKQL
QKQLQELEILQGETTGTARVLSSALVPKRPVSPRIPLNIGIGAILGVILGVGTALVLESLDKSVKNIEEINRLLDLPLLG
SIPNFETKKRKNKGEWEGEGDLPLFDQPYSPISRSFQILQTNLGFARDRELQVMLVTSSSQGEGKSFVSANLAAALSYLG
KRVLIVDGDLRRPCQHRVWKLPNFVGLSEILAGRTQLGASIQEVSSISVLTAGNTPPNALQLLDSESMVNFVQKVRNEYD
FIIIDTPPLTAVADALVVSKLVDGVLLVVRPGRVESSAVSAANTLLTQAKVPVLGMVVNGVSEESGYGGYQYSGYYTGDY
EDLKDSHQGNSVGLKR
>gnl|bykdb|A0A1Y0RCK1 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nostocales cyanobacterium HT-58-2] (length=726 residues).
MEKRISNVLAVLKRRSAPAIAAFAAVIGGAIAYLAVTPSKYEAYARLMLDDKRVSVSELGRDLTQVSSNSPGNSPLADQA
ELIKSQRVLERAIAIAFPQIKGNLSQSPVSTAELSHNLKVKIVPATNILELNYQSKNPQLAAQLLNAISQAMVEDNTKSI
NSEATKVKEFLEEKQVPEADKQLRQAEAQENKYRQLSGIVSLEEQTKSLVQSIATVEDQERTLSAQLQEIKARDVSLRQI
TNTENLNNAYSSVRSGQDEEIKKLRAKLSELENKIIEARLRFTEEHPNVRNLVGERDALRAIYSEQLARVSSENQNASAK
NFAGDQLSQDLNSKFIVNRIEESAVNDRLKLLQTKKVNLQARLAQLPIKQQTLTVLTRKREEAAASLKFLQSKLEEARLT
EAQKVSNIRVIENAVAPSSPSEPKQKVILALASVFGSVLAVGVVLLLELMDNTLRDATEAEELLQLPLLGVLPRLPAKTL
VLKPANQFLDNISLVEPYRTLFKTLEFRSREQLRLIVVSSTISGEGKSVVASHLAAVAAMLSWRTLVIDADLRKPVQHTL
FHLAPKLGITDVLEGNISLLDAVQPTDIENLDVLTCGQLHGRPSQLLESIEMKSLIAEASENYDLVIIDTPPLSACADAS
TLAQQSDGVVLVTRPSFTDKEILSRCVWELTQNRIPILGVVVNGMANLTQKYYRYPIHGSQPRLPKSQKQLMGVSQNAKN
SPNGVK
>gnl|bykdb|A0A1Z3HMQ0 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Halomicronema hongdechloris C2206] (length=747 residues).
MDGKTYQDYVEEIDLQRYWLVLKRRWLPASLVFAACVVAAALVGLSQKDTYQASGKLLFQVDRSTSLTGVGDEIGDLEAV
NPVNSDPLSTQAAILSSLPVLQEAVNALDLQDAKGNSIPPDVLRRGLTIAPLEGTDVLRVAYQSPNGELSAAVVNQVMTS
YIERNITMNRSEATAARQFVQEQLPKAEAEVEQAAEALRQFKDQNQIIALESEANAAVSMINNLETQIGQAQAQLASAIT
RTGELRRQLGIPLAQARQVDSLSQSPGVQRILEDLQAVQTELASQRSRYTASHPLIANLEREQASLQTLLNRRVGEVLGT
QANISPGDLQMSELSRQLTSQLTEAEVNRLSLASQVQALLDSRQAYIEWSQAFPALEKRQLELEQRLLAAKTNYETLLVR
LQEAQLAENQTVGSAQILEPAAPPRFPVGTSTKKYIAAGGAVGLLLGVAMAFFLDLIDKSIKTVKDGEALLGYTLLGLIP
KFGLLGNDGPDLELPAGEGISPRVIAFSQTQPMVTAAYQMLQANLKFISSDTPRRALTLTSSVPQEGKSEVAANLAATIA
QTGKQVLLVDADMRSPWQHHLWNVVNQIGLSHVLVGEGHLNQALRPVANNLTLLSAGVTPPNPLALIDSERMAALVRTLA
KRYDYVLFDTPPLIGAADAAVLGRATDGVLLVLRPRLVDSASAQAAKSLLQRSGAEILGMVANGVDIRHEHDDYVSHVKA
GAYPYGQRRDASTSNLSPISTELSDKT
>gnl|bykdb|A0A1Z4FWI3 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Calothrix sp. NIES-2098] (length=746 residues).
MESRESIDLDFGRYLSVLKRQWIPATTIFASTVAVSVMATTFMKPSYESEGKLLFKSPSFNVVGTNLLPNGSEGQATGDL
KSLVSNQNPISSQIEVISSPTLLQRTIDELQLKNDKGEPLTVEALKQRLTLKIVGGTDVLLVSYKSPDPETAAAVVNTVM
NIYLENDSNTNRAEAEATRRFMAKQLPNTRAAVQEAEGALRRFKQSNNIVDLIEETRSAVAIIGNLDNSINATRAELDQA
TAQSNELRQKVALNSQQALSASAVSQSPAVQGIVTQLQDVERQLATERSRFQDENPVIINLEAKKANLKALLQQEIGQAG
GNPSNIQPRTLQIGETKQNLINTFLQAEVQRQGLAQKLTSLYNSRGAYEKRVKVIPQLEQQQRELERRLEVAQSTYQTLL
KKIQELQVAENDNTPNARIIARGLVPTKPGLGLKPIVWLLGILLGAFLSTTAVVFLETRDRSLKTLNEIREIFGRYTLLG
IVPSSTKKLRSRNREAELAPPEIAVIDTPQSLTSEIYRMIQANLRFLSSDKVLKTIVVSSAVPKEGKSTVSANLAAAIAQ
LGRRVLLIDADMRVPSQHHLWQITNSAGLSDVLVGEAEFKTVACNVIENLDVLTAGVRPPNPLALLDSKRMASLIQDFSS
QYDFVIIDAPPLLLAADASTLSHMTDGILLVARPGVIDSNSANHAKEMLERSGHNVLGLLVNGIDEKNEFSRQYYTKEYF
PAEEGMQEYKIQTRKDGVLSSYNKFK
>gnl|bykdb|A0A1Z4G5Y1 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Calothrix sp. NIES-2098] (length=730 residues).
MPTKRDDRDLIDFQEYWPILKRRWPVTAVVIGSVFGLTALVTFVQKPVYESQAKLLFNKQSGVSSLTGLSSQVGELSGLT
NLSNPVDTEAEVIRSNPIVQKTIASLNLKDKSGKPLSIEKFLKKLKLKTIRGTDVMQLSYNSTNPEEAATVLNSLMNYYL
ESNVRTNRAEARSAREFLNRQLPEVEKRVLKAEMALRRFKEQNKVVALEVEAKTGVEGLKDLLGEITKAQAGLADATSRT
KALQSQIALNTQQAVEFSTLSQSPGIQQVLTEYQKAEDELAVARTRFSEEHPIVINLAQKAAALRSQLEGRVSQTIGSSE
FVPEQNLQIGVLKQNLTEALVKSEVDRLAFTNRVATLRQVYLTNQRRLDILPRLEQQQLQLQRQLQVAKITYEQLMKQLQ
EVEVIENQNIGNSRVISDALVPEKPVSPIVPLNLGLGGVLAIALGVGAALMLEAADNSLKTIEEVKRLLDYPLLGTIPLA
EKPKGVDGEGSAELPVLHNPYSPESAAFEMLQTNLGFSISDKTLKVIVLSSSIPGEGKSFVAANLAVAAAQTGRRVLLVD
ADMRRPRQHKVWEQSNLIGLSNILVNQAELATTTKEALMTLDLVTAGTIPPNAAALLESKRMVSLIQEATSNYDFVIIDA
PPLTAVADAQILGKLVDGILLVVRPGVVDSAAASATKTLLVQSGQRVLGMVVNGITAGSSYGGYYSKGYYHQNGHSKNGK
VDVQTLKIRT
>gnl|bykdb|A0A1Z4GIX0 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Anabaenopsis circularis NIES-21] (length=740 residues).
MSKNSMESRETIDLDINRYLLVLRRRWILILSILAASVGLSVAATTLLKASYEAEAKLLFRMPSFNVVGTNLLPSNNEGE
ETGDLRSLVSTQNPINTQIEVISSPPLLQRTIDKLQLKNDKGEPLKVEELQKNLTLKIVGGTDVLRIAYKSTNPEEASAV
VNTIIDAYLENDILTSRSEAEATRKFMAKQLPNTQAAVHKAEVALRIFRQKNNIADLTEETRSGVGIIGNLDNEINTVNS
QLAEVTAQSNELRQKINLNSQQAIAVSTLSQSPAVQGVLTQLQEVERQLANERSRFLDDNPIIVSLEARKANLTALLQQQ
VGQTLGTQAQVPQRLLQIGELRQTLIQNFLQLEVQRFGLTNRLASLYNSRSAYERRMKVIPQLAQTQRELERKVDVAEST
YQTVLKKVQELQVAENKTTPNARVVAQATVPEKPESGKKLIFIALGLTFGAFLSTSAVLFLEMRDKSLKTLKEIREVFGY
TLLGGIPLSTNKMRSRESDGELASPEIAVRDMPHSLTSEMYRMIQANLKFLSSDKVLKTVVVTSAVPKEGKSTVSANLAA
AIAQLGRKVLLIDADMRVPSQHHLWQLTNAAGLSEVLVGQAEFPTAVSQVMDNLDVLTAGVRPPNPLALLDSKRMASLID
NFSTKYDFIIIDAPPLLLAADALTLNQMSDGILLVVRPGVIESSSALTAQEMLQRSSHNVLGLVVNGISEQSESNSYLYQ
AHEYFNPHEVNKKVVLKKQI
>gnl|bykdb|A0A1Z4GT50 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Calothrix sp. NIES-2100] (length=733 residues).
MESRESIDLDLSRYLLMLKRQWLPANSIFAATVAMSALATTYMKPSYEAQGKLLFKTPSFKVIGSNLLPNNSEGEEADLK
PLVSTQNPISTQIEVITSPPLLQRTIDQLHLKNNNGEVLAVEELAEALELKIVGGTDVLQLNYKSRNPEEAAAVVNTIMK
MYVENDITTSRAEAEDTREFMSKQLPKMQAAVREAEVALRKFKEKHNIVDLSEEAKSGVAIIGNLNNEIHTIQAQLDEVN
AQSNELRQKVNLNSPEAITVMAISQSPAIQGILAQLQDLERQLATERSRFYDDNPVITNLEAKKTTLQTLLQKQIEQIVG
NQVKIPQGQLQIGELKQNLIKDFLQSEVQRNGLTKKLASLYNSRSAYEQRLKIIPLLVQNQRELEQKLEVAQSTYQTLLK
KVQELQVAANKNTANARIIAQASVPEEAVLGKKPIVLSLGVLLGLFLSTSAVAALETRDRSLKTLKEVKEIFGYTLLGML
PLSTKKGRSRNRDAESITPEVPVRDTPNSLTSEIYRMIQANLRFLSSDKVVKTIVITSAVPKEGKSTVSANLAAAIAQLG
RRVLLIDADMRVPSQHHIWQLTNAAGLSEVLVAQAEFKQAACKVMDNLDVLTAGVRPPNPLALLDSKRMASLIEKFSNQY
DFVIIDAPPLLLAADALTLSHMTDGILLVARPGVIDSSSANAAKEMLERSSHNVLGLLVNGTVEKNEPSGDFYHAKEYFS
NEGVAKKSPIKTL
>gnl|bykdb|A0A1Z4H6Z8 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Calothrix sp. NIES-2100] (length=759 residues).
MNVIGAIILFVGTEGSDSPNYIWYFGTLFMPTKQDDRDLIDFQEYWPILKRRWPVTAVVIGSVFGMTALVTFLQKPVYES
QAKLLFNKQSGASSLSGLSSQVGELSGLTNLSNPVDTEAEVIRSNPIIQKTITSLNLKDKSGKPLTIEKFLKLLKLKTIR
GTDVMQLSYRSTNAQEAATVINSLMNYYLESNVRTNRAEARSAREFLNRQLPEVEKRVLKAEMALRRFKEKNRVVALEVE
AKVGVEGLKDLAEEITTAQGELVAAKTRSVALQSQMELNPHQAVELSTLSQSPGIQQVLKEYQKAEDEVAVARTRLTDDN
PTLINLEQKQAALRNQLEGRVAQTIGSSESVPEQNLQIGELKQTLSEDLVKSEVEGLALQNRVAELRKAFIINKSRLDIL
PRLEQQQLQLQRQLQVARVTYEQLVKQLQEVEMIENQNVGNARVISDALVPDKAVSPIIPLNVALGGFLGILLGVGAALM
LEATDNSLKTIEEVKRLLGYPLLGTIPLAEKPKGSNSEAGSELPVLNNPYSPESTAFEMLQVNLGFSISDKTLKVIVVSS
SIPSEGKSFVAANLAVAAAQTGRRVLLVDADMRRPRQHKIWEQSNLIGLSNILVNQAELPTTTKEALMTLDLVTAGTIPP
NAAALLESKRMAALIQEATNEYDFVIIDAPPLTAVADAQILGKLVDGILLVVRPGVANSAAANATKTLLAQSGQRVLGIV
VNGITSKSSYGGYYSKGYYHQNGHSKNGKVDVQTLKIRN
>gnl|bykdb|A0A1Z4HPW5 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nostoc carneum NIES-2107] (length=735 residues).
MESRESIDFDFGRYLSIVKRQWIPAASIFASTVALSVVATTLLKPSYEAEGKLLFKTPSFNVVGTELLPTETQARGDLRP
LVSTQNPITTQIEVITSPLLLQKTIDELQLKNNQGQLLTPEALKKALNLKIIGGADVLQISYKSPNPQEAAAVVNNVMNL
YLENDILTNRAEAEATRKFMAKQLPNNRSAVQDAEAALRIFKQKYNIVDLAEETRSAVAIIGNLDNNINGVRADLDQATA
QTNELRQKVNLNSQEALSASAVSQSPAVQGILTQLQDIDRQLASERSRFLDDNPVIINLEQRKANLQALLKKEIGQTDAG
PVNYQPKTLQIGETKQNLIREFLQSDVQRRGLEQKLTSLYNSRSVYEQRVRIIPQLEQQQRDLERRLEVAQSTYQTLLKK
VQELQLAENNNTPNARIIAKGSAPKKPTLGLKPFILVLGVLLGAFLATTAVIFLETRDRSLKTLKEIREIFGYTLLGIVP
SSTKKIRSRYRETEIATQEIAVIDSPSSLTSEIYRMIQANLRFLSSDKVLKTIVVSSAVPKEGKSTVSANLAAAIAQLGR
KVLLIDADMRVPTQHHLWQITNTAGLSEVLVGEADFKTAASNVIENLDVLTAGVRPPNPLALLDSKRMATLIQEFSNQYD
FVIIDAPPLLLAADAVTLSHMTDGILLVARPGVIDSNSANNAKELLQRSGQNVLGLLVNGINEKNESSTDFYHAKEYFSA
ETSASNSIIKTSSNY
>gnl|bykdb|A0A1Z4HVE1 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nostoc carneum NIES-2107] (length=730 residues).
MPTKQEEREVIDVQQYWTVLKRRWPVTTVVIGSVFGLTCLFTFLQKPVYESQAKLLFNKQNGVSSLTGLSSQVGELSGLT
NLSNPVDTEAEVIRSNPIVLKTITSLNLKDKSGKPLTIEKFLKLLKLKTIRGTDVMQLSYRSTNPQEAASVINSLMNYYL
ESNVRTNRAEARSAREFLNRQLPEVEKRVLKAEMALRRFKEKNRVVALDVEAKVGVEGLKDLLEEITKAQANLVDANTRT
QALQNQIALNTQQAVELSTLSQSPGVQQVLTDYQKTQDELAVARTRFSDEHPLVINLDKKATALRSQLEGRVSKIVGTSE
SVPEQNLQIGQLKQILSQDLVKAEVERLALAKRVAELRQAYLINQRRLDILPRLEQQQLQLQRQLQVARVTYEQLLKQLQ
EVEVIENQNIGNARVISQALVPDKAISPIIPLNLALGGFMGIMLGLGTALILEAMDNSLKTIEEVKRLLGYPLLGTIPLA
EKVKDSDGEEGAELPVLNNPYSAESAAFEMLQANLGFSISDKTLKVIALSSSIPGEGKSFVAANLAVAAAQTGRRVLLVD
ADMRRPRQHKIWEQSNLIGLSNILVNQAELQTTTKEALMTLDLITAGTIPPNAAALLESKRMAALIQEATSNYDFVIIDA
PPLTAVADAQILGKLVDGILLVVRPGVVDSAAAAATQTLLRQSGQRVLGMVVNGVTAGSSYGGYYSKGYYHQNGHSQNGK
VDVKTLKIRM
>gnl|bykdb|A0A1Z4I7C5 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nostoc sp. NIES-2111] (length=726 residues).
MGKGISTLLAVLGRRGFPAITVFAAVIGTSFAYLQVTPRLYESSARLMLEDKKASVSELGRDLTQINSSSVGRNPLADQA
EFLKSQPVLQLAISKLNRQQGNSTQKKLSPSDIKSNLKVVIVPATNILELRYQSPNPEQTAQVLNAVSQAMVEENIKTIN
SEATKVREFLSQKVPQARQRLQQAELAETRYRQQSGVVAADDQTKSLVGSLADLENQERTLAAQLQEARSRDASLRQVTD
AKNITAAYASVREGQDEQLKALRTKLTDIETKLIEARTKFKEAHPTVVDLVQQRDEIKALYGQQMARVSSSNQTANFQDL
ANDQISQNLISELITNDITRLAVENRLNAIRQMRADIQRRLALIPIRQQPLTVLTRQREEAAESLKFLQSKLEEAQIAEA
QKVSNIRILETAVVPELPSSPKRNVILVMATFFGSVLAVGLVLLLELMDNTLRDASEAEELLQLPLLGVVPRLPATKLSL
EPAEQFLDDLGLVEPYRMLLKNLEFRSIDNLQVIVVSSPLSGEGKSVIVSHLAAVCAMLSRRTLIIDADLRKPSQHTLFN
LPPKPGITDVIDGKRPLLNAVQSTAVDNLSVLTCGELRGRPSQILESPAMKSLVAQAAEYYDIVIIDTPPLSACADAASL
SQMSDGVILATRPGFTLKEVLQRAVSELNQNRIPILGVVVNGMTTGTEKYYRYPSEEYPSRLPKPWRRLTALGSSRRNST
DNSRSN
>gnl|bykdb|A0A1Z4IBC7 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nostoc sp. NIES-2111] (length=734 residues).
MTMESLRSIEEVDIHKYIEVLQRRWLAVVGVFGLSLALGCLYAFSLKPSYKADGSLMIMTNRTFSLTGLPQDIGKLEPLN
VNDNPLETQVRIIGSNPVLERTINTLNLKEANGKKLSIRIFAQQLKIEGIKGTDVVQISYKSNNAEQAAKVVNTVIKSYI
DLNIQANQDEAVTAKQVILREIPKAEESVKKAESELRIFKEINKIVALEQEATVAVDTVSKLSNQISQAQAQLNDVKGRL
EQLRAQAQVNSQQGVIASELSQAPGVQKVLAELQETQSKLAIERTRFEPEHPAITALEEKVAVLEKLLKERTGEVAGNAP
VTQGSLQVGQLRQSLIADITRAEAQRVGLERQITTLIQQRDAYIKRANYLPKLEQNQRELERRLQAAQGTYETLLKKRQE
IDIAQNQKIPNARVISYALVPDFPEGPRKILFVIGGGAVGIFLGIIAAFSIDLIDRSVKTVKEAKEVLRYTVLGVIPTLG
RNSKDESPIPGLDRPVPKIIGRDIPYFPLGDAYQILQVNLKFLCSDKPLKSIVVTSSVPKEGKSEVSANLAVTMAQAGRR
VLLVDADMRHPIQHHIWELSNEIGLSNVLIGQVTLEDAVQEVMPNLEVLPCGILPPNPVAMLDSQRMATLMSNFARDYDF
IIFDTPPLTGIADAAVLSTLTDGILLVVRPGVVDFDSANAAKEFLTQSGQKVLGIVINGVNIKNEPNGYIYSYKEPQLES
KSLSGSLMKLSKRR
>gnl|bykdb|A0A1Z4IYV4 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Scytonema sp. HK-05] (length=742 residues).
METKGYQEEVDIQKYWLVLKRRWPIVAGVVLASVGLSSFAVFLQKPKYQASGMLLFQSDRTSSLTKVGEKIGDLESLMRE
GNPLETQSVILTSQPILEEVIKTLELKDKKGNTLDPESLKIKVEPIVGTDVLQVSYTSENPELAASVVNQLMKSYVANNI
QSNRSQVFAAGEFIKKQLPYARAELDRSAEALRQFKIQYKIIELPEEASAAVKNLGQIDQEINQARAALADVSAQEAKMN
SQLNLAGDQAVEVTSISQIPGVQEVLSELQKVQTKLANEKARYTSEHPDIAELKNQEVTLNALLQQRIEQVLGTKGIKQV
LGTQKNVPPGKLQVGKIKENLTSEFAKIQAQRQGLESKIQALSNIQASYKQRLAMMPNLEKKQGDLERKLSISKKNYENL
VSTLQEIEVAEKQTVGNAKEIQAAKVPKKPVLSKVVLLLAGGGVFVGLLLGIAAAFFVDLVDRSLKTVKEAETFFGYTLL
GLIPKFESNTTSTPDKLMSEGVSARVIVATSPRSVIHEAYQMLQANLKFISHKKVRTIVVTSSVPGEGKSEVSANLAAVL
AQAGRRVLLVDADMRKPTQHHLWGVINSVGLSNMIVCQAEFPQGVQTVTKHLSVLTAGVVPPNPLALIDSDRMATLIKMF
SDKYDYIVFDTPPLVGTADAAVLGKMADGVLLVVRPGVVDSASATAAKSLLERSDANILGMIANAVNVKHEPGNYFYYSS
PRVGQSVVETEVGTQQWTHKST
>gnl|bykdb|A0A1Z4J2K1 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Scytonema sp. HK-05] (length=728 residues).
MEKGISSVIAVLRRRSLPAIAAFVAVIGGAIAYLAVTPSKYEASARLMQDDKRVSVSELGRDLTQVSSSGPGISPLADQA
ELIKSQRVLEQAVAIAFPEIKGNLQRSPVSTAELSHNLKVKIVPATNILELSYQSKDPQLAAKLLNAISQAMVEDNTKAI
SSEATKVKKFLEEKQVPEADKQLRLAEATENKYRKLSGIVSLEEQTKSLVQSIATVEDQERTLSAQLQEIKARDASLRQI
TDAGNLNKAYSSVRSGQDDEIKKLRAKLSDVENQLIEARLRFTDEHPNVTNLVGERDALRAMYSEQVARVSPKDQTSSAN
NFAGDQLSQELNSKFILNSIEESAVNNRLKLLQVKKANLQARLSQLPITQQTLTVLTRKREEAAASLKFLQSKLEEARLT
EAQKVSNIRVIENAVAPSSPSEPKPKVILALASVFGSMLAVGVVLLLEMMDNTLRDASEAEELLQLPLLGVLPRLPAKTL
VLEPANRFLDNIGLVEPYRTLFKTLEFRSPEQVRLIVVSSPISGEGKSVVASHLAAVAAMLSWRTLIIDADLRRPVQHTL
FNLTPKPGITNVLEGNVSLLDAVQPTDIENLDVLTCGELYGRPSQLLESIAMKSLVAEAAENYDLVIIDTPPLSACADAS
TLAQQSDGVMLVTRPGFTEKEILSRSVSELTRNRIPILGVVVNGMTNQTEKYFRYPIHGYQPRLPKSQKRLIGVGGSGKN
SANRSRQR
>gnl|bykdb|A0A1Z4J9W0 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Leptolyngbya boryana NIES-2135] (length=738 residues).
MAQSNITLFNASPHAQEPDPGYGQLFGVLLRRKLWFLGALAGTLALAAGVTAVLPPTYRSTMQLMVESNYRERRSPNDTR
PSFADPNVETDAATQVNLMRSGQLLQRAVDQLKPRYSDIDVDRLRKRLNIAQVQELRGNERVTTNLVEVTYIDHDRIKTR
EVLKALEKVYQDYNLEQQRNRLTKGLSFIDRQIPEVQAKVNQAESNLERFRSTSNLVDPEVQAKSLVDSLKELQQNQQEN
RGLLASSRAKFIALQQQLQRSPGQATVAARLSQSKQYQALLAEIQKTEVELAQMQTKFTSNTPQVQQLAEQRQRQVSLLQ
QEAQRILGSEAGAASSESLFATGQLGENDLKFASDLTDAQVEFFGARARDQELARTEQQLRGQLQRFPSLLAEYNRLQPL
VTLNRDTLDELQKARQDLSLEIARGGFDWQMVEQPKLGRQVGPSWMRNLLIGAAGGLMLGCVAAFLRESADKSIRTSEDL
TKEASIPLIGMVPELPMSELMPTTPNFAFSRNAFEENSSMLQVLHWAPFRESLDLIYKNLQLMTDGDPLKSLVVTSALAG
EGKSTVALGLAISAARLHQRVLLIDADLRRPGLHKQLQLPNDHGLSTLLTSDRAITQGAIQPASTYSDLPISVLTAGSSP
SDSVKLLSSKRMRDLMTLFEQHYDLVILDAPPVLGIVDALLASSCSDGVLLVGRMGHVQKSEIAQAVGMLNRLNLVGVVA
NCAESGNSYYYRSSTASV
>gnl|bykdb|A0A1Z4JCS8 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Leptolyngbya boryana NIES-2135] (length=682 residues).
MKKIALIASRHWKALLGLNAVVIFGTLGAMLTTPKVWTAQAQLILPSSNGGNLDANLGTLGSYRNSDPSFSPQVNPLKIQ
EAILTSDAILEKAWAADPERDAANKPRNYGQFFEVTSLEQTSVMLLSVTGSSPDIAKQRAEAILNAYRQRLSELRQANNN
TRDGFSQKQLEQAQRRLTEAQTALAQFKQSTGLVNNEEQTKGLVGTINTLEAAQAQVQAESQATRDRANTLATRLNLSPT
DAVQALGLDQNEDYKELRSKLTEVESTLGKLRSTFTDRSPQVQRAIVERDTLRNQLQQYVGQAAGRISANTDFTTGAEGR
NTLIEQLVLAETNANGQQRQAEQLQQQIDQRQKILNQLPANQAKLNALQRQADVAEGVYKGLVAQTQQSNIDAFNAYPNI
QELNAPFVDAKPSSPKKSLIAINALLASVIGSIALILLLEARNPLLTPKDLQALKFSLVARIPKLKRLAIEPNSSFEGEI
EFQRVASAISLQPLKGIRLLIASAITGEGKTTVALQLAHALTELGFRVLLVDGDFRKAQLSHQLGYLSDRSVGDQVISLQ
PNLDFVPTMPQTGKIVDLVKRGRFERYLAVAESQKDYDYVLVDSAPVSSTSETALMAAIVPYVLFVVRPGISARNVVNNS
LEQLTQHHAKLLGLVINGVEVQGHAYSYHSNHDDPRPYRLSN
>gnl|bykdb|A0A1Z4JK72 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Leptolyngbya boryana NIES-2135] (length=739 residues).
MTSMKMETKQYSEDFDLQNYWLILKRRWLTAATVLAATVGLVGLATSMQRPSFEANGRLLVQSNRTTSLTGVGEKVGTLE
SLKREGNPLDTQAVVVTSYPILQRVIDTLQLKNSKGRPMDPEELSKQLKVEAVPTTDILNLKYSDNDAEMAANVVNQIMK
AYIDNNLKTNQEEANKAGRFIESQLPRAEAELQKASEELRLFRTQNQIVDLERESAANINSLSLLQDQLNQARSQLADVA
RQEQVVRDQLGLETGQAIDLASLSQSPGVQEALSQLQQVQTRLVTEQARFKSTTPQIQTLQQQEQDLNALLQSRVSEAVG
ASVQVAPGALQVGDIKRKLAESLATLQSQKLGLEGRVGTLAGLQSSFRSRMAATPTLVKQQSELERKQDLAQKAYENLTS
RLQEIQVARNQQVGNARVLQNALVPTQPTGRMRLILLAAGTMIGLLLGVAAAFFRDMMDKSLKTVKEAEAQYGYTMLGLV
PKFETSDTPTIVSPSADDISPRVIAMTSPRSMIHEAYQMLQANLKFMSLDKKVKTIVISSAVPREGKSEVAANLAATMAQ
SGRKVLLVDADMRNPSQHHLWGIVNSVGLSNVVVDQSELRQAVKPITNNLSILTAGVMPPNPLAILDSEAMTTLLETIAK
DYDYVLFDTPPLAGTADAAVLGKMADGVLITVRPGVADAGSISAAKSLLDRSEPNILGLVANGVNVRYEPDSYFYYTSPR
EQVSERGEGARSVRSLLTK
>gnl|bykdb|A0A1Z4JVB4 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Calothrix brevissima NIES-22] (length=731 residues).
MPTKQEDRDSIDFQQYWLILKRRWLLTSFVTGSVFGLAALLTFLQKPAYESPAKLIFNKQNGISSFSDIAAKAGELRGLT
SFSNPVDTEAEVIRSYPIIQKTITTLKLKDKKGQPLSIEDFLKNLKLKTIRGTDVMQISYRSKNPQESADVVNFLMKSYI
ESNISNNRTEARSLREFLSKQLPEVENRVLRAEMALRRFKEKNRVVALDEEAKVGVEGLNQLSQEIISTQGQLVAAKTWS
VGLQDQMALSTKQAVELTTLSQSPGIQSVLKEYQKAEDDLAVAKTRYTNDNPTIINLEQKAQALRSQLEGRVSQTIGTSA
DVPEQNLQIGDLKQNLSQDLVKAEVERLALANRVMELQRAYLLNKRRLDILPALEQQQLQLERQLKVARITYEQVSKQLQ
ESEIIENQKVGNARVLSEALVPDKPISPIIAINLALGGALGILLGIGVAILLEAMDSSLKTVEQAQDLLDYPLLGIIPKV
ETAKGNHDERTAALPVLHNPYSPAAVAFEMFQTNLGFSICEQKLKVIVVSSAVPGEGKSFIAANLATATAQLGKKVLLLD
ADMRRSRQHKIWQQSHLMGLSNILVGQADLQSTSKEVLINLDLLTSGIIPPNPVALLNSPRIAALLHQASNDYDFVIIDA
PPLSAVADAQILGKLADGILLVVRPGLVDSTAANATRKLLAQSSQRVLGIVVNGVTANNSYHESYFKENHSQNGHSKNGK
VDAKMPNIQIP
>gnl|bykdb|A0A1Z4JYE7 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Calothrix brevissima NIES-22] (length=737 residues).
MESRESIDLDLKIYLYLLRRRWISVTSIFLGTVSLSILATTLLKPAYESSGKLWFRIPSFKTIGTNLLPNNNEGDAAGDL
KSLVSTQNPISTQVEVISSPPLLEKVINKLELTNEKGEPLTVEELQEKLTLKIIGGTDVLEITYQSNDPKQAAAVVNALM
NVYVDNDISTNREEAEATRKFMERQLPQTQAAVNYAEAVLRKFREQNNIVDLAEETKTSVGVITGIDNEINAVKAQLADL
VAQRNQLSQQLGLTTQQAIAVTTLSQSPAVQGILSQLQELERQLANERSRFTDDNPIIVSLEAKKDNLNNLLQLQIAKTV
GLGQKLQFSPTLLQIGEVRQNLINNFLQLELQSTGLNQKLNSLLNTRSAHEKRMQILPKLAQQQRQLERKVEVAESTYQT
LLKKVQELQVAENANTANARIIARGSVPEEPLAAKKMLVLVIGAMFGLFLATSTILLLEIKDKSLKTLDKVKEAFNGYTL
LGIIPLLPQKTISRKREGEYQIPRIAVRDTPDSLTSEIYRMIQANLKFLSSDKLLKTIVVTSAVAKEGKSTVSANLAAAI
AQLGRRVLLIDADMRVSSQHYIWGITSTAGLSEVLVGHLDVRFAVKKVMDNLDILTAGVRPPNSLALLDSKRMASLIKEL
SSQYDYVIIDAPPALLAADALTLSKMSDGILLVARPGVIDHNSALAAREMLKKANHNVLGLVINGVNEQNEPSNYFYHAS
EYYGSASSQAVLDKSLK
>gnl|bykdb|A0A1Z4KHN9 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Trichormus variabilis NIES-23] (length=736 residues).
MPSQQDDQDLINFQQYWLIVKRRWLLIAAIIGSVFGVTGLVTFSQKPIYEADGKLLFNKQSGVSSLTGVSEQLGQLSGVT
NLSNPLETEAEIIRSNPIIQKTIAESQLKDEQGQPLEIDDFLRNLKIKSVRGTDILQLSYRSADPKEATAIVNKLMSAYL
ENNVRNNRSEATAAREFLSKQLPLVEAKVTEAEAALRRFKEKYEVVSLQEEAIQGVKRLNELSGQVTLLRAQLVDARTRS
GALQNQLELNTKQAMALSSLSQSNAVQQVLSEYQKVQDQLAVERSRFTEEHPVIANLLNKEQALKAQLEGRVSKTLGSSQ
PIPEQDLQIGELKQALTANLVQVEVERLGLENQVGVLMKAFVLYQARLRVLPKLEQQQLQLQRQLQIAQTTYEQMLKRLQ
DVEVVENQNVGNARIVSEALLPKTPVSPRILLNLALGGFLGFFLAIGAALLLEAGDKSVRTLEEAQQLLDYPLLGTIPVF
DQKVRLARGESITELPVLNNPYSSVNAAFEMLQINLGFTFSDKKLKVIVVSSCVMNEGKSFIAANLAVATAQMGRRVLLI
DADMRRPRQHEMWQQPNLMGLSNVLVGQATLAEAAKEVVINLELLTSGTIPPNPAALLDSQRMNALLQQAAKDYDCVIID
TPPLSVLADASIVSKMADGMLLVVRPGVVNSAAAKTTKTLIEHSRVPVLGMVVNCVATDSNDYSYYYSHKNTGESNSSKK
DRIKSNLSKITGLRLL
>gnl|bykdb|A0A1Z4KIC7 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Trichormus variabilis NIES-23] (length=727 residues).
MGKGISTLLGVLGRRGFPAVTVFAAVIGASFAYLAVTPRLYETSARLMLDDKKASVSELGRDLTQITPTGVGRNPLADQA
ELLKSQTVLQLAISKLNPPIKDSSTQKPLTPSDIRSNLKVIIVPATNILDLRYQSPEPNQAAQVLNAVSQAMVEENIKTI
SSEATKVREFLAEKVPIARQRLLQAELAETKYRQQSGVVATDDQTRSLVGSLAELENQERTLAVQLQETRSRDASLRQVT
DAKNINTAYASVREGQDEQLKVLRTKLTDIETKLIEARTKYQEAHPTVLDLVEQRNEIRALYGQQMARVSSSGQTDNFQD
LANDQISQTLISDLITNDITRLAVENKLNAIQKMRANIQSRLALIPIQQQPLTVLTRQREEAAESLKFLQSKLEEAQIAE
AQKVSNIRIIETAVAPELPTSPKRTVVLVIAGFFGSILAVGLVLLLELMDNTLRDATEAEELLQLPLLGVLPRLPATKLS
LEPAEQFLDDLGLVEPYRMLLKNLEFRNVDNLQVIVVSSPLSGEGKSVIVSHLAAVAAMLSRRTLIIDADLRKPSQHTLF
NLPPRPGITDVIDGTRPLLSAVQSTTIENLSVLTCGELRGRPSQILESAAMKSLVAEAAQRYDLVIIDTPPLSACADAST
LSQMSDGVILTTRPGFTLKEVLQRAVSELNQNRIPVLGVVVNGMATDIEKYYRYPSEEYPSILSRPLRRLTSLGSSARNS
SNDSRSN
>gnl|bykdb|A0A1Z4KM73 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Trichormus variabilis NIES-23] (length=734 residues).
MTMDSLQGFEEVDIHKYVEVLQRRWLAVVGIFGLSLTLGCVYAFSQKPSYKAEGSVMIKTNRTSSLTGLPQDIGRLEPLN
VNDNPLETQVRIIGSNPVLQQTIKALNLKDQNGKPLSIRIFAKQLKIEGIKGTDVVQLSYKSNDPALAAKVVNKVIDNYI
ALNIKANQDEALTAKQVLIAEIPKAETSVKKAESELRIFKEINKIIALEQEATVAVDTVSKLSNRISEAQAQLNDVKGRL
EQLRTQAQVDSQQGVIASELSQAPGVQKVLAELQEAESKLAVERTRFEAEHPAITSLEEKIVVLKNLLKDRTGQVAGTAQ
VTQGSLQVGQLKQSLIADITRAESQRVGLERQISTLLQQREAYIKRANYLPKLEQNQRELERKLQAAQGTYETLLKKRQE
IDIAQNQKIPNARVISYALIPDFPEGPRKILFIIGGGVAGIFLGIIAAFSIDLIDRSVKTVKEAKEVLRYTVLGVIPTLG
RNGKDDTPIPGLDRAVPKIIGRDIPYFPLGDAYQILQVNLKFLCSDKPLKSIVVTSSVPKEGKSEVSANLAVTMAQAGRR
VLLVDADMRHPIQHHIWDLSNAIGLTNVLIGQVTLDEAVQEVMPNLEVLPCGILPPNPVAMLDSQRMATLMSNFARDYDF
IIFDTPPLTGIADAAVLSTLTDGILLVVRPGVVDFNSANAAKEFLTQSGQKVLGIVINGVNIKNEPNGYIYSSKYRQLEP
DSLSSSLSKLSRKS
>gnl|bykdb|A0A1Z4L5A1 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nostoc linckia NIES-25] (length=737 residues).
MESRETIDLDLNRYLLMLKRWWIPAATIFLATVMLSAVATRFMKPSYEAEGKLLFRIPSFKVVGSNLLPTTTEGGSTGDL
KSLIASQNPINTQIEVISSPALLQKTIDKLQLKDKEGQPLTVKALQKSLVLKIIGGTDVLRITYSSLDPEEAASVVNTVM
NVYVESDILTSRSEAASTRQFIARQLPKTQEAVDKAERELRIFRQKNRIADLTEETKSAVSIIGNLNTEINTVQAQLDEV
NAQTNELRQKVNLSSQNAIAVSALSQSPAVQGILTQLQDIERQLASERSRFQDDNPAIINLEAKKANLRALLQQQISQTV
GSNAQVPQNLLQIGELRQNLIRDFLQSEVQRFGLSQRLASLYNSRSNYQKRVQVIPQLIQNQRELERKLEVAESTYQTLL
KKVQELQLVENTNTASSRIIAQALVPADPVAGKKLIVLLLGVMFGLFLATTTVLFLGMRDRSLKTLKEVRDVFGYTLLGI
VPLSVKKVRSRFSSAESITQKVAVRDMPHSLTSEMYRMIQANLKFLSSDKVLKTIVVTSAVPKEGKSTVSANLAAAIAQL
GRKVLLIDADMRVPSQHHLWQLTNAVGLSEVLVGQAEFNIAVSKVMDNLDVLTAGVRPPNPLALLDSKRMASLIDNVSSQ
SNYDFVIIDAPPLLLAADALSLSQMTDGILLVSRPGVIDSNSANAAQEILERSNYNVLGLVVNGIIDKNESSTYLYHGHE
YFQPRELTKEFKGLAKK
>gnl|bykdb|A0A1Z4LJ30 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Calothrix parasitica NIES-267] (length=674 residues).
MNRIAKIAIRHWKLLLAWNILILGITAINIKVAPRVWSSQAQLILPNVTNDSDADLGKLGSVRDGGVVFSQQINPLNILS
SVAMSDRVIQEVWQNDPEKADFSRLNNFKKLFEVSPEKESTVISVSVEGSSPELAQQRANGLIKAFRDRLQELRKDEAQQ
RSQFMQDEVKQAYQKLFKTQKNLSEFKQKTNLVSSEEQTKEIVSTINALETEQAQTIAQAQEFQSRAKMLSARIEMSPST
AVNSVKLKENKEYQLFRDKLSEVEVALVEARGKLTNSHPQIQELVYQQRVLRSQLRQYLANTSSVAGVDTSVGQNTAALA
EQMILAESQAFGMLKKAEQLQPTIDNLIKTLNGLPQKQATLLELQRQYDIAEGVYNGVVAQAEQAKLGSFSAYPSVQVLD
QPIMDTKPVGPKLRLMLLGALLACGFGSAAIILFSENRDPLLSPKDIVQTNIPVLANIPYIKNIHGKLEQKLGGEIEFQR
LASAVSLMQLGSGRLMIASATTSEGKTTATLGLANALINLGFKVLVVDGDFRKSELSQSLGYQSQTILDSRFIHKKIRPN
LDLLSVNIAEDKISEFVARGEFEQHLNFVQTNDNYDYVLVDSSPVTLTPEAALLAKVIINVLFVVRSTTSHRNYFCDSIE
QLTRHKAEIAGLVVNGVETRGQAYMYGQNIAQVE
>gnl|bykdb|A0A1Z4LN32 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Calothrix parasitica NIES-267] (length=737 residues).
MENQNLSEEIDVQKYLLVLKRRWLIASVVFAGFASFGVLHWVSQKPAYQATGKLLFRTDRTSSLTGAGEEIGHLESIKRE
ANPLDTQAIILQSEPIIKDVVKSLELKGNNGKPLDPNSISIGTGSIVGTDILRVSYTSGKPELAIKVVDKVMEAYIKKNI
YTNRSEAIAARSFIEKQLPSAKRGLSKVTEELRDFKQKNKVIELKEETTKAVQIIHEIDKELTEARSELADVGGQEKEVS
SQLNLPLNKAVDISSLSQVKGVQEVLSELQKVQTELTTLKTRMTNAHPSILDLQDKEAALNNLLQTRIMESVGYRTQIAP
SSLQIGRVKQELISRFVNLRSQRLGLTQKIDSLSDLKNRYKQRADVIPDLEKRQKELEQKLSIAQKNYENLETRLQEIKV
AESQTVGNASIVESAKVSPSPQVQKQKFIVTFGSIFVGLVLSIGSAYFVDLIDRRLKTAKEAEKLFGYTLLGLIPKFDTN
NAKSNHNIPVGKDKIAGVSERVIVATSPRTVIHEAYQMLQANLKFISLDRKIRSIAVTSSVAGEGKTEVAANLAAVMAQV
GRRVLLVDADMRQPSQHHLWGLINSIGLSNVMVGEHDLEDAVQKVTENLSVLTSGVMPPNPLALIDSERMTSFIEMLSLN
YDYIVFDTPPLTGNAESAVLSQMVDGALVIVRPKLVNSATATAAKSLLERSETNVLGIVANSVNVKHEPNNYFYYSSYES
ESGVETIDNSQSAVRSS
>gnl|bykdb|A0A1Z4LP32 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Calothrix parasitica NIES-267] (length=731 residues).
MQNKKNNQEVDIQQYWLIIKRRWLFIVAAMLGSIGLSWFVILQQKPQYQANGLLLFKSDRISSLTKAGEKIGDLESLMRE
GNPLETQAVVIQSEPILQEVIDTLNLKDDDGKPLEPESLPMEVEALVGTDVINVSYTSEKPRLAAAIVNQVMRTYVKNNI
ESNRAQVVAAGQFLKQQVPLSRLELENATEALLQFKNQNQVIQLAEEATAAIQNISKLDDEINQARALLADVSAQESRVA
SKLDFSTNEAVEITSLNQISGVQEVLTELQKVQTELAAERANYTQIHPLIRKLESQESALNALLQQRKSEASGRQQNISN
SRLQIGDIKQNLVNQLVQLQTQKDGLQNKLATLNNIKNDYQRKLAILPNLEKRQQDLERRLSVAQTDYENLITRQQEIEL
AEKQTIGNSRIIQSARIPNKTVLSKMTIMLAGGGVFVGLLLGIAAAFTVDLIDRSLKTIKEIEEFFGYTLIGLIPKFEPN
SKSLDSNFIDDNISPRIIVASSPRTMIHEAYQMLQANLKFISHKEVRTIVVTSSVVGEGKSEVSANLAAILAQSGKRVLL
VDADMRQPNQHHLWGLINGGGLSNVIVGQDEFSRCYHQVNKYLSVLSAGVQPPNPSALIDSAAMDSLIQSLLPRYDYIIF
DTPPLAGTPDAAVLGKMVDGVLLVARPRVVDSASATGAKSLLERSEAKILGIITNAVNVKQEPESYFYYSEPRGTKDVTE
TKINSEEWVTK
>gnl|bykdb|A0A1Z4LRU5 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Calothrix parasitica NIES-267] (length=732 residues).
MTNEMQVNQEEQDYIDLGQYWLILKRRWLPALLVTSSIFGLAAFVTFRQKPVYQAEGKLRFDKNNNVSSLSGLGGQIGEL
SGITNLSNPLDTEAEVIQSHPLIKETITKLNLINEEGETLSHEAFLKLLQVKSIRGTDVLQLSYKSTDPKEAANVVNSLM
GDYMENNVETNTAEVRAAREFLQKELPQVEGRVVQAEAALRQFKEQNNVVALEEEAKFGVESLKDLSENITQSQANLVEA
MTRSEALQNQLKLQPQQAVALSSLSQSPAVQQVLTEFQKTQKELAVARTKLTDQHPTVINLSKKLEALKNQLEGKVGQIV
GNGVSVREPDLQIGELKQSLTAELIKSEVERLAATNRVGLLRKAFVSNQARLSVLPKLEQQQRQLQRKLQVAQSTYQQLL
KQLQEVQVVEKQNVGNAKVIASALVPNKPISPKIALNLALGGFLGILLGVGTALILEAMDKSLKTLDEAKKLLGYPLLGT
IPRVDEKDKDRQELPVLNNPYSPASTAFEILQTNLGFTMSDKALKVIVVSSSIPGEGKSFVSSNLAVAMAQLGRRVLLID
ADMRRPTQQNIWDLPNMIGLSNVLVGQAALNGSTEEALVTLDVLTSGKIPPNPLALLESQSMANLVKDASQEYDLVIIDA
PPLTVVADALNIGKLADGMLLVVRPGVANTGSVNAAKSLLEQSGHRVLGMVVNGVTADNSYGGYYSYKGYYGINPGEMNG
KVDAEVTKVEIG
>gnl|bykdb|A0A1Z4M597 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Fremyella diplosiphon NIES-3275] (length=731 residues).
MPTKQEEREVIDVQQYWTVLKRRWPVTTVVIGSVFGLTALVTFLQKPVYESQAKLLFNKQNGVSSLTGLSSQVGELSGLT
NLSNPVDTEAEVIRSNPIVLKTITSLDLKDKSGKPLTIEKFLKLLKLKTIRGTDVMQLSYRSTNPQEAASVINSLMNYYL
ENNVRTNRAEARSAREFLNRQLPEVEKRVLKAEMALRRFKEKNRVVALDVEAKVGVEGLKELAEEITRTQGELTAAKTRS
LALQNQMKLNTDTAVELTTLSQSPGVQQVLTEYQKVQDELAVARTRLTEDNPKIINLENQAVALKNQLEGRVAQTIGNSE
YMPEQNLQIGNLKQTLTENLVKSEVERLALTNQVAELKQVLLVNKNRLDSLPRLEQQQLQLQRQLKVAQVTYEQLSKQLQ
EVEVVENQNVGNARVISEALVADKSVSPIIPLNLALGGILGIILGAGTALVLESIDNSLKTVEEAKRLLDYPLLGAIPQA
EKAKGSEGVGEVELPVLNNPYSPVSSAFEMLQTNLSFSISDKMLKVIAISSSIPGEGKSFVAANLAVAVAQLGRRVLLVD
ADMRRPRQHKIWEQNNLVGLSNILVGQTELQTTSKEALMTLDIITAGTIPPNPAALLNSQRIATFIKEATQEYDFVIIDC
PPLTLVADALMLSKLVDGILLVVRPGVANTGSVNATKMLLEQSGHQVLGMVANGVTPESSYGGYYAKSYYGAKQSHKNGK
VDASISKIRIL
>gnl|bykdb|A0A1Z4MKF8 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Fremyella diplosiphon NIES-3275] (length=737 residues).
MESRESIDFDLSRYLSMVKRQWIPAASIFASTVALSVVATTLLKPSYEAEGKLLFKTPTFNVVGSELLPSESQARGDLRP
LVSTQNPITTQIEVITSPLLLQKTIDELQLKNKEGKPLTPEVLKKALNIKIIGGTDVLLVSYQSPNPQEAAAVVNNVMNL
YLENDILTNRAEAEATRKFMAKQLPNNRSAVQDAEAALRIFKQKYNIVDLAEETRSAVAIIGNLDSNINGVKADFDQATA
QTNELRQKVNLNSQEALSASAVSQSPAVQGILTQLQDIDRQLASERSRFLDDNPVIINLEQRKTNLQALLKQEIGQTGAG
PVNYPPKTLQIGETKQNLIRDFLQSEVQRRGLEQKLTSLYNSRSVYEQRVRIIPQLEQQQRDLERRLEVAQSTYQTLLKK
VQELQLAENNNTPNARIIAKGSVPIKPTLGLKPFILVLGVLLGAFLATTAVIFLETRDRSLKTLKEIREIFGYTLLGIVP
SSTKKIRSRYRETEIATQEIAVIDSPSSLTSEIYRMIQANLRFLSSDKVLKTIVVSSAVPKEGKSTVSANLAAAIAQLGR
KVLLIDADMRVPTQHHLWQITNTAGLSEVLVGEAEFKTAASNVIENLDVLTAGVRPPNPLALLDSKRMATLIQEFSNQYD
FVIIDAPPLLLAADAVTLSHMTDGILLVARPGVIDSNSANNAKELLQRSGQNVLGLLVNGINEKNESSNDFYHAKEYFSA
DTVTTESGAGVRTWSQR
>gnl|bykdb|A0A1Z4MSN1 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Tolypothrix tenuis PCC 7101] (length=737 residues).
MESRESIDFDLSRYLSMVKRQWIPAASIFASTVALSVVATTLLKPSYEAEGKLLFKTPSFNVVGSELLPSESQARGDLRP
LVSTQNPITTQIEVITSPLLLQKTIDELQLKNKEGKPLTTEALKKALSIKIIGGTDVLLVSYQSPNPQEAAAVVNNVMNL
YLENDILTNRAEAEATRKFMAKQLPNNRSAVQDAEAALRIFKQKYNIVDLAEETRSAVAIIGNLDSNINGVKADFDQATA
QTNELRQKVNLNSQEALSASAVSQSPAVQGILTQLQDIDRQLASERSRFLDDNPVIVNLEQRKANLQALLKKEIGQTGAG
PVNYQPKTLQIGETKQNLIRDFLQSDVQRRGLEQKLTSLYNSRSVYEQRVRIIPQLEQQQRDLERRLEVAQSTYQTLLKK
VQELQLAENNNTPNARIIAKGSVPNKPTLGLKPFILVLGVLLGAFLATTAVIFLETRDRSLKTLKEIREIFGYTLLGIVP
SSTKKIRSRYRETEIATQEIAVIDSPTSLTSEIYRMIQANLRFLSSDKVLKTIVVSSAVPKEGKSTVSANLAAAIAQLGR
KVLLIDADMRVPTQHHLWQITNTAGLSEVLVGEAEFKTAASNVIENLDVLTAGVRPPNPLALLDSKRMATLIQEFSNQYD
FVIIDAPPLLLAADAVTLSHMTDGILLVARPGVIDSNSANNAKELLQRSGQNVLGLLVNGINEKNESSNDFYHAKEYFSA
DTVTTESESGVRTWSQR
>gnl|bykdb|A0A1Z4MWT1 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Tolypothrix tenuis PCC 7101] (length=731 residues).
MPTKQEEREVIDVQQYWTVLKRRWPVTTVVIGSVFGLTALVTFLQKPVYESQAKLLFNKQNGVSSLTGLSSQVGELSGLT
NLSNPVDTEAEVIRSNPIVLKTITSLNLKDKSGKPLSIEKFLKLLKLKTIRGTDVMQLSYRSTNPQEAASVINSLMSYYL
ENNVRTNRAEARSAREFLNRQLPEVEKRVLKAEMALRRFKEKNRVVALDVEAKVGVEGLKELAEEITRTQGQLTAAKTRS
LALQNQMKLNTDTAVELTTLSQSPGVQQVLTEYQKVQDELAVARTRLTEDNPKIINLENQEVALRNQLEGRVAQTIGNSE
YTPEQNLQIGNLKQTLTENLVKSEVERLALTNQVAELQQVLIVNKNRLDSLPRLEQQQLQLQRQLKVAQVTYEQLSKQLQ
EVEVVENQNVGNARVISEALVPDKSVSPIIPLNLALGGILGIILGAGTALVLESIDNSLKTVEEAKRLLDYPLLGAIPLA
EKAKGSEAASEQELPVLNNPYSPVSSAFEMLQTNLSFSISDKMLKVIAISSSIPGEGKSFVAANLAVAVAQLGRRVLLVD
ADMRRPRQHKIWEQNNLVGLSNILVGQTELQTTTKEALMTLDIITAGTIPPNPAALLNSQRIATFIKQATQEYDFVIIDC
PPLTLVADALMLSKLVDGILLVIRPGVANTGSVNATKMLLEQSGHQVLGMVANGVTPESSYGGYYAKSYYGAKQSHKNGK
VDASISKIRIS
>gnl|bykdb|A0A1Z4NDS1 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Calothrix sp. NIES-3974] (length=737 residues).
MDSVTSTTNVEEIDLQKYVQVLQRRWLPGLAIFGTCVTLATIYAFSLQPSYKAEGNLLIKTNNTPSLTGLGEAIGKLESL
TRDSNPSDTQVKIITSNQVIQETIQRLGLKDSEGNPLQIKAFRSKLKVDSAKGTDIIQVSYQDNDPELAAKVVNKLMEVY
VQNNIRENRAEASAAGTFLDDQRPNAARIVQAAELELRRFKEENKVINLQEEATASVNAIARLEDQITQVQAKLVDATAR
VKTLQEQANINSQQAITSSSLSQIPGIQKVLSQLQEVQSQLALQQTRFHPEHPSIQDLQARVATLQNLLQQRINQVDGNQ
QIQLDNLQLGDLRQKLMEDYARAEAERSGLARQLVSLQKQWLTYKQRANILPRLEQKQRELERKLKAAQTTYENLLNREQ
EIRIAENQNIGNARIVSYALVPDTPAGPKKILIIAAGAIAGFLCGVITAFALDLIDSSLKTVQEARELFRYTLLGVIPQI
PRNSKRKSEQPERNLPQIVGRDTPQFPFSDAYQMLQANLKFLASDNELKTIVVSSSVSGEGKSEVSANLAVTVAQLGRRV
LLIDADMRCPIQHHIWGLNNTIGLSNVIVNQVNLSLAVEEVIPNLHLLPAGVVPPNPVALLDSQRMAALVASFAQEYDLV
IFDTPPLSGMVDAAVLSKLADGLLLVVRPGVVNWNSASAAREFLTQSEQNVLGMVINGVNVKREPDSYFYYSRESIEYNH
TYRNTSLNSQSSLGQKS
>gnl|bykdb|A0A1Z4NFV0 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Calothrix sp. NIES-3974] (length=723 residues).
MENPSYLEEIDVHRYWLVLKRRWLVVVGILAASTALSGFVLSTQRPQFEAIGQLLFQSNRTSAYTKIGENTGSLESLRHE
SNPLSTQAVVLQSRPILEQVIAKLNLRDRNGKLLDPDLLKIKVEPVMGTDVLKVSHISDNPNLAAAVVNQVMESYVESNI
QSNRAEAQSAGKFIEQQLPRARAELEKSAEELRKFRTQNQIANLPEEAKTTVESIAKLTDELNSTQAELAQVTSQMGQLR
SQMNISSEQAVDISTPGVQDAITELQKLQRQLANERSRYTEFHPKILNLKQEIAQVQGLIQQRVNASSGANFNTTPERLE
VQGLREKLLNEYVQLQAQQAGLASRVQELSNLHRIYRQRTTIIPNLEKRQGDLERRLGVAQKTYEHLLSRLQEIRVAENQ
TVGNARIIQAAAPPPLPAKSKMSLLIGVGGVFAGLSLGIAAAFLIDLVDRSIKSVKEAESVFGYTLLGLIPRFDSSVSSN
RSEELFAGVSPRVIVATTPRSVIHEAYQMLQANLKFISHKKVRTIVITSSVAGEGKSEVAANLATSIAQSGRRVLLVDAD
MRNPSQHHLWGRINPTGLSNILVGQDDMSKAVQTVTGNLSVLTAGVIPPNPLALLDSEAMVAIVKTLSQGYDYVIFDTPP
LQGNADAAILGKMTDGILFVVRPGVVDSARATAAKSLLQRSEANIFGMVANGIRVKYEPDSDFYYASPRGETMVEGKEKV
VIN
>gnl|bykdb|A0A1Z4NPM1 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Calothrix sp. NIES-3974] (length=726 residues).
MASEYEEQDYIDIQQYWLILRRRWLVILLVLGSVFGLAAFYTFTLKPVYEAGGKLMLKQNSSSSLIGLSDKLGELSGLTN
TSNPLDTEAEVIRSTPSVQKTIEKFQLRTPKGKPLSVEDFLKNLKVKSVRGTDVMELSYRSTDPQEAANVINFLMKSYLE
GNILNNRAEATAAKEFLSKQVPQLERRVVVAEADLRRFKDENRVVELTEEAKVGVEAMRNLSAELTRAQAALAEKNTRVQ
TLQNQLELNRQQAVELSTLNQSQGVQQVLAEYQKTQDELAVAKTRLTNDHPTVINLTEKVNALRSQLEQRVGKVIGGGVA
VPERDLQIGQLKQSLTADLVRAEADRLAAEQQVQVLSRALTDYQNRLAALPKLQQRQRALERKLQVAQSTYQQVLKQLQE
VEVAEQQKVGNARIVSPALVPDKPVSPKIMLNLALGGFLGVLLGAGSALLLEALDKTLRDIDEAKRLLGLPVLGTIPQLM
DKKGKKAGDEELPVLNNPYSPASVAFEMLQTNLSFTVSDNELRVILVTSSVPGEGKSFVSANLAVAMSQLGKRVLLIDAD
MRRPRQHKVWQLANITGLSNLLVGQAVLSQVTHEALVTLDLVTTGTTPPNPVTLLESKRMDNLIKDVSSNYDCVIIDTPP
LTAVADALVVGKLVDGLLLVVRPGIVESAAVQASKNLLEQAKVPVLGMVVNGVDEKSGYGGYYYAKGYYGKKEFDGEEKI
AGLKIG
>gnl|bykdb|A0A1Z4PQB9 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Scytonema sp. NIES-4073] (length=739 residues).
MESKPNFEEIDFQKYLLVLQRRWVPAVGVFGVAVTLVSLYAFSLKPTYKAEGSLLIKTNRTSSLTGLGEALGRLESLGVN
NNPSDTQAKIVVSVPVIQETITELDLRDDKGKPLTIQELSKELKIKGDKGTEVLEVSYTDTNPTLAAKVVNKLMQAYIKN
NIGANREEAVSVRKFIQKQLPATERSVKRAEAELRRFKEENKVIALQEEATAAVNEISKLEEQISQAQAQLADVSARSQK
LQNQAKIDSQQGVTFTSLSQTPGIQQVLTQLQEAQSQLAVERTRLQPEHPIIINLEEKVAALNSLLQQRLKQAVGSDRQI
PTLNLQTGELRQKLLEDYARSEAERVGLEKKIITLSSKRSAYKQRANVLPKLEQNQRQLERKIKAAQTTYETLLTRLQEI
QVAENQNVGNARIISPALIPDKPAGSRKILMITGGGVLGILLGVIAAFTLDLIDRSVKTVKEARELFKYTLLGVIPSISS
NSTKSSFLRGVDQPIPRVIGTDIPQFPVGDAYQMLQANLKFLSSDNELKAIVVTSSVPKEGKSEVAANLAVAMAQVGRRV
LLVDADMRHPVQHHVWGMTNAVGLSNVIVDELPIDIAVQEVIPNVYVLPSGVVPPNPVALLDSRRMAALVNTFVSNYDFV
IFDTPPLAGIADAAVLGKLADGILLVVRPGVVDSASANAAKEFLTQSGQQVLGMVINGVNVKREPDSYFYYTKESDESGV
VSRNSVPTRQARSRIMDER
>gnl|bykdb|A0A1Z4PWZ0 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Scytonema sp. NIES-4073] (length=728 residues).
MEKGISSVIGVLRRRSLPAIAAFVAVIGGAMAYLTVTPSKYAASARVMLDDKRVSVSELGRDLTQVSSNAPGISPLADQA
ELVKSQRVLERAIAIAFPEIKGNLSLSPVTTGELSHNLKVTIVPATNILELSYQSEYPKLAARLLNAVAQAMVEDNIKAI
SSEATKVKAFLEKKQVPSAEKQLLQAEEKENKYRKSSGIVSFEEQTKSLVQSIATVEDQERTLSAQLQEIKARDASLRQI
TDSATLNKAYSSVRSGQDDEIKKLRAKLSELENKIIEARLRFTEEHPTVTNLVGERDALRAIYSEQVARVSPQGQTVSAN
NFAGDQLSQELNSKFILNRIEESAVNDRLKLLQTTKTDLQKRLAQLPINQQTLMLLTRKREEAAVSLKFLQSKLEEARLT
EAQKVSNIRVIENAVPASSPSDPKPNVILALASVFGSMLAVGVVLLLEIMDNTLRDASEAEELLQLPLLGVLPRLSAKTL
VLEPANRFLDNIGLVEPYRTLFKTLEFRSSEQLRLIVVSSPISGEGKSVVASHLAAVAAMLSWRTLIIDADLRRPVQHTL
FNLTPKPGITDVLEGNVSLLDAVQPTDIENLDVLTCGELYGRPSQLLESIAMKSLVAEAAENYDLVIIDTAPLCSCADAS
TLARQSDGVMLVTRPGFTEKEVLSRSVSELTQNRIPILGVVVNGMTNQTEKYFRYPVDGYQPRLPKSQKRLIGVGGSAKN
SGNNSRQR
>gnl|bykdb|A0A1Z4Q0T6 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Scytonema sp. NIES-4073] (length=741 residues).
METKGYQEEIDIQKYWLVLKRRWPIVAGVVLASIGLTTFAVFLQKPEYQATGMLLFKSDRTSSLTKVGEKIGDLESLMRE
GNPLETQAVILQSQPILEEVINTLRLKDKKGNTLEPESLKIKVEPIVGTDVLKVSYISENPELAASVVNQLMKSYVANNI
QSNRVQVFAAGEFIKKQLPYARAELDRSAEALRQFKIQYKIIQLPEEASAAVQNLGQIDQEINQARAALADVSAQEAKMN
SQLNLAGDQAVEVTSISQIPGVQEVLGELQKVQTKLANEKARYTSEHPDIAELKNQEVTLNALLQQRIEQVLGTKGIKQV
LGTQQNVPPGKLQVGKIKENLTSEFARIQAQRQGLESKIQALSNIQASYKQRLAMMPNLEKKQGDFERKLSISKKNYENL
VTRLQEIEVAEKQTVGNAKEIQPAKVPKKPVLSKLVLLLVGGGVFVGLLLGVAAAFFVDLVDRSLKTVKEAETFFGYTML
GLIPKFESNSTSAPTKLMSEGVSARVIVATSPRSVIHEAYQMLQANLKFISHKKVRTIVVTSSVAGEGKSEVSANLAAVL
AQAGRRVLLVDADMRKPTQHHLWGVINSVGLSNMIVCQAEFPQGVQTVTQHLSVLTAGVVPPNPLALIDSDRMASLIKIF
SDKYDYIVFDTPPLVGTADAAVLGKMADGVLLVVRPGVVDSASATAAKSLLERSDANILGMIANAVNVKHEPDSYFYYST
SPRVGQSVVETEVGTEQWTHK
>gnl|bykdb|A0A1Z4QL41 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cylindrospermum sp. NIES-4074] (length=730 residues).
MESREAVDLDFGRYLSSVKRHWIPATCIFATTVILSALASTRLKPSYESEGKLLFKVPSFQILGTNLLPNSSEGGGIGDL
KPLVSTQNPISTQIEVISSPPVLQKTIDKLKLKNQKGEPLEVEDLVKDLTLKIIGGTDVLKITYKSNKPEEAAEVVNTIM
NFYIENDISTNRAEAEETRQFLDKQLPKTQTAVQTAEAALRRFKQQNSVVDLSEETKSAVTIIGNLDNEINTIRAQLADF
NAQTDALRQKIGLNSQQAIVVSSLSNSPAIQAILTQLQEIDRQLAVERSRFLDENPVIINLEAKRFNLKNLLQKQIEQTI
GSQTQFTQGFLQIGELRQKLIQDFLQSEVQRIGLAKRLASLYNSRSAYEQRTKIIPRLAQTQSELERTIEVAQSTYGTLL
KKIQALQVAENQNTASARIITEAIIPKKSSGGKKLIVLLLGGTLGVFLASSTIFILEMRDSSLKTVNEVREIFGYTLLGM
MPLLAKKVPFRHQKAQTNTQNIVVRDQPYSLASEMYRMIQANLRLVSSDQVLKSIVVTSAVSKEGKSTVSANLAAVMAQL
GRKVLLIDADLRLPSQHDLWQLNNLAGLSEVLVDEAELNVALCKVMDNLDVLTAGVRPLNPLALLDSKKMASLIEDCSHQ
YDFVIIDAPPLLLAADALALSRMTDGILLVARPGVIDSSNARAAQDILGRYSYNVLGLIVNGIIEKNESRSYFSHAKEYF
AVEQVTKSHK
>gnl|bykdb|A0A1Z4R0P8 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Calothrix sp. NIES-4101] (length=730 residues).
MEKQSYPDELDLQNYWLVLKRRWPIALGIFLTSVALSGFAISLQKANYEAEGKILFQANRTNSLTGVDGKFRDLESIRRE
ANPLSTQAVILQSRPILQAVIERLNLRDDTGKLVDPKSLIIKVEPVAGTDVLNVSFISDKPKEAAAIVNQLMRSYVDNNI
KNNRSEALAARKFIEAQLPRAKGELDKTTEDLRRFKERNQIINLEEESNETVKTIGELDKQLNEAQGQLAEVISQYQELR
SQVKIPSETAVDVASLSLIPGVQEVLSELQKVQTKLATEKSRYNSTHPSVINLEEQEKALASLLQQRASQSVGANVKISP
NSLQLGGLKEQLVGESVRLQAQRLGLANKVQTLTNLHQIYKRRANVLPNLEKKQGDLERRLEVAQESYKNLLTRLQEVRV
AENQNVGSARIVQEAVVPNQPVSSKLTLYLAAGGIFVGLMLGIAAAFLIDIIDRSIKTTKEAQNIFGYTLLGLIPKFSTN
NAAIEQISIEGASPRVIVGTLPRSVIHEAYQMLEANLNFISHKRVRTLVVTSSVAGEGKSEVSANLAAVIAQTGKRVLLI
DADMRNPSQHHLWGVMNLTGLSNAIVGQNQIRRCIQSVTRNLSVLTAGVIPPNPLVLIGSESMNALIHSLSESYDYIIFD
TSPLAGNADAAVLGKMVDGVLVVVRPGLVDTASALAAKSLLLRSEANVLGIIANGVNVKSEPDNYFYYNSNRTEVSSEQL
VAQNTTNSRQ
>gnl|bykdb|A0A1Z4RMB9 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Chondrocystis sp. NIES-4102] (length=762 residues).
MLSNNSNEQNTNSAYPSIAPKRDSLDVNFNEYLLKVKRRWKPALGVFLLTLGVTGALSLLQTKTYQAEGKILFKQTSAAS
YTGIGEEAGTLKPILNDQTPLTTQIQVLRSEPVVQQVIDQLKLTDNEDKPLKPEDFRKKLVTEVVGGTDVVDVKYRHPNP
KTASEVVNALMDVYVKEQIRGNQSQPAAAKDFITKELPSIESKVQQAESQISAFRTQNNIVDIEEEKRGVVESIGALNQQ
ISTTGSELQGLKAQTAALEGQLGLNLNQAVAANQLGASPEVQSILDQLAQTESDLSKERQRFNDAHPSVVSLNAKKNDLT
QQLEGLVANAVGQGVQVSQGLLEGQDGTKENQLERFITLKIDELSRQRQVESLYQSQQEYLKRAKELPSLEKRDRELVRS
AEAASKTYQTLLDSLQKAQIAENQQSGNTDIVEYATVPDKGSAGRVMLMGLGVILGAFLANLSIILLEMQDRSLQSLAEI
KKKFAYNVIGMTPLEPPSYQGRIITREEPDSFSSEIYRMIQANLKFLTSDKPPKVMLITSSVPEEGKSTVVANLAAAIAQ
LGRSVLLIDADLRRSSQHTLWGVDNNLGLKDILTNDQSPLSVIKRPMPKLSLLTSGIVNSNPLALLDSPMMSDFVGRSRR
DYDLILIDAPPLPVTADVLTLSKLVDGIVFVTRPGVVEHESAELAQEALATTRQQVLGMIINGVKAKEFDRYSYHGRYGK
SYYKKGNSSQSSSNNLNTQQNSNLPENNSSNNGTNNVSKAKL
>gnl|bykdb|A0A1Z4RN12 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Chondrocystis sp. NIES-4102] (length=726 residues).
MDSNLHLEEYIDFNKYWQVLKRRWLPATATFTGVVLLSLIAALSSQKVYEAEAQLLIKPDRTSKLIGIDTNPEEIKGLTQ
DKDPIETEAKILQSRPIVERLIKELELKNDDGEPLTYKSVSTALSVEPIIGTDLLKITFTDQDPEVALAFVNRAIELYSE
DYASYNRSETASARDFIAKQLPKAEENVREAEANLRIFKNRNRTINLDEETASTIESISTIENQIDQVEAELSDINARYS
RLQSQLGMNWREASAVSALSQSPGVQRALSQLQDVKVALAQKQAFLSNNAPQIVSLKQEEADLTSLLEQQIASTLGPGQQ
GLVNSVNIASLGELKQSQLAEFAELGLQKEGLDKRLASLRSNYNNYQQRSDNLPQLQEQQRELQRRVDATQSTYKTLLAK
LQEAEIIEQRNTGKVRVTAPAAIAEDPVNPDKKVIVAAGAMMGALFGMALAFLLDLKDNTIKNTQEVENLFAYPLHGVVP
NLNLTGERKQLQLPGNSTANLPEQVTTDASMLPLKEAYQNIQVNLKLLGANVETKTIAVTSSVPQEGKSSVSANLAVARA
QCGQKVLLVDADMRRPTQHRIWEITNEIGLSNVLKHEVQWADVVHKVMPNLDVLTSGIVPEHPISLLDSEVMKDFVNNVS
QHYDQIIFDTPPLLGIADTKIIGNLVNGFLFVVRPGVADYNSATSARKVLNSTNQKVLGVIVNGADMSQEGSSYYKNYYY
SQRSDD
>gnl|bykdb|A0A1Z4RPC6 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Chondrocystis sp. NIES-4102] (length=729 residues).
MTNLQTTNSLSSNHREELDINIGNYLQKLKRRWIPALAVFIVTVGTTAFLSGFLEKNYKSEGKILFKKNSVDSFLDLQSK
PEQLNSILPDQTPLSTEKLRITSEPVLQQTIDQLKLVDAAGKPLKTEDFKKKLTVEIVGGTDVIQIAYKDPDPVIASKVI
NTLMDVYIKEQVNSNKKATASADSFVTSTIPKIEDKLQTLESRLQNFYERNQVVDLQEEKRILVGEVGNLNRQIADTGAQ
LQGAKAQTESLQNQLGLDLKQAIAANQLGSTPQVQSILDQLATTETELAQERQRFNDNHPTVISLNDKKQALNSQLQQLI
TQYVGTKVSEGLLQAGNVRENQLERFISLKIDELSLQTELASLYKYQQVYLDRAKEVPRLEKEEQALLREVESTRSTYNT
LLDNKQEIDILVNQQTGNAEVIELGKVPDKGSTGRVFLIALGVLMGLFLSNLTVILLEMQDRTLKTIPEVKRKFGYQVLG
IVPFDSFQDSHGSIIVQREPDSFASEIYRMIQTNLKFLAVKRQPKVIVITSSVPGEGKSTIAANLAAAMAQLGRKVLLID
GDLRKASQQDLWQVSNLMGVKDVITHKTPLDQVVSQPMKQLDLLTAGTIAPNPLALLDSVEMSELVATARKDYELVIIDA
PPLAVTADVLTLTKLADGLVFVSRPGIVEHESAELAQETLTNANLSQQVLGLVINGVKPTEFDRYSYHAKYSKKYFTSPE
NTPSKTATA
>gnl|bykdb|A0A1Z4SFN6 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nostoc sp. NIES-4103] (length=735 residues).
MESKQNLEEVDFQSYLLVVQRRWLAAVSVFGVVVALASLQAFSSKPSYEAQGSLLVKTNRSTSLTGLGESIGRIESLTNT
NNPLETQAKIVESVPVIQETIRTLNLKDDEGQLLTIPNFTAKLKTKNYKGTEVLDIYYKDEDPYLAAKVVNQMMEVYIKN
NIEANRAEAVSARKFIMKELPATELSVRAAESTLRKFKEENKIINLESEAGLAVERISNLEQQLAQAQAEYANVTAKSQK
LQNQGSIDSPQSVTFASLSQIPGIQQVLTQLQEAQNQLTIEQTRLQPGHPTIINLEEKIAALNSLLEERIKQVVGSNQQI
PLENVQNLQNLQIGELRQNLIQNFATTEAERVGLSQQIATLSSKLSSYKQRVNVLPRLEQIQRQLERKLKASQTTYEALL
TRLQEVQVAENQNIGNARIISPALVPDEPTGPRKALIIAGGGVLGILLGIMAAFTLDLIDRSLKTVKEARELFQYTLLGV
IPLVGGNGKKSYYLPGADQQIPRVIGRDIPHFPVGDAYQILQANLKFLSSDKKLKAIVVSSCVSKEGKSEVAANLAVAMA
QLGHRVLLVDADMRRPVQHHIWGMTNAVGLSNVIVDQSPMRVAIQEVMPYLYVLPSGVVPPNSVALLDSQRMATLVTTFT
EEYDFVIFDTPPLSGMADAAVLSKLADGIMLVVRPGVINYASANAAKEFLKQSGQQVLGMVINGVNIKSEPDSYFYYSRD
SAESGYTPQKSAITK
>gnl|bykdb|A0A1Z4SIJ3 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Calothrix sp. NIES-4105] (length=766 residues).
MENEGYPLQEAEIQKYWLVLKRRWLFVAVTVAASVGVAGIFIVRQHPEYRANGMLLFKSDRISSLTKAGEKIGDLESLMR
QGNPLETQAVIVDSEPVLEEVIRTLDLKDKKGHPLDPDQLKIKIEAIPGTDVLKVSYVSINPELAKKVVNQVMQTYVDKN
IESNRTQVYAAGEFIKKQLPFSRAELESASEALRRFKTENKIIQLSQESTAGINNIAQLDEQINQSKASLADISAQEALI
ASQLNMQSKEAVEVASVSQMSGVQDVLSELQKVETKLAAERGRYTNQHPSIVYLKNQQAALKSILNERAGKALGTTDNIS
TNKLQVGKIKQDLAVQYLQFQGQRQGLEKKIRAMEAVQANYQQRLNVIPNLEKNLGDLERRQTLAQTNFQNLQDRLQEIE
IAEKQTIGNARIIQPARLPNKPVLSRLTLLLAAGSAFAGLLFGVSIAFFVDLIDNSLKTIKETEAFFEYPLLGLIPKFES
NNQDSSKETRLLGRINGLLAKYQQKNQIVSLPSTNFDSKLLPIRLVGLEVSNRIIVASAPHTVIHDAYQMLQANLKFISH
KKVCTLAITSSVAGEGKSEVAANLAAALAQSGRQVLLVDADMRQPAQHRLWGLINSVGLSNVIVGQSDFLLSKKVVNEHL
SILTAGVRPPNPLALIESDRMASLISTFAQDYDYVIFDTPPLAGTADAAILGKMVDGVLLVARPGVVNSASAKAAKSLLE
RSSSNVLGIVANAVNLKHEPDSYFYYSDRNVQVAETEMEVEEWVYK
>gnl|bykdb|A0A1Z4SMD6 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Calothrix sp. NIES-4105] (length=737 residues).
MNQGFIEEIDVQNYWLVLKRRWLIAAGVLLTFVGLSGVAIYMQKPEYEASGMLLFQSNRTSSLTKVGEKIGDLESVMREG
NPLETQAVILNSEPIIQKVINTLKLKDKKGKLLNPELVKVKVETITGTDVLKISYSSKDPEVASSVVNQVMKTYVEKNIE
SNRSQVFAAGSFIKKQLPDSKAELEQAAEALRQFKNQFQIIELKDESTAAINNVAKIDEEMNQVKAAIAEAIAQETQLRS
QLNIAQNQPVVEIASLNQIPGVQEVLSELQKAQTQLAVQRTRYTEDHPSITSLKNQEINLNNLLRSRIEQVLGPSGMNLV
FGNRQTVSTGKLQIGQIKQNLASQLSQLQTQRQGLEKKILALSNIRDSYKQRLSILPNLEKKQGDLERTLSVAQKNYESL
VNRSQEIQVAERQTVGNARVIQHARVPNKPTLSKSTLALAGGGVFGGLLFGVAVAFFIDLIDNSLKTVKEAEVLFDLTLL
GLIPKFEPSPSTVPSIKGISPRIVIGTYPHTIVHDAYQMLQANLKFISDKKVRTIAVASSVALEGKSEVSANLAAALANA
GRRVLIVDTDMRQPRQHHLWGLINSTGLSNIIVGQEEFSSAVQSITTNLSVLTAGVQPPNPLALIDSQRMASLIDIFSQS
YDYIIFDTPPLVGTADAAVLGKMLDGILLVVQPGIVDSASANAAKNLLKRSEANILGIVANAVNLKQEPSAYFHYSKPRI
GQEVLDVEIVNKQRVYK
>gnl|bykdb|A0A1Z4SNV3 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Calothrix sp. NIES-4105] (length=708 residues).
MEKGFWSVLAVIKRRGLPALITFTAVISGAVAYLKVTPRLYETSARLIFDDKRVSVSELGRDLSQTSVSGSGNSALANQA
ELIKSERILNQALAIAETSEAGRSTITTAELSRGIRIKTIPATSILEISYQSKNPELAATYVNAVAMATIRDNTKSISTE
ATKVRQFLQQQLPQARAQLQAAEAAENKYRQASIIVNYDEQTKSLVQSVASLEDQQRTLATQLQDANSRGESLRQITQAK
GLDRAYESVRSGQDQELQKLRAKLADQETLLIEARLRFTDSHPTVAKLLQQRDALRSLYAQQLARVAPVDTSSSNNSNLN
NVAGDAISQDLTSKLITNEIERAAITDKLRVTQNNIAQLRNRLTQLPLQQQPLTALVRKREEAAASLKFLQAKFEEARIA
EAQKVSNLQVIQVAQPPTEASSPKPKVVLALAGAFGLLLATGVVILLELMDNTLRDASEAEELLKLPLLGVLPRLPDRTL
VLNPANRFLDNVGLVEPYRMLFKSLEFRTSELQLLVVSSTISGEGKSIVASHLAAVSAMLSRRTLIIDADLRRPVQHTIF
NLPAKPGITDIVEGSISLKEAVQPTEIENLSVLTCGELHVRPSQILESPAMKRLISEAVANYDFVIIDTPPLSACADTAT
LAKQSEGVLMVTRPNITIKEVLQRAVSELNNNGIPIVGVVVNGMTTQTEQYYRYPVSGYQMKRIKART
>gnl|bykdb|A0A1Z4SQV2 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Calothrix sp. NIES-4105] (length=718 residues).
MQVNAENDSINFRQAWRIMKRRWLAVTVVLSSVVGITGAVTFSQTPIYEAEGKLLFNRANLYSSLTGITESQNIDVPGIN
STNPLETQAEIIRSQPLVQKTIDTLELRNNNGQPLTVEEFSQKLKVAGVKGTDVLEVSYRSPDAKQAANIVNTLIKNYLE
NDIRTNRTEAVAAREFISKQLPEVETKVRSAEYGLRQFKEKNRVVELQEEAKTSIKNQSDLADQIIKSEAQLVDISSQIQ
ALQNQLSLNSRQAVALNTLSQSTAVQPLLNEFRSSQDKLAVERTRYSDEHPIIIDLANKIQVLRQQLQLRIVQILGSTQA
LNERDLQIDPLKQNLIAELVKLEVERTGLSNRVSTLGNAFTLYKQRAGILPRLEQNQRQLERNLQVARQTYEQLLRRYQE
VQVIENKTVGNARIVSEAQVTNRPVSPKLYLNLALGGFLGIILAVGAALMSEALDGSVRTLSEAQELLGYSLLGTIPRLS
ITRPHRNRDISTLPIRDNPWSPASAAFEKLQSTLEYTLPDQVLKSIVITSAVPNEGKSFVSANLALAMAQLGRRVLIIDA
DMRCSRQHEIWKVENSQGLNEILEGTIDLQTAERKVSNNVYLLTAGVTPSNPFAILGSPQMNDLMATAQQEYDFVIIDTP
PVIYAADALVLGKLVDGALVVVRPGAANSAISQEMKTLLKQSNQRVLGMVVNDVTDESDSYYGYGVHKGYYRLPTVAK
>gnl|bykdb|A0A1Z4T6Y7 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Calothrix sp. NIES-4105] (length=729 residues).
MEQQNNRSEDIDIRNYWLALKRRWLVASGIFITTVALSGFAISLQRPTYQASGKLLFQTNRASFLTGVGEKIGDLETVRR
EANPLSTQAEILQSRPILEAVIKKLDLRDKNGNLVKPESLNIKVEPIIGADVLNVSHISSDSRLAADVINYVMRSYVENN
IQTNRLEAVSARKFIENQLPRAEQELNKTTEELRSFKTNNKVINLDKETEETVKNIGELDKQLNEVKGQLAEVTSQQAEL
RAQIKIPSNEAVDRTSLSLIPGVQESLGELQKIQSQLATEATTYTSNHPKIISLRQKEAALNNLLQQRASQSLGTNVKVS
PNKLQLGQLKEQLVGESVRLQAQRLGLENKVQTLSGLHEQFKQRAEVLPNLEKKQGDLERRLMVAQKSYETLLGRLQEIR
VAENQTVGNARVIQNAVVSPNPARLRMMFLLGAGGIFIGALLGVAAAFLVDVIDKSIKTVKEAQDVFGYTMLGLIPKFEN
APTIEQTIEGASPRIVVGTLPRSVIHEAYQMLQANLKFISHKKVRTIVITSSVPGEGKSEVSANLAAVIAQAGKRVLLVD
GDMRNPAQHHLWGVMNLTGLSNVIVGQDRIRSCIQSVTRNLSVLTAGVIPPNPQALLDSESMSALIQALSQHYDYIIFDT
PPLAGTADAAVLGKVVDGVLVVVRPGVADSASALAAKTLLMRSEANVLGMVANGVNIKHEPDRYFYYNSTRDTDNSSLVT
QASNSKTKV
>gnl|bykdb|A0A1Z4TIZ8 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Fischerella sp. NIES-4106] (length=714 residues).
MEKGLSSLLFILKRRTLPALATFAAVIGGAIAYLQITPRLYETSTRLILDQKRVSVSELGRDLTQLSPGTPGGSNPLADQ
AELIKSQRVLQKALAKVSAESGFSPPGNELTVEQLSQNLKVKIVPATNILEVSYLNKNPTLATKVVNAISQAMVEDNTQV
IRQEAANVRKFLEKKVPDARKRVEEAEQKENKYRQSSGIVSFDEQTKSLVNSLATLEEQENTLVAQLQELRSKEASLRQV
TDAKALNQAYAAVRGGQDEELKALRNKLAEIETKLIQARLYLTESHPTVINLLGQRNGLRGLYLQGLARVSPGNTSISSS
SVAGDKISQDLTSQLIVNDVERLAIENKFRSVQANRANLQTRLAQLPIKQQQLTPLTRKREEAVESLKLLQSKLEEARIA
EAQLVGNIQIIEAAQPPKEPSLPNKKAILAIATVFGTALATGIVLLLELMDHTLKDASEAEELLKLPLLGVLPRLPTHAI
ALESSGRFLDHVGLIEPYRTLFKNLEFRSNEPLRSIVVSSSITGEGKSVVASHLAVISAMLSRRTLLIDADLRRPVLHTL
FNLAPQPGITDVIDSQRSLEETVQRTHIANLSVLTCGDLYGHLSHLLESEVMKSLITEAILQYDCVIIDTPPLSACADAQ
TLGRQSDGILLVTRPNFTIKEVLQRAVSELTHNQIPIMGVVVNGITQQTERYYRYPVNGYRSLLSKGLSQGSSA
>gnl|bykdb|A0A1Z4TLC8 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Fischerella sp. NIES-4106] (length=729 residues).
METNSYTQETEIQQYILVLKRRWRLIASIIIASIGLSGLALFMQKPEYQADGILLFKSDRTSSLTKVGEKIGDLEALMRE
GNPLETQAVIVNSHPMLQEVITALDLKNEQGKLIDPELLKINVKPIVGTDVLKVSYASNDPELAAAVVNQLMKSYVENNI
QTNRAQVSAAGEFIKEQLPNSRRELERAAEALRQFKIQNRVIQLAEESTAAIDIISKLDQEMNQIKAALADVSAQEAQIA
SQLNVSENQAVTVASLSQIPGVQEVLTELQKIQTKLANARAIYTEQHPTITDLKNQQATLNSLLQQRTQQYSGIPLVSPG
KLQIGKIREEMVGNYVQLKAERQGLEKKFRTLSNIRANYQQQLAVMPSLEKQQQGLERKLESAKNGYENLVSRLQEIQVA
EKQTIGNARIVQPAQIPKKSVISKTKILLATGSIFAGVLLSIAAAFFVDLIDRSLKTVKETETFFGYTLLGLIPKYKPNN
FVNAVQDVDVEDGVYPQVITTTSPRTLVHEAYQMLQANLKFISHRKVRKIVVTSSVSAEGKSDVSANLAAVIAQSGKRVL
LVDADMRKPTQHHLWSLINSVGLSHLLVGQGVFSQAVHKVTEYLSVLTAGVIPPNPLALIDSEGMTSLVDIFAENYDYVI
FDTPPLVGIADAAVLGKMADGILLVTRPGVLDSPSAAAAKSLIERSEANVLGIIANAVNAKQEPSSYFYYSSPRDRKSAA
DLERVARMS
>gnl|bykdb|A0A1Z4TQ63 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Fischerella sp. NIES-4106] (length=731 residues).
MKESEYQLEEIDVQKYLLVLQRRWMTAVGVFGAVVTLALLYAFSLKPTYTAQASLLIKTNRASSLTGLGEDIGRLESLAE
NNTPLDTQAKIVTSVPVIQETITSLSLKNDEGEPLKIEDLLKNLKVEGLKGTDVLEISYTDENPQLAAKIINRVVDTYIK
QNIQANREEATSAGRFILQQLPKTEEAVQKAELALRRFKEKNKVIVLQEEATAAVNTISKLEDEIAQAQAQLVDANARLE
KLQNQARVNSQEAVSAVDLSQVAGTQQVLKELQEAQTELTVARTRYLPGHPTVSNLEEKVSALKSLLQQRVEQVGGNNPQ
ISTANLQMGEVRQKLIEDLANTDKERAGLEKRLADLRNTWSLYKQRANIMPRLEQTQRELERKLKAAQTTYETLLTRLQE
INVAENQNIGNARIISPALVPDEPSGTRKALIVLGGGVLGILLGIIAALTSDLIDRSIKTVREARELFQYTLLGVIPSVS
RSGKSSYSVEGLDRPVPRVVGRDIPHFPVGDAYQMLQANLKFLSDKQLKAITVTSSIPKEGKSEVSANLAVAMAEVERRV
LLVDADMRHPIQHHIWQLSNKKGLSNIIVDQVPLESVVHEVMPNLHVLTSGVIPPNPVALLDSDRMATLVANFTKDYDCV
IFDTPPLAGTADAAVLGKLADGILLVVRPEVVDFASASAAKEFLTQSGQKVLGMVINGVSVKRERDSYFYYGKNSVESTS
VSKKSILVKNR
>gnl|bykdb|A0A1Z4TX53 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Aulosira laxa NIES-50] (length=731 residues).
MPTKQEEREVIDVQQYWTVLKRRWPVTTVVIGSVFGLTALVTFLQKPVYESQAKLLFNKQNGVSSLTGLSSQVGELSGLT
NLSNPVDTEAEVIRSNPIVLKTITSLNLKDKSGKPLSIEKFLKLLKLKTIRGTDVMQLSYRSTNPQEAASVINSLMSYYL
ENNVRTNRAEARSAREFLNRQLPEVEKRVLKAEMALRRFKEKNRVVALDVEAKVGVEGLKELAEEITRTQGQLTAAKTRS
LALQNQMKLNTDTAVELTTLSQSPGVQQVLTEYQKVQDELAVARTRLTEDNPKIINLENQEVALRNQLEGRVAQTIGNSE
YTPEQNLQIGNLKQTLTENLVKSEVERLALTNQVAELQQVLIVNKNRLDSLPRLEQQQLQLQRQLKVAQVTYEQLSKQLQ
EVEVVENQNVGNARVISEALVPDKSVSPIIPLNLALGGILGIILGAGTALVLESIDNSLKTVEEAKRLLDYPLLGAIPLA
EKAKGSEAASEQELPVLNNPYSPVSSAFEMLQTNLSFSISDKMLKVIAISSSIPGEGKSFVAANLAVAVAQLGRRVLLVD
ADMRRPRQHKIWEQNNLVGLSNILVGQTELQTTTKEALMTLDIITAGTIPPNPAALLNSQRIATFIKQATQEYDFVIIDC
PPLTLVADALMLSKLVDGILLVIRPGVANTGSVNATKMLLEQSGHQVLGMVANGVTPESSYGGYYAKSYYGAKQSHKNGK
VDASISKIRIS
>gnl|bykdb|A0A1Z4U1C2 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Aulosira laxa NIES-50] (length=737 residues).
MESRESIDFDLSRYLSMVKRQWIPAASIFASTVALSVVATTLLKPSYEAEGKLLFKTPSFNVVGSELLPSESQARGDLRP
LVSTQNPITTQIEVITSPLLLQKTIDELQLKNKEGKPLTTEALKKALSIKIIGGTDVLLVSYQSPNPQEAAAVVNNVMNL
YLENDILTNRAEAEATRKFMAKQLPNNRSAVQDAEAALRIFKQKYNIVDLAEETRSAVAIIGNLDSNINGVKADFDQATA
QTNELRQKVNLNSQEALSASAVSQSPAVQGILTQLQDIDRQLASERSRFLDDNPVIVNLEQRKANLQALLKKEIGQTGAG
PVNYQPKTLQIGETKQNLIRDFLQSDVQRRGLEQKLTSLYNSRSVYEQRVRIIPQLEQQQRDLERRLEVAQSTYQTLLKK
VQELQLAENNNTPNARIIAKGSVPNKPTLGLKPFILVLGVLLGAFLATTAVIFLETRDRSLKTLKEIREIFGYTLLGIVP
SSTKKIRSRYRETEIATQEIAVIDSPTSLTSEIYRMIQANLRFLSSDKVLKTIVVSSAVPKEGKSTVSANLAAAIAQLGR
KVLLIDADMRVPTQHHLWQITNTAGLSEVLVGEAEFKTAASNVIENLDVLTAGVRPPNPLALLDSKRMATLIQEFSNQYD
FVIIDAPPLLLAADAVTLSHMTDGILLVARPGVIDSNSANNAKELLQRSGQNVLGLLVNGINEKNESSNDFYHAKEYFSA
DTVTTESESGVRTWSQR
>gnl|bykdb|A0A1Z4UZW9 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Dolichospermum compactum NIES-806] (length=730 residues).
MSINQEDQDSSIDIQQYWLIFKGRWPMASIVFAVVFGVTALVTYSTKPVYESEGKLVFTKKSGASSLTSLSQQMGELGAL
TNLSNPVDTESEIIRSYPIVNKTITTLKLTDDQGKQLSLEVFLKKLKLKTIRGTDVMQLSYRSTNPQEAAKVVNSIMKYY
LESNVRTNRTEARSAREFLSKQLPEVEKRVTKAEMNLRRFKENNRVVALDVEAKTGLESLGKLDEAITKSQGELAAVLTR
SVALQNEMKLGTQQAVDLSSLSQSPGVQQVLTEYQKTQSELAIARSLYTNDNPKVVDLVMKEASLKNVLKERVAQTVGSS
ESLPKQNLHIGELKQSLTQDLVKSEVERLALTKQVEELQRVFIVNRRRLDSLPRLEQQQLQLQRQLTVAQLTYQELLKQF
QFIEVLENQNVGNSRIISEALVPERPVSPKIPLNLALGGFLGIILGAGTALVLESMNQSLKNIEEANRLLGFPLLGTIPL
YIGKNPKNPQEGRQELPVLNNPYSPVSTSFEMLQTNLGFTLSDKELRVILLTSSIPGEGKSFVAANLALAAAAQPGRRVL
LVDADMRRPRQQSIWEIHNLLGLSNVLAGQVQLKNAVQEVSPQVHILPAGRTPPSPVTLLDSQRMADLIEEARREYDFII
IDTPPLTAVTDPMIVGKYVDGLLLVVRPGFVEYSAVKSAKSLLEQARVPTLGMVVNGISEENGYGGYYKYKDYYGEKVVS
KEKRSQANVR
>gnl|bykdb|A0A218Q4C1 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nodularia sp. NIES-3585] (length=730 residues).
MPSYQEDQDEINLQQYWLTVKRRWLLIATIITSVFGFTAFVTFSQKPIYQAEGKLIFDKQSSVSSLTGVSERVGELSRLT
NLSNPLDTQAEIIRSHPLIQQTIDNLQLKNQEGEPLGVGSFLGKLKVTTIRGTDVLQLSYNSIDPQEAQSTVNQLMAAYL
NNNVLNNRSQAAAAREFLTEQLPLVEAKVSEAELALRRFKERNEVVALEEEAKQGVERVYEISNQITLLRARLVDASSRS
SALQNQLQLNTEQATALSTLSQSRAVQQVLLEYQKVQDQLAVERSRLTDEHPVVVNLLNEEEALRIQLEGRVTQTLGSSQ
PIPEQNLQIGELKQALTANLVQVEVERLGLENQVDVLTQAFTFDQVRLRSLPRLEQQQLQLQRQLQVARNTYEQLLGRLQ
EVQLVENQNVGNARIISEALLPDKSISPRIKLNLALGGFLGILLAFGSALLLDAVDKSVQTAEEAEKLFDYPLLGKVPKL
LRDEHTTELPLLDNPYSSVNTAFEMLQINLGFTISDKKLKVIVVSSCLPGEGKSFITANLAVATAQMGQRVLLIDADMRR
PSQQEVWQVRNLIGLSNVLVGQATLAQSCHEALVNLHLLTAGTIPPNPAALLDSERMHELLQEASQDYDCVIIDTPPLTF
IADASIIGKLADGILLVARPGVVNSDAIRTTKTLLENSRLSVLGMVVNGVSGDSSYYYNNSHYYHQQNGNRKKHTIESQF
QGITEKWLKK
>gnl|bykdb|A0A218Q6R8 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nodularia sp. NIES-3585] (length=729 residues).
METKNYPDEIDIQKYWLVLKRRWLIIAAVSTACAALGGVNFFIQPTTYQASGKLLFQLNRTSSLTGVGGRIGDLESIGAN
PLDTQALLVRSTPIIEDVINTLELKDQENNLLRPESININIERIMGTDGLQVSYVSEEPQLAKEVVNQVMKSYIANNILA
NRSEAIAAATFIQQQLPQAKKELEEITEALRQFKTQNQIVDLQEEKNATVTIVLALDEELNNARALLADVSAQEKQIIGQ
LNLPAEQALAITSLSQESGVQEVLGELQKVQTNLAIQQTRYTDQNPHIANLKNQEAALASLLQQRITESLGYPMQIPPTM
LQMGEIRQEIVSEFVKLKSQRLGLAEKIQSISNFRNSYSQRVSNLPSLEKRQGELERKLSRAEKNYENLLTRFQDIKIVE
SQTIGNARVLQYAEIGSNSSANKKKIIILLGGGFVGLLLGVAAAFFIDLIDRRVKTAKEAEELFGYTLLGLIPVFETKNI
SNTLDTEEPIVEQFSPRIVVETSPRSVIHESYQMLQANLKFMSLDKKVRTIVVTSSVPGEGKSEVSANLAAVMAQVGRKV
LLVDADMRQPSQHHLWGLLNSIGLSNVMVGQEELSDTIKQITPNLSVLTTGVIPPNPLALIDSECMTSLINRLNQQYDYI
IFDTPPLIGTVDAAVLGKMVDGVLVVVRPGVVDSTSVTGAKTLLSRSEANILGIVANGIDVKQEPGNYFYYSSARSEQSV
EKTDPVPLS
>gnl|bykdb|A0A218QGE0 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Tolypothrix sp. NIES-4075] (length=727 residues).
MDTKNYPEEIDVQKYLLVLKRRWLIASGVFAVFATLGGINFVIQPPVYEASGKLLFQSNQTSSLTGVGEKIGHLESIKPE
ANPLDTQAIVMQSEPVMQDAIETLKLKDKKGNPLSPDAISIKTEAVVGTDVLKVSYTSDNPESAKAIVDQVMKSYIANNI
LSNRTQAISAGAFIEKELPRAKAQLEKAAEALRKFKLKNQILELAEETKASVKNISDVEIELAKARSELADARAQEIQIR
RQMNLRVDRAVDITSLSQVPRVQGLLAELQKVETQLAALKARYTERHPAIVDLESQKANINSLLQQQISQSLGYKAAIAP
GKLQMGEIKQNLTSDFVRLQSQRLGLEKKVEALSAVIASYKRRAQVMPNLEKQEGDLERRLSIAQKSYENLLTRQLEIEV
AKNQTVGNAKVVEYAKVAFSPSVKKKKLVITLGSGFVGLLLGVASAFFVDLIDRRLKTTKEAEALFGYTLLGLIPKYEKN
TSTFLDRSLEKVSERIIVATSPRTVIHEAYQMLQANLKFISLDRKVSAIVVTSSISGEGKTEVAANLAAVMSLAGRRVLL
VDADMRQPSQHHLWGLINSVGLSNVMVGENDFSKSVQRITSNLSVLTAGVMPPNPLALIDSERMTSFIDMLSQSYDYVIF
DTPPLVGTADAAVLGNMVDGVLIVVRPGVVDSNTATAAKSLLARSEANILGIVANAVNVKHEPDNYFYYNSYRSENSVEK
VDTASIP
>gnl|bykdb|A0A218QN17 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Tolypothrix sp. NIES-4075] (length=725 residues).
MEKGISSLLAILKRRALPALVTFTAVIGGAVAYLTVTPRLYEASARLMQDDRRVSVSELGRDLTQVSSGAPGGPSPLANE
AELVKSQRVLERAIALASLKSYNGSPPSQITSGDLSKGLGVKIVPATNILELSYKSKDPELAAQLLNAVSQAMIEENTKT
ISSEATKVREFLENNEIPNARKRLATAEQNESNYRHISGIISFEEQTKSAVESLATLEDQERALTAQLQEAKGRDASLRQ
ITSAKSLDKAYASVRGGQDEQLKTLRAKLTELNTKLIEARLRLTENHPSVIALVEQRDKVNKLYTEQLAIVSPANSSVAT
NSVAGDQISQELTSKLLANETERSAIENKLTTVKAQRTQLQVQIAKLPIQQKPLIALTREREDATASLKSLQSKLEEARI
TEAQKVSNLRLIEAAKPPTIASSPKRSAVLALATVFGTVLGTGVMLLLEVLDNTLKDASEAEELVSLPLLGVLPRLPAKT
LVLEPAERFLDNISLVEPYRMLLKTLEFRSNDKVQVIVVSSTLSGEGKSIVASHLAAISAMLSRRTLIIDADLRRPMQHT
LFNLAPTPGITDVIEKRRSLNQAVQPTDVENLDVLTGGEFHGRPSQLLESPAMKSLVAEAAATYDMVIIDTAPISACADA
ATLARQSDGIMLVTRPNITIKEVLQRAVSELNNNQIPVLGVVVNGMTEQTEKYFRYPVDNDRPLGGRSPRRLTAVDGGRN
NYDNG
>gnl|bykdb|A0A235HUM0 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nostoc sp. 'Peltigera membranacea cyanobiont' 210A] (length=742 residues).
MSEKSMESRESIDLDLNRYLLILKRWWVPAFSIFVATVILSAISTKFLKPDYEAEGKLLFRVPSFKVAGNNLSPGTSEGG
DSGDLKPLVATQNPISSQIEVISSPALLQRTIDKLQLKDKEGEPLEVKALQKALNLKIVGGTDVLRISYSSHDPEEAAAV
VNTVMRFYLENDVLTNRSEAGATRQFMAKQLPTTQAAVNNAEVALRIFKQKHQIADLSEETRSAVATIGNLDNEMNTVKA
QLNEVNAQTSELRKKVELNSQEAIAVSALSQSPAVQGILTQLQETDRQLAVERSRFLDDNPIIINLEAKKTNLKSLLQQQ
VGQTVGNQTQVPTSLLQIGELRQSLIQNFLQSEIQRFGLTQRLSSLYNSRVSYEQRVKLIPQLAQNQRELERKVEVAEST
YQTLLKKVQELQLVENTNTPSSRIIAQALVPKDPTLGKKIIVLVLGVMFGLFFATTTILFLAMRDRSLKTLKEIRDVFGY
TLLGIVPLSVKKLRSRDSNAEFTSQTVAVRDTPHSLTSEMYRMIQANLKFLSSDNLLKTIVITSAIPKEGKSTVSANLAA
AIAQLGRKVLLIDADMRVPSQHHLWQLTNEVGLSEVLVGQAEFEIAVSQVMDNLDVLTAGVRPPNPLALLDSKRMASLIE
NFSSQYKYDFVIIDAPPLLLAADALTLSQMTDGILLVARPGVIDSNSANAAQEILERSSYNVLGLVVNGVIDKNESSSYR
YHSHEYFKPRELTKELKGLAKK
>gnl|bykdb|A0A235I9I0 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nostoc sp. 'Peltigera membranacea cyanobiont' 210A] (length=735 residues).
MTMESLPNFEEVNIQKYLEVFQRRWLPLVGIFAISVSLGCLYAFSLKPSYKAEGSLMIKTNRSSSLTGLPDDIGRLEALN
VNDNPLETQVRVIGSNPVIEKTINSLNLKDGQGKLLSIPDLAKQLKIEGIKGTDVVQLSYKGGDPKLAAKIVNEVIDSYI
DLNIKANQNEARTAKQVLVTEVPKAEEVVRRAESKLRVFKETNKVVVLDQEAAAAVDTISKLGNQISQALAQLDDVKGRL
EQLSSEAQVDSRQGVIESELSQAPGVQKVLAELQETESKLAIERTRFSPEHPTITNLEEKVVALKNLLKERTGQVAGGAQ
ITQGSLQVGQLRQSLIADITRAQAERVGLERQIATLKEQQNAYIKRANNLPRLEQSQRELERKLQAAQTTYETLLKKRQE
IDIAQNQKIPNARVISYALIPDKAEGPRKMLFIIGGAGVGFFLGIIVAFTLDLIDRSVKTVKEAKEVLRYSVLGVIPTQG
RNGKDHSSIPGLDRAIPKIIGRDIPYFPVGNAYQILQVNLKFLCSDKPLKSIVITSSVAKEGKSDVSANLAVTMAQAGRR
VLLVDADMRHPIQHHIWGLTNTSGLSNIIGSQAPLDTVVQEVMPNLEVLTSGVLPPNPVAMLDSQRMATLISSFGRDYDL
VIFDTPPLSGIADAAVLSTLTDGILLVVRPGVVDLNSANAAKEFLTQSGQKVLGIVINGVNTKNEPNNYFYDNKKRQIEQ
DLVSSSSLTKFRKER
>gnl|bykdb|A0A235IKU3 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nostoc sp. 'Peltigera membranacea cyanobiont' 213] (length=748 residues).
MSEKSMESRESIDLDLNRYLLILKRWWIPAVGIFVGTVMLSAISTTFMRPSYEAEGKLLFRVPSFKVAGSNLSPGSSEGG
DSGDLKALVATQNPVSTQIEVITSPNLLQRAIDKLKLKDKEDKPLEVQALQKSLTLKIVGGTDVLKITYSSHDPEEAAAV
VNTVMNLYLENDILTNRSEAAATRQFMAKQLPKTQAAVNNAEVALRIFKQKHQIADLSEETKSAVATIGNLDNEMNTVKA
QLDEINAQTNELRQKVELNSQQAIAVSALSQSPAVQGVLVQLQETDRQLAIERSRFLDDNPVIINLEAKKANLKSLLQQQ
IGQTIGNQTQIPQSLLQIGELRQGLIQNFLQSEIQRFGLTKRLSSLYNSRSSYEQRVKLIPQLAQNQRELERKVEVAEST
YQTLLKKVQELQLVENTNTASSRIIAQALVPKDPILVKKIIVLVLGVMFGLFFATTTVLFLAMRDKSLKTLREVRDVFGY
TLLGIVPLSVKKVRSRYSNLELPTQTVAVRDTPYSLTSEMYRMIQANLKFLSSEKALKTIVVTSAVPKEGKSTVSANLAA
AIAQLGRQVLLIDADMRVPSQHHFWQLSNAVGLSEVLVGQVEFNMAISKVMDNLDVLTAGVRPANPLALLDSKRMASLIE
NSSSQHNYDVVIIDAPPLLLAADALTLSQMTDGILLVARPGVIDSNSAAAAQEMLERSSYNVLGLVVNGIIDKNESSSYF
NYAKEYFTHQDLTKEVKPQKRIPDKSSV
>gnl|bykdb|A0A235IXQ2 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nostoc sp. 'Peltigera membranacea cyanobiont' 232] (length=736 residues).
MLSDQNNQDLINFQQYWLTVKRRWFLILIIIGSVFGVTGVVTFSEKPIYEAEGKLLFNKQSGVSSLTGVNEQLGQLSGVT
NVSNPLETEAEIIRSYPLTKKTIAELQLKDKLGQPLEIDDFLHNLKIKSVRGTDILQLSYRSTNPQEATAIINRLMSAYL
ANNVRINRSEARAAREFLNKQLPLVEAKVTEEEAALRRFKEKYEVVSLEEEAKEGVKRLNELSSQITELRARLVDARSRS
GALQNQLALNTQQAMALSSLSQSRAVQQVLSEYQKVQDQLTVERSRFTDEHPVITNLLSKEQALKEQLKGRVSQTLGSSE
PIPEQDLQIGELKQTLTANLVQVEVEKLGLKNQVSVLMKAFLLYQARLRSLPKLEQEQLEVKRQLEVAQTTYEQMLKRLQ
EVQVLENQNVGNATIVSNALVPKKRISPRISLNLALGGFLGFFFAIGVALLLEAGDKSVKTAEEAQHFLDYPLLGKIPVF
DQKARLARGENITELPVLNNPYSSVNAAFEMLQINLGFSFSDKELKVIVVSSSVINEGKSFIAANLAVATAQMGRRVLLI
DADMRHPHQHKMWQQPNLMGLSNVLVGQTSLAEAAKEVVINLELLTSGTIPPNPAALLDSQRMNGLLKQAAQDYDCVIID
TPPLNILADASIVGKMADGMLLVVRPGVVNSAAAKTTKALLEHSRVPVLGMVVNCMATGNNDYTSYYSHTESGENNSGNK
NKVKSNLSRITGLHLF
>gnl|bykdb|A0A235IZ96 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nostoc sp. 'Peltigera membranacea cyanobiont' 232] (length=743 residues).
MESRESIDLDLNRYLLILKRWWIPAVGIFVGTVMLSAISTTFMKPSYEAEGKLLFRVPSFKVAGSNLSPGSSEGGDSGDL
KALVATQNPVSTQIEVITSPSLLQRAIDKLKLKDKEDKPLEVQALQKSLTLKIVGGTDVLKITYSSHDPEEAAAVVNTVM
NLYLENDILTNRSEAAATRQFMAKQLPKTQAAVNNAEVALRIFKQKHQIADLSEETKSAVATIGNLDNEMNTVKAQLDEI
NAQTNELRQKVELNSQQAIAVSALSQSPAVQGVLVQLQETDRQLAIERSRFLDDNPVIINLEAKKANLKSLLQQQIGQTI
GNQTQVPQSLLQIGELRQGLIQNFLQSEIQRFGLTKRLSSLYNSRSSYEQRVKLIPQLAQNQRELERKVEVAESTYQTLL
KKVQELQLVENTNTASSRIIAQALVPKDPIVVKKIIVLVLGVMFGLFFATTTVLFLAMRDKSLKTLREVRDVFGYTLLGI
VPLSVKKVRSRYSNLELPTQTVAVRDTPYSLTSEMYRMIQANLKFLSSDKALKTIVVTSAVPKEGKSTVSANLAAAIAQL
GRQVLLIDADMRVPSQHHFWQLSNAVGLSEVLVGQVEFNMAISKVMDNLDVLTAGVRPPNPLALLDSKRMASLIENSSSQ
HNYDVVIIDAPPLLLAADALTLSQMTDGILLVARPGVIDSNSAAAAQEMLERSSYNVLGLVVNGIIDKNESSSYFNYAKE
YFTHQDLTKEVKPQKRIPDKSSV
>gnl|bykdb|A0A252D4T4 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nostoc sp. 106C] (length=737 residues).
MESRESIDFDLGRYLSIVKRQWLPAVTIFASTVALSAVATTFLKPTYEAEGKLLFKTPSFNVVGTNLLPSDSEGGTSGDL
KPLVSTQNPISTQIEVISSPILLQRTIDELQLKNAIGEPLTVEALKKAINLKIIGGTDVLLVSYNSPNPEEAAAVVNTIM
NLYLENDILTNRGEAEATRKFMAKQLPNTKNAVQEAEAALRIFKQKYNIVDLVEETRSAVAIIGNLDNGINTAKADLDQA
TAQTNELRQKVALSSQEALSASTLSQSPAVQGILTQIQEVDRQLATERSRFQEENPVIVNLVARRANLQALLKQEVGQNG
GTSANIQPKTLQIGPTKQDLIKEFLQSEVQRQGLAQKLNSLYNSRSIYEQRVKIIPQLEQQQRELQRRLDVAQSTYQTLL
KKVQELQVAENNNTPNARIIAKGLVPNKAALGLKPFVLVLGILLGAFLATTAVIFLETRDRSLKTLKQIREIFGYTLLGI
VPSSTKKLRSRNRETDLINPEIAVIDTPHSLTSEIYRMIQANLRFLSSDKVLKTIVVSSAVPKEGKSTVSANLAAAIAQL
GRRVLLIDADMRVPSQHHLWQITNTAGLSEVLVGEAEFKTAACNVIDNLDVLTAGVRPPNPLALLDSKRMASLIQDFSSQ
YDFVIIDAPPLLLAADALTLSHMTDGILLVARPGVIDSNSANHAKEMLQRSGHNVLGLLVNGINESNESSTDFYHAKEYF
STEKIATESRIKARMHN
>gnl|bykdb|A0A252DJH5 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nostoc sp. RF31YmG] (length=737 residues).
MESRESIDFDLGRYLSIVKRQWLPAVTIFASTVALSAVATTFLKPTYEAEGKLLFKTPSFNVVGTNLLPSDSEGGTSGDL
KPLVSTQNPISTQIEVISSPILLQRTIDELQLKNAIGEPLTVEALKKAINLKIIGGTDVLLVSYNSPNPEEAAAVVNTIM
NLYLENDILTNRGEAEATRKFMAKQLPNTKNAVQEAEAALRIFKQKYNIVDLVEETRSAVAIIGNLDNGINTAKADLDQA
TAQTNELRQKVALSSQEALSASTLSQSPAVQGILTQIQEVDRQLATERSRFQEENPVIVNLVARRANLQALLKQEVGQNG
GTSANIQPKTLQIGPTKQDLIKEFLQSEVQRQGLAQKLNSLYNSRSIYEQRVKIIPQLEQQQRELQRRLDVAQSTYQTLL
KKVQELQVAENNNTPNARIIAKGLVPNKAALGLKPFVLVLGILLGAFLATTAVIFLETRDRSLKTLKQIREIFGYTLLGI
VPSSTKKLRSRNRETDLINPEIAVIDTPHSLTSEIYRMIQANLRFLSSDKVLKTIVVSSAVPKEGKSTVSANLAAAIAQL
GRRVLLIDADMRVPSQHHLWQITNTAGLSEVLVGEAEFKTAACNVIDNLDVLTAGVRPPNPLALLDSKRMASLIQDFSSQ
YDFVIIDAPPLLLAADALTLSHMTDGILLVARPGVIDSNSANHAKEMLQRSGHNVLGLLVNGINESNESSTDFYHAKEYF
STEKIATESRIKARMHN
>gnl|bykdb|A0A252DNA2 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nostoc sp. RF31YmG] (length=730 residues).
MPTKRDDRDLIDFQEYWPILKRRWPVTTVVIGSVFGLTALVTFLQKPVYESQAKLLFNKQSGVSSLTGLSSQVGELSGLT
NLSNPVDTEAEVIRSNSIVQKTITSLKLKDKSGKPLSIEKFLKLLKLKTIRGTDVMQLSYRSTNPQEAATVINSLMNYYL
ESNVRTNRAEARSAREFLNRQLPEVEKRVLKAEMSLRRFKEQNRVVALDVEAKAGVEGLKDLLEEITKAQAELADASTRT
RALQSQIALNTQQAVELSTLSQSPGIQQVLEEYQKAEDELAVARTRFSEEHPIVINLDKKAAALRSQLEGRVSQTIGSSE
FVPEQNLQIGKLKQNLTEELVKSEVDRLAVANRLAELRQVYVVNQRRLDILPRLEQQQLQLQRQLQVARVTYEQLLKQLQ
EVEVLENQNIGNSRVISEALVPDKPVSPIVPLNLGLGGVLGILLGVGVALMLEATDNSLKTIEEVKRLLDYPLLGTIPLA
EKPKGSDGEGSAELPTLHNPYSPESAAFEMLQANLGFSISDKTLKVIVLSSSIPGEGKSFVAANLAVAAAQTGRRVLLVD
ADMRRPRQHKVWEQSNLIGLSNILVNQAELPTTTKEALMTLDLVTAGTIPPNAAALLESKRMAALIQEATSNYDFVIIDA
PPLTAVADAQILGKLVDGVLLVVRPGVVDSAAANATKNLLAQSGQRVLGMVVNGITAGSSYGGYYSKGYYHQNGHSKNGK
VDVQTLKIRN
>gnl|bykdb|A0A252E1Q4 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nostoc sp. 106C] (length=730 residues).
MPTKRDDRDLIDFQEYWPILKRRWPVTTVVIGSVFGLTALVTFLQKPVYESQAKLLFNKQSGVSSLTGLSSQVGELSGLT
NLSNPVDTEAEVIRSNSIVQKTITSLKLKDKSGKPLSIEKFLKLLKLKTIRGTDVMQLSYRSTNPQEAATVINSLMNYYL
ESNVRTNRAEARSAREFLNRQLPEVEKRVLKAEMSLRRFKEQNRVVALDVEAKAGVEGLKDLLEEITKAQAELADASTRT
RALQSQIALNTQQAVELSTLSQSPGIQQVLEEYQKAEDELAVARTRFSEEHPIVINLDKKAAALRSQLEGRVSQTIGSSE
FVPEQNLQIGKLKQNLTEELVKSEVDRLAVANRLAELRQVYVVNQRRLDILPRLEQQQLQLQRQLQVARVTYEQLLKQLQ
EVEVLENQNIGNSRVISEALVPDKPVSPIVPLNLGLGGVLGILLGVGVALMLEATDNSLKTIEEVKRLLDYPLLGTIPLA
EKPKGSDGEGSAELPTLHNPYSPESAAFEMLQANLGFSISDKTLKVIVLSSSIPGEGKSFVAANLAVAAAQTGRRVLLVD
ADMRRPRQHKVWEQSNLIGLSNILVNQAELPTTTKEALMTLDLVTAGTIPPNAAALLESKRMAALIQEATSNYDFVIIDA
PPLTAVADAQILGKLVDGVLLVVRPGVVDSAAANATKNLLAQSGQRVLGMVVNGITAGSSYGGYYSKGYYHQNGHSKNGK
VDVQTLKIRN
>gnl|bykdb|A0A252EB80 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nostoc sp. T09] (length=737 residues).
MESRESIDFDLGRYLSIVKRQWIPAVTIFASTVALSAVATTFLKPTYQAEGKLLFKTPSFNVVGTNLLPSDSEGGGSGDL
KPLVSTQNPISTQIEVISSPILLQRTIDELQLKNAIGEPLTVESLKKAINLKIIGGTDVLLVSYNSPNPEEAAAVVNTIM
NLYLENDILTNRGEAEATRKFMAKQLPNTKNAVQEAEAALRIFKQKYNIVDLVEETRSAVAIIGNLDNGINTAKADLDQA
TAQTRELRQKVALSSQEALSASTLSQSPGVQAILTQLQEVDRQLATERSRFQDENPVIVNLVAKKANLQALLKQEVGQNG
GTQVNIQPQSLQIGETKQNLIRDFLQSEVQRQGLAQKLSSLYNSRSTYEQRVKIIPQLEQQQRELQRRLEVAQSTYQTLL
KKVQELQVAENNNTPNARIIAKGLVPTKPALGLKPFVLVLGILLGAFLATTAVVFLETRDRSLKTLKQIREIFGYTLLGI
VPSSTKKLRSRNRETDLINPEIAVIDTPHSLTSEIYRMIQANLRFLSSDKVLKTIVVSSAVPKEGKSTVSANLAAAIAQL
GRRVLLIDADMRVPSQHHLWQITNAAGLSEVLVGEAEFKTAACNVIDNLDVLTAGVRPPNPLALLDSKRMASLIQDFSSQ
YDFVIIDAPPLLLAADALTLSHMTDGILLVARPGVIDFNSANHAKEMLERSGHNVLGLLVNGINENNESSTDFYHAKEYF
STENIATESRIKARIHN
>gnl|bykdb|A0A252ECZ1 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nostoc sp. T09] (length=731 residues).
MPTKRDDRDLIDFHQYWPILKRRWPVTTVVIGSVFGLTALVTFLQKPVYESQAKLLFNKQSGVSSLSGLSSQVGELSGLT
NLSNPVDTEAEVIRSNPIVQKTITSLNLKDKSGKLVSIERFLKVLKLKTIRGTDVMQLSYRSTNPQEAASVINSLMNYYL
ESNVRTNSAEARSAREFLNRQLPEVEKRVLKAEMALRRFKEKNRVVALDIEAKAGVEGLKDLLEEITTAQAELADANTRT
RALQSQMALNTQQAVELSTLSQSPGIQQVLTDYQKTEDELAVARTRFSDEHPTVINLDKKAAALRSQLEGRVSQTIGNSE
FVPEQNLQIGKLKQNLTEELVKSEVNRLAITNRLAELRQVYIVNQRRLDILPRLEQQQLQLQRQLQVARLTYEQLSKQLQ
EVEVIENQNIGNARVISEALVPERPVSPVIPLNLALGGFLGILLGVGTGLLLEAMDTSLKTIEEVKHLLDYPLLGIIPLA
EKAKGSDGEGSTELPVLNNPYSPESSAFEMLQANLSFSISDKKLKVIVVSSSVPGEGKSFVAANLAVAAAQIGHRVLLVD
ADMRRPRQHKIWEQSNLIGLSNILVGQAELPTTTKEALMTLDFVSSGTIPPNPAGLLESKRMAALIQEATNDYDFVIIDA
PPLTAVADAQILGKLADGILLVVRPGVVDSAAASATNTLLAQSGQKVLGMVVNGITSTSSYGGYYSKGYYHQNGHSKNGK
VNKQMPKIHIS
>gnl|bykdb|A0A254W5G5 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][cyanobacterium TDX16] (length=729 residues).
MESRESIDLDLSQYLLSLKRRWLPAVSIFIFVTTVTLSVVAAALMKPSYEGEGQLLFKIPSFNVVGSNLLPSISEGQGTG
DLRALVSTQNPISSQMEVISSPTLLQRTIDELQLKNDRGEPQEVEAFKKAVKLKIVGGSDVLRITYKHHDPEKAAAVVNK
IMELYLENDIHTNRSEAEATRLFMAKQLPKTQAAVHQAEVKLRIFKQKNNIVDLSEEAKTAVANIGSLDNQIDNLKAELD
QANTQTKELRQKVGLNPQQASTVSALSQSPAVQGVLAQLQDTERQLASQRSRYLNNNPIIVDLEAKKSNLVALLQKQIKQ
TVGSQTKVASGLLQIGELRQDLIRTLLQSDVQRRSLAQKLASLSNSRSTYEQRKKVISQLVQNQHELEGRLVVAQSTYQT
LLKKVQELQVAENKNTAHARVIAQALVPNKPVLEQKLIVLALGIMFGAFLSTSTVLFLELKDRSLKTLEEIRKKFSYTLL
GVIPLVGNKFRSNDWDVESTNLEIAVRDKPHSLTSEIYRMIQANLKFLSPDRVLKTIVVTSAVPKEGKSTISVNLAVAIA
QLGRKVLLVDADMRDSSQHHLWQLTNAAGLSEVLVGQAQLSVATAKVMNNLDVLTAGVTPPNPLALLDSQQMAALIEGFS
SRYDIVIIDAPPLLLAADALTLSQMTDGILLVARPGVIDANSANAAQEMLERSGQNVLGLVVNGIVDKNEYSSYFSHTNE
GSVTTGSSI
>gnl|bykdb|A0A254WHG9 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][cyanobacterium TDX16] (length=712 residues).
MEQKYALLPTIFYRRRLPALATFISVMLGALVYLIFAPRTYEAEARLMLDGKQLSLAGETGRDLTQESARLDSNPVATQA
ELALSQKVLRQAIYEAYTANNRNSNAEPPTVEELRKQLKVKTVPATSILEIKYSNKDPLIAAKLLNALTEAMINEDTAVI
RREAGSARQFLAVEVPKKRAQLAQVEATLSQYKQSQGIVSIADDQGRDNAQTTSIVESLAQIEEQERTTLAQLQEVKARN
SSLEQVTDSSTLKNTYATVRSGQNEQLQALRTQLVELEAKVASAQSKYKADSPPLLNLIEERDAARALYQQKIGNETGNP
AASTPNAATDKLSQDLATQLITGEVEASALEGRLAAIRRDRATLQERLNQLPIREQGLAALVRQRQEAVTSLEFLQRKLE
EARIAEAQKVSNLRPVDLAEPPRLPTWPNPAIVLVLATVAGGTLALGTVLLQEGLDGTLRNATEAGSLVEVPIMGVLPVI
SPEVRGKEYADALMQEPAILESYRSLLRSSEFSANEDIKVIVISSALSGEGKSLVSSYLAAVAATLSRRTLLIDADLRCP
TQHKLFKLAAKPGLAEVAQGKLALAEAVQTTGIDKLKVLCSGRPRSHPSELFESRQIQQVIAAAATQYDLIVIDTPPVTS
CVDAVSLCGNGEKLLLVARPSFTQRDIFTQAVAELRAKRVEILGVAVNGIDPQIDKYYRYAFQSYKTLTNVS
>gnl|bykdb|A0A254WJ87 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][cyanobacterium TDX16] (length=745 residues).
MVRVNESNMPMTVEESDGGYGQLLAVLMRRRYWLLGVMGAVLTIATVFTLISKPTYQSEMQLLIEPNYQGKKDGTTPRQG
EQYADSGVTIDDYATQINVMRSSLLIQRAVDILRSEYPTLTVAEVKKNLVLKQVVEEKANTKIVEATYTANDPIKAQKVL
KAIHTVYQIYNREQQEQRLKKGLKFINEQIPAVTKTVDQAENKLEEFRKNNNLIDPEQQAATVNQSLNAIAQEREVIRAQ
YNDLQARYGQLQQQLARSPQQALVASRLSQSSRYQTLLNELQRTELALSQRRVVFTDEDPNVKKLLEQRQNLLSMMKQEG
GRVLGEGQAAQAAASNGGDGILQQGQLGALDLNLAGQLIEIQTNMNAMRARDNSLAQTQQKLRSELKRFPVLLAEYNRLV
PFVQINRDKLQQLLRAQQELSLEIARGGFDWQALEEPRLGLKVGPNLKLNLLLGLVAGLMLGSLAAFLRDAVDDSVHSSE
DLERQFELPLLGMTPELPRGRVAQPEVSLPFGKPLHLSPWTVQVRNWPPSWESLDLIYRNLQLMNEMAAFKSLVVTSAVA
GEGKSTLALGLALSAARLHQRVLLIDTDLRRPSLHQILNLPNDYGLSTLLSSDATLPMHNAIQSSGSYIDILTAGPQPED
PANLLSSQRMRELMAGFEQNYDLILLDAPPLLGMVDAMIAASCCTGVVLVSRVGMVKKTELVQANAMLRKLNVIGVVANG
VSNVSYGYGAYSREQGVELKKVWGN
>gnl|bykdb|A0A254WLA7 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][cyanobacterium TDX16] (length=771 residues).
MADTSLDNERLSVEHRVENRANATDLRQLLTVLLRRRFLILSLFCIPLSASSFLALMAKPTYQSSMQLLVSSNLYQGQNS
NAQGGVEESDFTDSNLKVDYTAQLSVMTSPKIVERAVELLRPEYPNITVEEINGKPAKVKQSPLKVTQVESGTKTLQTLS
QVFEVTFVAGDPIKSQKVLQALQNVYQIYNLEQQKLRLTNGLAFVNEQLPKIRKDVSQAEANLENFRKQNKLLDPEVQAK
NLLDALAAVESERRTIRAQFQDQQARYNKLQQQISRSPQQALIASRLSQSPRYQSLLDEIQALDVTLEKLRVQYRDDYPK
VQDLLKQRQNLIGLLRTEAGRSADRLPAQLNTTEKSLPKQLQLGDSDRKLVDALVDAQVVWFGLSARDQSLAKSEQQLRS
TLLKYPQLLAEYNRLMPEIAINRKTLEQLLQTQQNLGIKIAQGGFNWQIIRDPEPGVYMGTGRIMLLVSGAVFGLVLGIG
AAFLLEALDDTIHSCDELQKLSSLPVLGITPKLPNFELKKPSIALPFFKQQSLTSQRIQALNWFPFRESMDLIYQNIQIL
GSPLSFKSLLLTSALTGEGKSTLAAGMALSVARLQRRVLLIDADLRRSNIHKLLNLSNDRGLSTLLTEEADVRERDCIQS
VQPSLDVLTAGPTPTDIVKLLSSQRMKHLIESFEQSYDLVLVDAPPVLGLADASIVASLCSGTVVVERLNRVTRFDLNQS
LEALSKLNVIGAIINESKECNSRYTAYDGSTQNYIERGFTTNPNLAGKGIF
>gnl|bykdb|A0A254WLE3 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][cyanobacterium TDX16] (length=736 residues).
MQERLIETSESLDLDFSKLWLILKRRWLPGASVFSAILGLTIIAVCLQKPVYEATGKLIIKKNDQTAALTGLGQGIGDLE
GLNLQSNPVNTEIEVVRSIPLLQKTIAALNLKDDRKNEPLKPEDLIDKLKLKNIGGTDVMQVTYKSVIPDEAAAVVNKLM
NVYLENNIQTNRVTATAAGDFIAKQIPDVEARVRRAESALRRFKEQNHLIALEVEAQGAVTVIQTLEGQIAQVRAELADA
NTKLAKLRQQVGMDADNSLNLNALNQSRGVQRVLTEYQKTEAELAQLRTRYAETYPGISNLKQKRTALKALLSQRIAQAV
GKARTVADGKLQIGESKQKLTEAYIQLEVERLGLASRLASLSGEYKLYKQRANILPKLEQQQRELERQLKAAQSTYEILL
QKLQEVKVAENQNMGNARIIESALAPEKALLLKPAMILAAGILLSVMLSSGTVAALEVKDTSVKTLKEARELFGYTFLGA
IPSLTKKAAADGKNGETTAIALPVRDTPRAPIAEAFRMLQANLKFSSSDKLKVILVTSSVPGEGKSTVSANLGAAIAQLG
NRVLIVDADMRRPRQHHIWEKANTEGLSDAIVGQIDYQSAIKEVLPKLHILTAGATPPNPVALLDSVQMTSLIDNFAKSF
DFVIIDAPPILVAADALTLGKMADGLLMVARPGVVSSNTAATARDLLQSSSQKVLGLVVNGVILENESDSYYYYVKDYYM
EEDSTERQRSTAKRKT
>gnl|bykdb|A0A256BLV2 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Pseudanabaena sp. SR411] (length=734 residues).
MTEYPKATYVGKYVDDSFKLAKFFRVLRKRWIVIVAVSVSVFAGNTYYTFTRTPQYRSSASLLVNSTIAVSDIQLPGLST
SSLVNLGTEVAILKSRPLIEIAVSKMQQSPSALSFKDLDPLTIMNGLDIRPEKDTMVLRLTYTDSDPKRAREVLTALTQT
YVEYSLKDRRTKSSTAIKFIQDKLPQVKQQLDKSALAVTQFRKTYNIVDPDTYAASVYKMREALENQAQDLQIKMAQVQQ
QYEALSRQVGKSPEAAIGSAILQQDTPYQSLVKQFQEVETNYFLERTRFREDHPTVIALKDRRDELYRLLETRAQSVVGV
RGSTTNITNEPNSAIQQNLASQLFDAQTTLAVSQAQLESIRNAQSEVATAFSKIPQIQQRYVEIQRQLALDTSTYNKLSE
KLEELRISEAQEISSWKILEPPLTPIKPSSPDIERSLITGAISGIALGILFALLLNRLDQRIREVEEVRELIDIPLLASI
PMTEVSSLSAATNQGILPSSSYYAFKEALGSLALNLRYLGTDNMMKVIAFTSSVPSEGKSTLTYNLATILSALGYRVLLV
DADMRKPSIHKLAGLSNKVGLSTALATPSPWQDLIQAGDEQDNLHILTSGSLPPNPMLLLESNKMAALLQEWRQEYDYVL
VDTPPVIGITDAQCLTSKVDTFILVAAINRSTRSGISRALEILSTARANVSGLLINMIGSSDSEYHYGYYNRYYLNASEA
EEEESDAEVEVIEN
>gnl|bykdb|A0A2A2TC28 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Calothrix elsteri CCALA 953] (length=741 residues).
METKGYLEEIDIQQYWLVLKRRWLIAATVFCASVGLSGLVVLRQKPQYEASGMLLFKSDRTSSLTKVGEKIGDLESLMRE
GNPLQTQAVIVNSQPILQEVINNLNLKDKDGKPVDVELFKVLVEPVVGTDVIKVSYQSNNPEMTAEVVNQVMNTYIKNNI
QSNRTQVFAAGDFIRKRLPSSRAELERATEALRRFKIQNNIVQLPQEATAAITNISNLNEQVSQNQAALADIIAQETELK
KQLNLVGEEAVNITSLSQIPGVQEVLGEQQKVQAKLATLKARYTDEHPAIADLKSQELALNSLVKQRVEQSLGSGKIGST
KNISPTNLQIGKIKEDLASQYVQLLAQRQGLEKKVQTLLNIREGYQRKLSILPNLDKLQTDLERKFNIAQTDYQNLVARL
QEIEIVEKQTIGNARVVQPALVPKIAAMSKMTLLLLGGGVFVGLLVGIASAFFIDLIDRSLKTVKESEKFFGYTMLGFIP
KFEPNNTHSSLHQIMGDNVSPRVIVASSPRTVIHEAYQMLQANLKFISHKKVCTIVVTSSVAGEGKSEVTANLAAIIAQS
GRRVLLVDADMRQPSQHHLWGLINSSGLSNIIVGQDEFSLAVKTVTNHLSILTAGVQPPNPSALIDSEGMLSLIEKISEN
YDYIIFDTPPLVGTADAAVLGKMVDGVLLVARPKVVDSVSAQAAKSLLERSEANVLGIIANAVNLKQEPDSYFHYSDSRI
KHSVAEIESAGGKLAPKSFSK
>gnl|bykdb|A0A2A2TNQ5 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Calothrix elsteri CCALA 953] (length=728 residues).
MPSHEEDTDYINLQEYLLVLKRRWLAAAIVMGSVFGITAFVTYSQKPIYEASGKLLLKQNEASNLTGLNQKLGELSGLTN
TSNPLETEAEIIRSNPLVKKIVNELEMQDKKGKPLEIDDFLKNLKVKSVKGTDVMELTYRGTNPLETAKVINTLMNNYLE
NNIRSNRTEVTAARDFLRKQLPEIENKVVQAEATLRRFKDDNKVVSLAEEAKVGVEGMRNIAEESTRALAVLEEAKSRSG
TLQKQLDLTTQKAVELSTLSQTPGIQQVLAEYQKVQDDLAVARSRFTEEHPSVRNLVAKEQAFRQQMEKRVGRVIGVGES
VKEQDLQIGELKQSLTGELVKSEVERLAALQRVQVLRNAYITYETRMRQLPKLEQRQRGLERRLEVAQTTYQQVQKQLQE
VEVVEQQKVGNARIVSEALVPEKPVAPKIPLNLALGGFLGVLLGAGTALLLEALDKSLKNVDEAKRLLGYPLLGTVPNLA
EKGKMATEIPARDNPYSSGSMAFEMLMTNLAFSVSDQELRVIVVTSSVPGEGKSLVAANLAVAKAQMGKRVLLIDADMRR
PRQHEIWELQNFMGLSNALVGQGEWVNLTKEVVYGLDVLTAGTIPPNPLAIVDSQSMATLIRETGKDYDFVIIDTPPLTL
ASEAQLLGKMADGILLVVRPGVANVDTVGIAKTMIEQSSQRVLGMVVNGVNVDSGSGYYYNKGYYGRKGNEKSEVDGKGV
KLPGIRIG
>gnl|bykdb|A0A2A2TPF8 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Calothrix elsteri CCALA 953] (length=737 residues).
MEKQSNSDDLDLQNYWLVLKRRWLIASGIFLTSVALSGFVISLQRANYEAKGKLLFQANRTNSLTGVDGKFRDLESIRRE
ANPLSTQAVILQSRPILQAVVEKLNLRDKTGKLIEPESLIIKVEPIAGTDVLDVVYISENGKEAAAIVNQLMRSYVENNI
RNNRSEALAARKFIEAQLPRAKGELDKTAEESRRFKEQNQIINLEEESNETVKTIGELDKQLNETRGQLAEATSQQTELR
SQLKIKSDRAVDVASLSLIPGVQEVLGELQKVQSKLATAQSRYTSTHPSIANLKEEEKALTNLLQQRVSQSVPSKNVKID
PNSLQLGALKEQLLGESVRLQAQRLGFENKVQTLTNLHQEYKKRANILPNLEKKQGDLERRLTVAQESYKQLLTRLQEVR
VAENQNVGSARIVQDAAVSNQPVRSKLTMYLAAGGVFVGLMFGIAAAFLIDIIDRSIKTIKEAETIFGYTLLGLIPKFET
NNNAIAQTFIEAASPRIIVATLPRSVIHEAYQMLQANLNFISHKKVRTIVVTSSVAGEGKSEVSANLAAVMAQAGKRVLI
IDADMRNPSQHHLWGVMNLTGLSNVIVGQEQIRRCIQSVTRNLSVLTAGVIPPNPIALLDSQSMNALIQALSASYDYILF
DTPPLAGTADAAVLGKMVDGVLVVVRPGVADTASALATKSLLVRSEANVLGIVANGVNVKQEPDNYFYYNNTRTESSKEQ
LLAQGASSDKEYRNVSK
>gnl|bykdb|A0A2C6WC43 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nostoc linckia z16] (length=737 residues).
MESRETLDLDLNRYLLMLKRWWVPAATIFIATVMLSAVATRFIKPSYEAEGKLLFRIPSFKVVGSNLLPTTTEGGSTGDL
KSLIASQNPINTQIEVISSPALLQKTIDKLQLKDQEGQPLTVKALQKSLILKIIGGTDVLRVTYASLNAEEAAAVVNTVM
NVYLENDILTNRSEAASTRQFIARQLPKTQEAVDKAERELRIFKQKNRIADLTEETKSAVGIIGNLNNEINTVQAQLDEV
NAQTNELRQKVNLSSQNAIAVSALSQSPAVQGILTQLQDIERQLASERSRFQDDNPAIINLEAKKANLRALLQQQISQTV
GSNAQVPQNLLQIGELRQTLIQDFLQSEVQRFGLSQRLASLYNSRTNYQKRVQVIPQLIQNQRELERKLEVAESTYQTLL
KKVQELQLVENTNTASSRIIAQALVPTDPVAGKKFLVLLLGIMLGLFLATTTVLFLGMRDRSLKTLREVRDIFRYTLLGI
VPLSVKKVRSRFSSAESITQKVAVRDMPYSLTSEMYRMIQANLKFLSSDKVLKTIVVTSAVPKEGKSTVSANLAAAIAQL
GRKVLLIDADMRVPSQHHLWELTNAVGLSEVLVGQAEFNTAVSKVMDNLDVLTAGVRPPNPLALLDSKRMASLIDNFSSQ
SNYDFVIIDAPPLLLAADALTLSQMTDGILLVARPGVIDSNSANAAQEMLERSNYNVLGLVVNGIIDKNESSTYMYHGHE
YFQPRELTKEFKGLAKK
>gnl|bykdb|A0A2D0HQT8 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nostoc sp. 'Peltigera malacea cyanobiont' DB3992] (length=735 residues).
MTMESLPNFEEVNIQKYLEVFQRRWLPLVGIFAISVSLGCLYAFSLKPSYKAEGSLMIKTNRSSSLTGLPDDIGRLEALN
VNDNPLETQVRVIGSNPVIEKTINSLNLKDSQGKLLSIPDLAKQLKIEGIKGTDVVQLSYKGGDPKLAAKIVNEVIDSYI
DLNIKANQNEARTAKQVLVTEVPKAEEVVRRAESKLRVFKETNKVVVLEQEAAAAVDTISKLGNQISQALAQLDDVKGRL
EQLSSEAQVDSRQGVIESELSQAPGVQKVLAQLQETESQLALERTRFSPEHPTITNLEEKVLALKNLLKERTGQVAGGAQ
ITQGSLQVGQLRQSLIADITRAQAERVGLERQIATLKQQQNAYIKRANNLPRLEQSQRELERKLQAAQTTYETLLKKRQE
IDIAQNQKIPNARVISYALTPDKAEGPRKMLFIIGGAGVGFFLGIIVAFTLDLIDRSVKTVKEAKEVLRYSVLGVIPTQG
RNGKDHSSIPGLDRPIPKIIGRDIPYFPVGNAYQILQVNLKFLCSDKPLKSIVITSSVAKEGKSDVSANLAVTMAQAGRR
VLLVDADMRHPIQHHIWGLTNTMGLSNIITNQASLDTVVQEVMPNLEVLTSGVLPPNPVAMLDSQRMATLISNFGKDYDL
VIFDTPPLSGIADAAVLSTLTDGILLVVRPGVVDLNSANAAKEFLTQSGQKVLGIVINGVNTKNEPNNYFYDNKKRQIEQ
DLVSSSSLTKFRKER
>gnl|bykdb|A0A2D6FCW3 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanobium sp. ARS6] (length=821 residues).
MSNLIVNPXQTPDFNRHQAQTVNVQDLGRXVVQAADNNDEIDXRELWRALRRRKNLVGVTAAGVLALSGLNTAYQRIFRP
VYQGSFALLITDPLNNESGNRAAAAALDGGMFEELARNTTSNDIPTLIELLQSPLLLSPIAQRYDLNANALAKRITITTG
GEKRKEAEGILNVSVTGRDPVEDKQLLDDLSSTYLQAALQQRQQRLSDGLNFLNKQAPALEAKTEEIQSEVSDFRQRHSL
LEPTTEGGALKQREAAIAAQVLDLEAGRNRLLRVRQEIANGTLTARGFQEAIGGLGNGTTAGGDVQGLTISDVDQSLLQQ
LLKVETELAEARAKYNPDSSMVRGLEARLNQLQPLLRKNQLEAVDAALNLNAGRLETAKAQETSLNNQFLKQPALIKQYE
ALQTRLKIAQENLTGLVTARENFQLEIAQRSVPWRVIDPPEINPNPIKPSIPRNLALGAVLGLVAGAAAGLLRDRMDHVF
HHAGEVKMDLGLPLLGHIPHVDLFKGVREDKRFLLQELDINNPSEEDQNTKQKAKYQRFFYQEAFRNLFTSIRFLNSDQP
LRSIAITSSLPAEGKSLVNVLLAKTLSEMGQKVLLIDADLRKPQLHTRLGLNNLRGLTNVLTDDSNSWRSLLQPVEGYEN
WSVITAGRRPPDPARLLSSNRLHQLVEDLENSGEFDLILFDTAPVLGLADAALVAEHCDGLVLMVSLDRVDRSLPKEAVA
RILSSGAPLLGVVTNCIKREEKGAQAYGFGQYDQYGYGYGGYGYGGYGYAAYDTTAAYAYYANDDETQTAGAARQDKRTS
NTNLKSKLRQRRIQLMHWLDN
>gnl|bykdb|A0A2G7GCS2 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Chroococcales cyanobacterium IPPAS B-1203] (length=688 residues).
MNHIVNIIRRHWMPLLLLNGVILAGTLYAVIYTKTNVAPVWKASAKLNLPQPTTRLDTNLGTLGQLQNSALGFTRELNPL
QIQMTILTSDTVMERALAVDPEKSLYPRLSDYKLAFSATPQEQSTIINLQVKASSPEIAQKRLSNLINVYQLRLNELRHQ
DTNVRKQFSQTDLEDAQAQLAKAQAELANFQQSTGLTEVTEQTRSLINQQRELRTTYTNVLSQAQANQAQAQAASQRLGI
NAQQAMNSLRLGENREYQAIRQKLSDAETALAEARSRYTDESPQVQSLLSQRDELMQIMNQQIAIAAPGASANQIDPTLG
GNGTRDSRIEMIAELIRSQNNAAGLQQQANQIASEINRVNAELNSITQNRSQLINLQRQYEIAEGVYKSILGQVEQTKTN
PFSVYPNVQTLDAPVIDPKPEEPSKRAIALGGILAGLFGSISLIFFLEKRNPMLRPKDLEQVEFPVLGRISRLKRTDMER
NLSGEVAIELQRLASAVLMLEHQRLLVTSPTSGEGKTTVTLGLALALVNFGFRVLIVDGDLRQAELSRRLGQLQKQPKNG
QQTPVSVCLGLDLLPAPNLSKTKIPEYFARGRFQQNLDQIQAEGGYDYVLVDSPPIGLASETNLMSSVVRNVLFVVRSGK
SDRYAVMDGFEQLVQHHAQVMGLVVNYVEPKDVGYRYGRQRELLETEA
>gnl|bykdb|A0A2G7GMH8 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Chroococcales cyanobacterium IPPAS B-1203] (length=737 residues).
MNKDNFAMATEQEAGYGQLLSVLMRRRFLLLSVFFGILSMATVLTIITKPTYKSSMQLLVEPNYQGKTDQGQGKTTESEF
ADSNVEVDIATQINLMSSSILLQRAVSLLQPEYPDIDIKSLRKSLTLSPVQGQDGTGKKVRTKIVEVLYTDNDPQRTQNV
LNAMQQVYQDYNLEQQKLRLAKGLTFINEQLPVIKDRVNQAENALELFRESNNLIDPELQAKALTDALNNVKQEQRTNRN
QIQQTQSRLHNLQQQLARTPRNALVSSRLSQSQRYQNLLNEIQKTELALAQQRLRYTDSSPQVELLLSQRDTQRELLQQE
MQTVVGENAIASEEDTTTAGQQGQLDINLAGELVEAQTNLVSLQANAQSLANAEQQLSAEIQRFPTLLAQYNRLLPEVSV
NRETLQQLMTARQELGLQLARGGFDWQVVEQPGIGEQISPSIKRNLLLGIVVGLTLGCFAAFIREAVDDAVHSSDELKKQ
VALPLLGLIPELPPAKPNGLIKLNKQQTQVLPMLCLQSFRDALDLIYKNIRLLTAFPVKSLAVTSALAGEGKTTLALGLA
IAAARLHQKVLLIDTDLRRPSLHKQLELSNEQGLSTLLTSDRALPCRRRIQLFGAQIDVLTSGPTPVDPVQLLSSSKMKE
MMLAFEQEYDLVLLDTPPVLGRVDAIQTASFCSGAILVARIDRVTRTEITQVTEMLSRTNVFGVIANAAANSPRYSSTYA
ESPRSRFLLNHSAAVER
>gnl|bykdb|A0A2G7GPR0 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Chroococcales cyanobacterium IPPAS B-1203] (length=733 residues).
MESNETIDIDLKRVWLILKRRWLPAAGVFGVVVAAAAALASMQRPVYEAQGKLLFKRADRTTAISGLKDINVGELEAIAT
KANPLNTEIEIIRSVPFVEKTISALNLRNSGGSLMKPQTLATRINAKNVPLTDVLQISYQSEDPEEAAAVVNKVMNLYIE
NNIITNRAEASAAGEFIAKQLPQMEATVRQAELALRQFKEQNQVVALDEEAKTAVAAVKQLENQITETQAQLADTTTRSA
TLQQQVGMNPQEGITLTSLNQSPGIQKVLTEYQQVEAELAVQQTRFVGEHPTILGLQERRDALRALLEERVQGAIGNAAA
TEVSPSNLQMGEIRQELTQNYVNSEIQRLGLTSRLSSLNNTYSAYRQRINVLPRLEQTQRELERRLEAAQSTYETLLRRL
QEVRVAENQNMGNARIIEFATVPENSSVRKRAMILALGNVLALILAILTICILELSDRSVKTLREARERLDYTLLGTIPY
FGKRYANRRNQEWSIPELPVINLPRSPISEAYRMLQANLKFLSSDKPLKVIVVTSAVPKEGKSTVSANLAAAMAQLGRKV
LLIDADMRHPLQHHIWELTNAAGLSDVIVSQAEFESVVTEVIPKLDVLSAGVIPPNPMALLDSKRMASLVQYFTNNYDFV
IIDAPPLVLAADAVTLGKMTDGVLLVARPGVLDSSSAAAAKESLERSGQNVLGLVVNGVIPENESDSYFYYAKEYANEKN
FPVEENAPITTRR
>gnl|bykdb|A0A2H2XGN1 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Calothrix sp. NIES-4071] (length=718 residues).
MQVNAENDSINFRQAWRIMKRRWLAVTVVLSSVVGITGAVTFSQTPIYEAEGKLLFNRANLYSSLTGITESQNIDVPGIN
STNPLETQAEIIRSQPLVQKTIDTLELRNNNGQPLTVEEFSQKLKVAGVKGTDVLEVSYRSPDAKQAANIVNTLIKNYLE
NDIRTNRTEAVAAREFISKQLPEVETKVRSAEYGLRQFKEKNRVVELQEEAKTSIKNQSDLADQIIKSEAQLVDISSQIQ
ALQNQLSLNSRQAVALNTLSQSTAVQPLLNEFRSSQDKLAVERTRYSDEHPIIIDLANKIQVLRQQLQLRIVQILGSTQA
LNERDLQIDPLKQNLIAELVKLEVERTGLSNRVSTLGNAFTLYKQRAGILPRLEQNQRQLERNLQVARQTYEQLLRRYQE
VQVIENKTVGNARIVSEAQVTNRPVSPKLYLNLALGGFLGIILAVGAALMSEALDGSVRTLSEAQELLGYSLLGTIPRLS
ITRPHRNRDISTLPIRDNPWSPASAAFEKLQSTLEYTLPDQVLKSIVITSAVPNEGKSFVSANLALAMAQLGRRVLIIDA
DMRCSRQHEIWKVENSQGLNEILEGTIDLQTAERKVSNNVYLLTAGVTPSNPFAILGSPQMNDLMATAQQEYDFVIIDTP
PVIYAADALVLGKLVDGALVVVRPGAANSAISQEMKTLLKQSNQRVLGMVVNDVTDESDSYYGYGVHKGYYRLPTVAK
>gnl|bykdb|A0A2H2XJQ1 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Calothrix sp. NIES-4071] (length=708 residues).
MEKGFWSVLAVIKRRGLPALITFTAVISGAVAYLKVTPRLYETSARLIFDDKRVSVSELGRDLSQTSVSGSGNSALANQA
ELIKSERILNQALAIAETSEAGRSTITTAELSRGIRIKTIPATSILEISYQSKNPELAATYVNAVAMATIRDNTKSISTE
ATKVRQFLQQQLPQARAQLQAAEAAENKYRQASIIVNYDEQTKSLVQSVASLEDQQRTLATQLQDANSRGESLRQITQAK
GLDRAYESVRSGQDQELQKLRAKLADQETLLIEARLRFTDSHPTVAKLLQQRDALRSLYAQQLARVAPVDTSSSNNSNLN
NVAGDAISQDLTSKLITNEIERAAITDKLRVTQNNIAQLRNRLTQLPLQQQPLTALVRKREEAAASLKFLQAKFEEARIA
EAQKVSNLQVIQVAQPPTEASSPKPKVVLALAGAFGLLLATGVVILLELMDNTLRDASEAEELLKLPLLGVLPRLPDRTL
VLNPANRFLDNVGLVEPYRMLFKSLEFRTSELQLLVVSSTISGEGKSIVASHLAAVSAMLSRRTLIIDADLRRPVQHTIF
NLPAKPGITDIVEGSISLKEAVQPTEIENLSVLTCGELHVRPSQILESPAMKRLISEAVANYDFVIIDTPPLSACADTAT
LAKQSEGVLMVTRPNITIKEVLQRAVSELNNNGIPIVGVVVNGMTTQTEQYYRYPVSGYQMKRIKART
>gnl|bykdb|A0A2H2XPG4 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Calothrix sp. NIES-4071] (length=766 residues).
MENEGYPLQEAEIQKYWLVLKRRWLFVAVTVAASVGVAGIFIVRQHPEYRANGMLLFKSDRISSLTKAGEKIGDLESLMR
QGNPLETQAVIVDSEPVLEEVIRTLDLKDKKGHPLDPDQLKIKIEAIPGTDVLKVSYVSINPELAKKVVNQVMQTYVDKN
IESNRTQVYAAGEFIKKQLPFSRAELESASEALRRFKTENKIIQLSQESTAGINNIAQLDEQINQSKASLADISAQEALI
ASQLNMQSKEAVEVASVSQMSGVQDVLSELQKVETKLAAERGRYTNQHPSIVYLKNQQAALKSILNERAGKALGTTDNIS
TNKLQVGKIKQDLAVQYLQFQGQRQGLEKKIRAMEAVQANYQQRLNVIPNLEKNLGDLERRQTLAQTNFQNLQDRLQEIE
IAEKQTIGNARIIQPARLPNKPVLSRLTLLLAAGSAFAGLLFGVSIAFFVDLIDNSLKTIKETEAFFEYPLLGLIPKFES
NNQDSSKETRLLGRINGLLAKYQQKNQIVSLPSTNFDSKLLPIRLVGLEVSNRIIVASAPHTVIHDAYQMLQANLKFISH
KKVCTLAITSSVAGEGKSEVAANLAAALAQSGRQVLLVDADMRQPAQHRLWGLINSVGLSNVIVGQSDFLLSKKVVNEHL
SILTAGVRPPNPLALIESDRMASLISTFAQDYDYVIFDTPPLAGTADAAILGKMVDGVLLVARPGVVNSASAKAAKSLLE
RSSSNVLGIVANAVNLKHEPDSYFYYSDRNVQVAETEMEVEEWVYK
>gnl|bykdb|A0A2H2Y096 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Calothrix sp. NIES-4071] (length=737 residues).
MNQGFIEEIDVQNYWLVLKRRWLIAAGVLLTFVGLSGVAIYMQKPEYEASGMLLFQSNRTSSLTKVGEKIGDLESVMREG
NPLETQAVILNSEPIIQKVINTLKLKDKKGKLLNPELVKVKVETITGTDVLKISYSSKDPEVASSVVNQVMKTYVEKNIE
SNRSQVFAAGSFIKKQLPDSKAELEQAAEALRQFKNQFQIIELKDESTAAINNVAKIDEEMNQVKAAIAEAIAQETQLRS
QLNIAQNQPVVEIASLNQIPGVQEVLSELQKAQTQLAVQRTRYTEDHPSITSLKNQEINLNNLLRSRIEQVLGPSGMNLV
FGNRQTVSTGKLQIGQIKQNLASQLSQLQTQRQGLEKKILALSNIRDSYKQRLSILPNLEKKQGDLERTLSVAQKNYESL
VNRSQEIQVAERQTVGNARVIQHARVPNKPTLSKSTLALAGGGVFGGLLFGVAVAFFIDLIDNSLKTVKEAEVLFDLTLL
GLIPKFEPSPSTVPSIKGISPRIVIGTYPHTIVHDAYQMLQANLKFISDKKVRTIAVASSVALEGKSEVSANLAAALANA
GRRVLIVDTDMRQPRQHHLWGLINSTGLSNIIVGQEEFSSAVQSITTNLSVLTAGVQPPNPLALIDSQRMASLIDIFSQS
YDYIIFDTPPLVGTADAAVLGKMLDGILLVVQPGIVDSASANAAKNLLKRSEANILGIVANAVNLKQEPSAYFHYSKPRI
GQEVLDVEIVNKQRVYK
>gnl|bykdb|A0A2H2Y561 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Calothrix sp. NIES-4071] (length=729 residues).
MEQQNNRSEDIDIRNYWLALKRRWLVASGIFITTVALSGFAISLQRPTYQASGKLLFQTNRASFLTGVGEKIGDLETVRR
EANPLSTQAEILQSRPILEAVIKKLDLRDKNGNLVKPESLNIKVEPIIGADVLNVSHISSDSRLAADVINYVMRSYVENN
IQTNRLEAVSARKFIENQLPRAEQELNKTTEELRSFKTNNKVINLDKETEETVKNIGELDKQLNEVKGQLAEVTSQQAEL
RAQIKIPSNEAVDRTSLSLIPGVQESLGELQKIQSQLATEATTYTSNHPKIISLRQKEAALNNLLQQRASQSLGTNVKVS
PNKLQLGQLKEQLVGESVRLQAQRLGLENKVQTLSGLHEQFKQRAEVLPNLEKKQGDLERRLMVAQKSYETLLGRLQEIR
VAENQTVGNARVIQNAVVSPNPARLRMMFLLGAGGIFIGALLGVAAAFLVDVIDKSIKTVKEAQDVFGYTMLGLIPKFEN
APTIEQTIEGASPRIVVGTLPRSVIHEAYQMLQANLKFISHKKVRTIVITSSVPGEGKSEVSANLAAVIAQAGKRVLLVD
GDMRNPAQHHLWGVMNLTGLSNVIVGQDRIRSCIQSVTRNLSVLTAGVIPPNPQALLDSESMSALIQALSQHYDYIIFDT
PPLAGTADAAVLGKVVDGVLVVVRPGVADSASALAAKTLLMRSEANVLGMVANGVNIKHEPDRYFYYNSTRDTDNSSLVT
QASNSKTKV
>gnl|bykdb|A0A2H6LC24 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nostoc cycadae WK-1] (length=740 residues).
MSKNSMESRETIDLDINRYLLVLRRRWILILSILAASVGLSVAATTLLKASYEAEAKLLFRMPSFNVVGTNLLPSNNEGE
ETGDLRSLVSTQNPINTQIEVISSPPLLQRTIDKLQLKNDKGEPLKVEELQKNLTLKIVGGTDVLRIAYKSTNPEEAAAV
VNTIIDAYLENDILTSRSEAEATRKFMAKQLPNTQAAVHKAEVALRIFRQKNNIADLTEETRSGVGIIGNLDNEINTVNS
QLAEVTAQSNELRQKINLNSQQAIAVSTLSQSPAVQGVLTQLQEVERQLANERSRFLDDNPIIVSLEARKANLTALLQQQ
VGQTLGTQAQVPQRLLQIGELRQTLIQNFLQLEVQRFGLTNRLASLYNSRSAYGRRMKIIPQLAQTQRELERKVDVAEST
YQTVLKKVQELQVAENKTTPNARVVAQATVPEKPESGKKLIFIALGLTFGAFLSTSAVLFLEMRDKSLKTLKEIREVFGY
TLLGGIPLSTNKMRSRESDGELASPEIAVRDMPHSLTSEMYRMIQANLKFLSSDKVLKTVVVTSAVPKEGKSTVSANLAA
AIAQLGRKVLLIDADMRVPSQHHLWQLTNAAGLSEVLVGQAEFPSAVYQVMDNLDVLTAGVRPPNPLALLDSKRMASLID
NFSAKYDFIIIDAPPLLLAADALTLNQMSDGILLVVRPGVIESSSALTAQEMLQRSSHNVLGLVVNGISEQSESNSYLYQ
AHEYFNPHEVNKKVVLKKQI
>gnl|bykdb|A0A2I8A9F5 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nostoc sp. CENA543] (length=731 residues).
METQNSAEDIDIQKYLLVLKRRWLVIAGVFVLFATLGGTLALKQPKSYEATGKLLFQMNRTSSLTGIGGKIGDLESIGSN
PLDTQALLVRSKPILEEVVNTLNLKDKKGERLKIESVDIQVEAIPGTDGLKVGYVSEDPYLAKAIVNQVMKSYIANNILT
NRSEVMAAGDFIAKQLPGAKTELEEAQKALLQFKTQNKIVNLEEESSGLVKNAITIDSEINNARAQLAETITREKQILNQ
INLPADQAVDISSLSQAAGVQDAFIELQKIQTQLKIQQTRYTDANPIVINLKNQEKALNSLLKQRITEYLGYPIQIETAR
LQIGEIKRDLSLELGKLQSQRLGLEKRITSLSNLKSAYEQRLGAIPDLEKTHGELEQKMLIAQKNYENLLTKYQEIKIVE
SQTIGNARILEYAEVDSSPKASKKKGLTLMVSVFGGLLVGIAVAFLLDVIDRRLKTAKEAEELFGYTLLGLIPKFSNNFN
TTQLEDSALAEPARRVIVETTPRSMIHESFGMLQANLKFISLDKKIRTIAVTSSIAGEGKSEIAANLAAVIAQTGRRVLL
IDADMRRPSQHHLWNLINSAGLSNVVVEQNDFSATVQAVTPSLSVLTSGVTPPNPLALIDSEAMKSLIDNLSKKYDYIVF
DTPPLLGNADAAVLSKLADGVLVVSRIGIVDVTSVNAAKSLLSRSEVNVLGIVANAVDITQEPNYFYYQNPSSEKSMTKQ
DSTDTSIKAEL
>gnl|bykdb|A0A2I8ADV2 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nostoc sp. CENA543] (length=714 residues).
MGRGISTLFAVLRRRGLPAVSTLAAVIGASVAYLAITPRFYATSAKMMVDAKGVSVSELGRDLTQPSVVGRSSNPLADQA
ELVKSQAVLDQAIKTLASKHPQIQLTPTDISSALKVSILPATNILQLNYFHQDPQFAADVLNAVSQAMVEENIQAISSEA
TKVRKFLEKEVPVARNRLQQAEVAESRYRQKSGVVADTDQTKSLVQSLTNLEDQERTLIAQLQEARSREASLRQLTATKN
INNAYTSVRSGQDEQLRSLRAKLTEIETQLIEARLQFTDNHPKVVSLLGQREQIRALYAQQVGRVSANNQTIPTEDVASD
QISQNLTTQLINNEVERVAVENKLQTVQSLRKNLQAQLAVLPLRQQPLTMLTRQREEAAESLKLLQSKLEEARIAEAQKV
SNLRIIELALVPTDYAYPKRSVVLAIAIFFGSILATGVVLLLELMDNRLYEVAEAEELLKLPLLGILPRLPATKLTLEPA
EKFLDDVGLVEPYRMLLKNLEFRSHEKLQVVVVTSTISGEGKSVVVSHLAAVAAMLFRRTLIIDADLRRPVQHTLFNLPP
KPGISDVINGNRTLLNAVQPTDIENLSVLTCGELHGRPSQLLESEAMKSLIAEAAHHYDLVIIDTPPIGVCADASTLSQY
SDGVIMTTRPSVTMKESLQRAVSELQQNRIPILGVIVNGMTTDAEKYYRHPIEEKQSFLPRISLPGSNRNGDRN
>gnl|bykdb|A0A2K3BR24 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Euhalothece sp. KZN 001] (length=723 residues).
MPTTTDQEDYIDLQQYWMALKRRSLSAIIVFASTIGIAAAYSFQQEPIYQAKAKLLFQGESQALALPTLEQQGNAGPLTN
QSQIMQSAPMLQEVIDRLGLKNDEGEPLTPGGMRKNLNVTRLSDTEILEIAYEHPEPEKAATIVNELMNVYRENNVLNNR
SEATAAREFIEEQLPKTEQSVQAAEEKFREFKEENNIIALSQEASSTVDILASLDQQLIQAQASLDDAQTRLEKLTEQLG
LPPEQALAAGALSQSEAVQKVLTEYQAVEQELTLKRSRYQPEHPIIKRLEEQEATLANLLQERVNAVLQEELPSNALADD
NFSLQLSSLKIDLVGDLVKAQINYLAQKSRIKGLKAEKADYQARAKILPKLEQRQRELERQLNASQSTYQALLKRLQEVR
VAENQNLGNARIIESASIPTSPISPRIKLNLALGGILGAMLGIATALALDARDRTVKTVQEVKDRLGYTVLGSIPLVKTK
MDNTSSFLPLRDLPQSSASEAFRMLQANLKFSSVDQKMKVIVLTSSIPNEGKSTVSANLGMALAELGHRVLIIDADLRRP
SQHQVWEEPNAVGLSNVLVEDKEVNSVVKELMQNLDVLTAGAPPPNSTALLDSQRMKDVLNQCSLDYDYVLVDTPPLAVA
ADAAILGRLGQGVLLVVRPSVVAASNLDNTREILQHSGQSLLGMVVNGVIPDNEPDSYYYYYAQDYSYAIDTQAKKVWSK
INF
>gnl|bykdb|A0A2K8SM78 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nostoc flagelliforme CCNUN1] (length=695 residues).
MKPSYEAEGKLLFRIPSFKVVGSNLFPTNAEGGDPGDLKSLLATQNPINTQIEVISSPNLLQRTIDKLQLKDEEGKPLEV
EKLRNSLTLKIVNGTDVLRISYTSRDPEQSAAVVNTIMSLYLENDILTNRSEAAATRQFMAKQLPKTQEAVNNAEVALRI
FKQKHQIANLSEETRSAVETIGNLDNEMNTVRAQLDEVNAQTNELRQKVELNSQEAIAVSALSQSPAVQGVLTQLQDTDR
QLAIERSRFLDDNPVIINLEAKKASLKSLLQQQIGQTVGNQTQIPQSLLQIGELRQNLIQNFLQSEIQRFGLAKRLSSLS
NSRSTYEQRVKIIPQLAQNQRELERKVEVAESTYQTLLKKVQELQLVENTNTASSRIIAQALVPKDPVVGKKIIILLLGV
MFGLFLATTTILFLSMRDRSLKTLKEVRDVFRYTLLGIIPLSVKKVRSRYSNLESITQKIAVRDTPYSLTSEMYRMIQAN
LKFLSSDKVLKTIVVTSAVPKEGKSTVSANLAAAIAQLGRKVLLIDADMRVPSQHHLWQLTNAVGLSEVLVGQAEFDVTV
SKVMDNLDVLTAGVRPPNPLALLDSKRMASLIENFSSQHNYDFVIIDAPPLLLAADALTLSQMTDGILLVARPGVIDSNS
ANAAQEMLERSNYNVLGLVVNGIIDKNESSSYLYHDHEYFKPTKLPKEFQGLAKK
>gnl|bykdb|A0A2K8T1B6 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nostoc flagelliforme CCNUN1] (length=734 residues).
MTMESLPQFEEVNIQKYLEVIQRRWLPLVGIFGISVTLGCLYAFSLKPSYKAEGSLMIKTNRSSSLTGLSQDIGRLEALN
VNDNPLETQVRVIGSNPVIEETINSLNLKDSKGKRLSIPDLAKKLKIEGIKGTDVVQLSYKGSDPELAAKIVNEVIDSYI
DLNIKANQNEALTAKEVLVTEVPKAEEIVRRAESKLRLFKEKNKVVVLGQEASAAVDTISKLGNQISQALAQLDDVKGRL
EQLRSEAKIDSQQGVIASELTQAPGVQKVFAQLQDTESQLALERTRFSPEHPTITNLQEKVVALQSLLKERIGQFAGTGQ
ITEGSLQVGQLRQSLIADITRAQAERVGLERQIATLLRQQDAYIKRANNLPKLEQSQRELERKLQAAQTTYETLLKKRQE
IDIAQNQKIPNARVISYALIPDKAEGPRKILFIVGGGGVGLFLGIIVAFGLDLIDRSLKTVKEAKEVLRYSVLGVIPTQS
RNGRDHSSIAGLDRPIPKIIGRDIPYFPLGNAYQILQVNLKFLCSDKPLRSIVITSSVAKEGKSDVSANLAVTMAQAGRR
VLLVDADMRNPIQHHIWGLKNTIGLSNVIIGEASLDTVAQEVMPNLEVLTSGVLPPNPVAMLDSQRMATLISNFGRDYDL
VIFDTPPLSGIADAAVLSTLTDGILLVVRPGVVDLNSANSAKEFLTQSGQKVLGIVINGVNTKNEPNNYFYGNKKRQIEQ
DLVSSSLTKFSKEH
>gnl|bykdb|A0A2L2NGP0 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nostoc sp. 'Peltigera membranacea cyanobiont' N6] (length=743 residues).
MESRESIDLDLNRYLLILKRWWIPAVGIFVGTVMLSAISTTFMKPSYEAEGKLLFRVPSFKVAGSNLSPGSSEGGDSGDL
KALVATQNPVSTQIEVITSPSLLQRAIDKLKLKDKEDKPLEVKALQKSLTLKIVGGTDVLRITYSSHDPEEAAAVVNTVM
NLYLENDILTNRSEAAATRQFMAKQLPKTQAAVNNAEVALRIFKQKHQIADLSEETKSAVATIGNLDNEMNTVKAQLDEI
NAQTNELRQKVELNSQQAIAVSALSQSPAVQGVLVQLQETDRQLAIEHSRFLDDNPVIINLEAKKANLKSLLQQQIGQTI
GNQTQVPQSLLQIGELRQGLIQNFLQSEIQRFGLTKRLSSLYNSRSSYEQRVKLIPQLAQNQRELERKVEVAESTYQTLL
KKVQELQLVENTNTASSRIIAQALVPKDPIVVKKIIVLVLGVMFGLFFATTTVLFLAMRDKSLKTLREVRDVFGYTLLGI
VPLSVKKVRSRYSNLELPTQTVAVRDTPYSLTSEMYRMIQANLKFLSSDKALKTIVVTSAVPKEGKSTVSANLAAAIAQL
GRQVLLIDADMRVPSQHHFWQLSNAVGLSEVLVGQVEFNMAISKVMDNLDVLTAGVRPPNPLALLDSKRMASLIENSSSQ
HNYDVVIIDAPPLLLAADALTLSQMTDGILLVARPGVIDSNSAAAAQEMLERSSYNVLGLVVNGIIDKNESSSYFNYAKE
YFTHQDLTKEVKPQKRIPDKSSV
>gnl|bykdb|A0A2L2NU95 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nostoc sp. 'Lobaria pulmonaria] (length=734 residues).
MTMESLPSFEEVNIQKYLEVIQRRWLPLVGIFAISVTLGCLYAFSLKPSYKAEGSLMIKTNRSSSLTGLPDDIGRLEALN
VNDNPLETQVRVIGSNPVIEKTINSLNLKDSQGKLLSIPDLAKQLKIEGIKGTDVVQLSYKGGDPELAAKIINEVIDSYI
DLNIKANQNEARTAKQVLVTEVPKAEEVVRRAESKLRLFKETNKVVVLEQEAAAAVDTISKLGNQISQALAQLDDVKGRL
EQLSSEAQVDSRQGVIESELSQAPGVQKVLAQLQETESQLALERTRFSPEHPTITSLEEKVAALNNLLKERTGQVAGKAQ
ITQGSLQVGQLRQSLIADITRAQAERVGLERQIATLKQQQNAYIKRANNLPRLEQSQRELERKLQAAQTTYETLLKKRQE
IDIAQNQKIPNARVISYALIPDKAEGPRKMLFIVGGAGVGFFLGIIVAFTLDLIDRSVKTVKEAKDVLRYSVLGVIPTQA
RNGKDHSSIAGLDRPIPKIIGRDIPYFPVGNAYQILQVNLKFLCSDKPLKSIVITSSVAREGKSDVSANLAVTMAQAGRR
VLLVDADMRHPIQHHIWGLTNTMGLSNVILNQASLDTVVQEVMPNLEVLTSGVLPPNPVAMLDSQRMATLISNFGREYDF
VIFDTPPLSGIADAAVLSTLTDGILLVVRPGVVDLNSANAAKEFLTQSGQKVLGIVINGVNAKNEPNNYFYDTKKRQIEQ
DLVSSSLTKFRKER
>gnl|bykdb|A0A2L2NW47 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nostoc sp. 'Lobaria pulmonaria] (length=742 residues).
MSEKSMESRESIDLDLSRYLLILKRWWLPAFSIFVATVILSAISTQFLKPDYEAEGKLLFRVPSFKVGGNNLSPGTAEGG
DSGDLKPLVATQNPISSQIEVISSPALLQRTIDKLQLKDNEGEPLEVKELLKVLNLKIVGGTDVLRIAYRSHDPEEAAAV
VNTIMRFYLENDILTNRSEAGATRQFMAKQLPTTQAAVDNAEVALRIFKQKHQIADLAEETRSAVATIGNLDNEMNTVKA
QLDEVNAQTNELRQKVELNSQEAIAVSALSQSPAVQGILTQLQETDRQLAVERSRFLDDNPIIINLEAKKANLKSLLQQQ
VGQTIGNQTQVPQSLLQIGELRQSLIQNFLQSEIQRFGLTQRLSSLYNSRVKYEQRVKLIPQLAQNQRELDRKVEVAEST
YQTLLKKVQELQLVENTNTPSSRIIAQALVPEDPTLTKTIIVLVLGVMFGLFFATTTVLFLAMRDRSLKTLKEIRDVFGY
TLLGIVPLSVKKLRSRYSNAESISQTIAVRDTPHSLTSEMYRMIQANLKFLSSDHLLKTIVITSAVPKEGKSTVSANLAA
AIAQLGRQVLLIDADMRVPSQHHLWQLTNEVGLSEVLVGQAEFEIAVSKVMDNLDVLTAGVRPPNPLALLDSKRMASLIE
NFSSQYKYDFVIIDAPPLLLAADALTLSQMTDGILLVARPGIIDSNSANAAQEILERSNYNVLGLVVNGVIDKNESSSYK
YHSHEYFKPRELTKELKGLAKK
>gnl|bykdb|A0A2N6K0T2 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Fischerella muscicola CCMEE 5323] (length=732 residues).
MKESEFHVEEIDFQKYLLVLQRRWMTAVGVFGVIVSLALLYALSTKPTYTAQASLLIKTNRTSSLTGLGEDLGRLESLVQ
DNSPVDTQAKIVTSVPVIQETITSLSLKNDDGEPLRVEDVQKNLKVEGVKGTDVLEVSYTHEDPQLAAKVINKVVDTYIK
QNIQVNREEAISAGKFMLQQLPKTEEAVQKAELALRRFKERNKIIVLQEEATAAVNTISKLEDEIAQAQAQLVDVNARLE
KLQTQARVNSQEAVSAVNLSQVPGTQKVLTELQEAQSQLTVARTRYQPGHPTVIDLEEKVAALRNLLQERVGQVAGNNQP
VSPANLQMGEVRQRLIEDLANTEKERVGLERRIAELTNTWSVYKQRANVLPKLEQTQRELERKLKAAQTTYETLLTRLQE
INVAENQNVGNARIISPALVPDEPSGVRKALIAAGGGVLGILLGIIAALAADLIDRSIKTVREARELFQYTLLGVIPSVS
KTSKNNYSVQGLDRPIPRVVGRDIPHFPVGDAYQMLQANLKFLSDKQLKAITVTSSIPKEGKSEVSANLAVAMAQVERRV
LLVDADMRHPIQHHIWQLRNNQGLSNIIVDQVPLETTVHEVMPNLHVLTSGVIPPNPVALLDSERMATLVDSFIQKYDCV
IFDAPPLAGTADAAVLGKLADGILLVVRPEVVDYASASAAKEFLTQSGQKVLGMVMNGVSVKREPDSYFYYAKDSVESTG
VSQKSILVRNHR
>gnl|bykdb|A0A2N6K4T3 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Fischerella muscicola CCMEE 5323] (length=716 residues).
MEKGLSSLPSILKRRALPALVTFAAVIGGAIAYLQMTPRQYQTSTRLMLDQKRVSVSELGRDLTQLSSDTPGGSNPLADQ
AELIKSQRVLQRALTEVTAESGFRSPENELTVDQLTQGLKVKIVPATNILEVSYLNKDPILATKVVNAVSKAMVEDNTQV
IRQEAANVRKFLETKVPDARKRLQEAEQKENRYRQSSGIVSFDEQTKSIVESLATLEEQENTLSAQLQELRSKEASLQQV
TDAKALNQAYAAVRGGQDEELKALRNKLAEIETQLVQARLSLTDNHPTVINLLGQRNGLRALYQQGLARVSPRNQSISSG
SVAGDQISQDLTSQLIINDVERLAVENKLKVVQTNRANLQARLAQLPIQQQQLTPLTRQREESAESLKLLQSKLEEARIA
EAQLVGNIQIIEAAQPPTKPSLPNKRSVLAIATLFGTALATGIVLLLELMDHTLKDASEAEELLRLPLLGVLPCLPSRAI
ALEPSVRFLDHVGLVEPYRTLFKNLEFRSRESLRSIVVSSTITGEGKSVVASHLAVISAMLSRRTLLIDADLRRPILHTL
FNLAPQPGITDVIDSERSLEETVQQTNIANLCVLTCGELCGYPSRLLESNAISSLLAEATRQYDCVIIDTPPLSACADAH
TLGRQSNGILLVTRPGFTIKEVLKRAVSELTHNQIPIIGVVVNGITNQTEQYYRYPLNGYRFLSSRSLSRNDTRNY
>gnl|bykdb|A0A2N6K7Q9 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Fischerella muscicola CCMEE 5323] (length=728 residues).
METNSYTQEAEIQQYLLILKRRWRLIAAIILASIGLSGSALFMQKPEYQADGILLFKSDRTSSLTKVGEKIGDLEALMRE
GNPLETQAVIVNSHPMLQEVITSLQLKDEQGKLIAPELLKVNVKPIVGTDVLRVSYASNDPELAAAVVNQLMKSYVENNI
QTNRAQVSAAGEFIKEQLPASRQELERAAEALRQFKIQNKVIQLAEESTAAIDIISKLDQEINQVKAALADVSAQEQQIA
SQLNVSENQAVTVTSLSQIPGVQEVLTELQKVQTKLANARAIYTEVHPTITDLKNQQATLNSLLQQRTQEYSGIPIVSPG
KLQIGKIREELTDKYVELKAERQGLEKKIRTLSNIRANYQQQLAMMPSLEKKQQALERRLEAAKTGYENLVTRLQEIQVA
EKQTIGNARIVQPAQIPKKPVISKTKILLAGGSIFAGVLLSIAAAFFVDLIDRSLKTVKETETFFGYTLLGLIPKYKPNN
SVSGVQEIEAGVYPQVIATTSPRTVVHEAYQMLQANLKFISHRKVRKIVVTSSVTAEGKSEVSANLAAVIAQSGKRVLLV
DADMRKPTQHHLWGLINSVGLSHLLVGQGVLSQAVQKVTEFLAVLTAGVIPPNPLALIDSEGMTSLVDIFAENYDYVIFD
TPPLAGIADAAVLGKMADGILLVTRPGVLDAPSAAAAKSLLERSEANVLGIVANAVNAKQEPSSYFYYSSLRDRNSTADL
ERVPQKLK
>gnl|bykdb|A0A2N6KGB9 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Fischerella thermalis CCMEE 5268] (length=732 residues).
MKESEFHVEEIDFQKYLLVLQRRWMTAVGVFGVVFTLALLYALSTKPTYTAQASLLIKTSRTSSLTGLGEDLGRLESLVQ
DNSPVDTQAKIVTSVPVLQETITSLSLKNDEGEPLKVEDLQKKLKVEGVKGTDVLEVSYTHEDPQLAAKVINKIVEEYTK
QNIQANREEAISAGKFMLQQLPKTEEAVQKAELALRRFKERNKIIVLQEEATAAVNTISRLEDEIAQAQAQLVDVNARLE
KLQTQARVNSQEAVSAVDLSQVPGTQKVLTELQEAQSELTVARTRYQPGHPTVANLEEKVSALRSLLQQRIQQVGGNNQQ
ISTANLQMGEVRQKLIEDLANTDKERVGLERRIAELTNTWSVYKQRANILPKLEQTQRELERKLKAAQTTYETLLTRIQE
INVAENQNVSNARIISPALVPDEPSGTRKALIAAGGGVLGIMLGIIAALAVDLIDRSIKTVKEARELFQYTLLGVIPNVS
RNNKNSYSVQGLDRPIPRVVGRDIPHFPVGDAYQMLQANLKFLSYKQLKAITVTSSIPKEGKSEVSANLAVAMAQVERRV
LLVDADMRHPIQHHIWQLSNNQGLSNIIVDQVPLETIVHEVMPNLHVLTSGVMPPNPVALLDSDRMATLVASFTQKYDCV
IFDAPPLAGTADAAVLGKLADGILLVVRPEVVDYASANAAKEFLTQSGQTVLGMVMNGVSVKREPDSYFYYAKDSVESTG
VSRKSILVRNHR
>gnl|bykdb|A0A2N6KJI4 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Fischerella thermalis CCMEE 5268] (length=714 residues).
MEKGLSSLPSILKRRALPALVTFAAVIGGAIAYLQITPRQYQTSTRLMLDQRRVSVSELGRDLTQLNSGTPGGSNPLADQ
AELIKSQRVLQRALTEVTAESGFRSPENELTVDQLSQGLKIKIVPATNILEVSYLNEDPILATKVVNAVSRAMVEDNTQV
IRQEAANVRKFLEKKVPEARKQLQEAEQKENRYRQSSGIVSFDEQTKSLVESLANLEEQENTLSAQLQELRSKEASLQQV
TDAKALNQAYAAVRGGQDEELKALRNKLAEIETQLVQARLSLTDNHPTVINLLGQRNGLRALYQQGLARVSPRNQSISSG
SVAGDQISQDLTSQLIINDVERLALENKLKVVQTNRANLQARLAQLPIQQQQLTPLTRQREESAESLKLLQSKLEEARIA
EAQLVGNIQIIEAAQPPTKPSLPNKRTVLAIAIVFGTALATGIVLLLELMDHTLKDASEAEELLKLPLLGVLPRLPGHAI
ALEPSAQFLDHVGLVEPYRTLFKNLEFRSSEPLRSIVVSSTITGEGKSVVASHLAAISAMLSRRTLLIDADLRRPILHTL
FNLAPRPGITDVIDSERSLEETVQRTNIPNLSVLTCGELHGRPSHLLESEAMKSLLIEAVRQYDFVVIDTPPLSACADAH
TLGRQSDGILLVTRPGFTIKEVLQRAVSELTHNQIPIMGVVVNGITDQTERYYRYPVNGYSSLSSRRLSRGSSA
>gnl|bykdb|A0A2N6KMP5 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Fischerella thermalis CCMEE 5268] (length=725 residues).
METNSYTQATEIQQYLLILKRRWQLITTIIVASIGLSGSVLFMQKPEYQADGILLFKSDRTSSLTKVGEKIGDLEALMRE
GNPLETQAVIVNSHPMLQEVITALQLKDDQGKLIDPELLKVNVKPIVGTDVLRVSYTSNDRELAAAVVNQLMKSYVENNI
QTNRAQVSAAGEFIKEQLPASRQELERAAEALRQFKIQNKVIQLAEESTAAIDIISKLDQEINQVKAALADVSTQEQQIA
SQLNVSENQAVTVTSLSQIPGVQEVLTELQKVQTKLANARAIYTEVHPTITDLKNQQATLNSLLQQRTQEYSGIPIVSPG
KLQIGKIREELTDKYVEFKAERQGLEKKIRTLSNIRANYQQQLAMMPSLEKKQQALERRLEAAKTGYENLVTRLQEIQVA
EKQTIGNARIVQPAQIPKKPVISKTKILLAGGSIFAGVLLSIAAAFFVDLIDRSLKTVKETETFFGYTLLGLIPKYKLNN
SVSGVQQIETGVYPQVITTTSPRTVVHEAYQMLQANLKFISHRKVRKIVVTSSVTAEGKSEVSANLAAVIAQSGKRVLLV
DADMRKPTQHHLWGLINSVGLSHLLVGQGVFSQAVQKVTEFLAVLTAGVIPPNPLALIDSEGMTSLVDIFAENYDYVIFD
TPPLAGIADAAVLGKMADGILLVTRPGVLDAPSAAAAKSLLERSEANVLGIVANAVNAKQEPSSYFYYSNLRDRNSTADL
ERVPQ
>gnl|bykdb|A0A2N6KT20 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Fischerella thermalis CCMEE 5273] (length=714 residues).
MEKGLSSLPSILKRRALPALVTFAAVISGAIAYLQITPRQYQTSTRLMLDQKRVSVSELGRDLTQLNSGTPGGSNPLADQ
AELIKSQRVLQRALTEVTAESGFRSPENELTVDQLSQGLKIKIVPATNILEVSYLNEDPILATKVVNAVSRAMVEDNTQV
IRQEAANVRKFLEKKVPEARKQLQEAEQKENRYRQSSGIVSFDEQTKSLVESLANLEQQENTLSAQLQELRSKEASLQQV
TDAKALNQAYAAVRGGQDEELKALRNKLAEIETQLVQARLSLTDNHPTVINLLGQRNGLGALYQQGLARVSPRNQSISSG
SVAGDQISQDLTSQLIINDVERLALENKLKVVQTNRANLQTRLAQLPIQQQQLTPLTRQREESAESLKLLQSKLEEARIA
EAQLVGNIQIIEAAQPPTQPSLPNKRTVLAIAIVFGTALATGIVLLLELMDHTLKDASEAEELLKLPLLGVLPRLPGHAI
ALEPSAQFLDHVGLVEPYRTLFKNLEFRSSEPLRSIVVSSTITGEGKSVVASHLAAISAMLSRRTLLIDADLRRPILHTL
FNLAPRPGITDVIDSERSLEETVQRTNIPNLSVLTCGELYGRPSHLLESEAMKSLLIEAVRQYDFVVIDTPPLSACADAH
TLGRQSDGSLLVTRPGFTIKEVLQRAVSELTHNQIPIMGVVVNGITDQTERYYRYAVNGYEPLSSRRLSGGGSA
>gnl|bykdb|A0A2N6KXT6 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Fischerella thermalis CCMEE 5273] (length=732 residues).
MKESEFHVEEIDFQKYLLVLQRRWMTAVGVFGVVFTLALLYALSTKPTYTAQASLLIKTSRTSSLTGLGEDLGRLESLVQ
NNSPVDTQAKIVTSVPVLQETITSLSLKNDEGEPLKVEDLQKKLKVEGVKGTDVLEVSYTHQDPQLAAKVINKIVEEYTK
QNIQANREEAISAGKFMLQQLPKTEEAVQKAELALRRFKERNKIIVLQEEATAAVNTISRLEDEIAQAQAQLVDVNARLE
KLQTQARVNSQEAVSAVDLSQVPGTQKVLTELQEAQSELTVARTRYQPGHPTVANLEEKVSALRSLLQQRIQQVGGNNQQ
ISTANLQMGEVRQKLIEDLANTDKERVGLERRIAELTNTWSVYKQRANILPKLEQTQRELERKLKAAQTTYETLLTRIQE
INVAENQNVSNARIISPALVPDEPSGTRKALIAAGGGVLGIMLGIIAALAVDLIDRSIKTVKEARELFQYTLLGVIPNVS
RNNKNSYSVQGLDRPIPRVVGRDIPHFPVGDAYQMLQANLKFLSYKQLKAITVTSSIPKEGKSEVSANLAVAMAQVERRV
LLVDADMRHPIQHHIWQLSNNQGLSNIIVDQVPLETIVHEVMPNLHVLTSGVIPPNPVALLDSDRMATLVASFTQKYDCV
IFDAPPLAGTADAAVLGKLADGILLVVRPEVVDYASANAAKEFLTQSGQTVLGMVMNGVSVKREPDSYFYYAKDSVESTG
VSRKSILVRNHR
>gnl|bykdb|A0A2N6KY52 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Fischerella thermalis CCMEE 5273] (length=728 residues).
METNSYTQATEIQQYLLILKRRWRLITAIILASIGLSGSALFMQKPEYQADGILLFKSDRTSSLTKVGEKIGDLEALMRE
GNPLETQAVIVNSHPMLQEVITALQLKDDQGKLIDPELLKVNVKPIVGTDVLRVSYASNDRELAAAVVNQLMKSYVENNI
QTNRAQVSAAGEFIKEQLPASRQELERAAEALRQFKIQNKVIQLAEESTAAIDIISKLDQEINQVKAALADVSAQEQQIA
SQLNVSENQAVTVTSLSQIPGVQEVLTELQKVQTKLANARAIYTEVHPTITDLKNQQATLNSLLQQRTQEYSGIPIVSPG
KLQIGKIREELTDKYVEFKAERQGLEKKIRTLSNIRANYQQQLAMMPSLEKKQQALERRLEAAKTGYENLVTRLQEIQVA
EKQTIGNARIVQPAQIPKKPVISKTKILLAGGSIFAGVLLSIAAAFFVDLIDRSLKTVKETETFFGYTLLGLIPKYKLNN
SVSGVQEIETGVYPQVITTTSPRTVVHEAYQMLQANLKFISHRKVRKIVVTSSVTAEGKSEVSANLAAVIAQSGKRVLLV
DADMRKPTQHHLWGLINSVGLSHLLVDQGVFSQAVQKVTEFLAVLTAGVIPPNPLALIDSEGMTSLVDIFAENYDYVIFD
TPPLAGIADAAVLGKMADGILLVTRPGVLDAPSAAAAKSLLERSEANVLGIVANAVNAKQEPSSYFYYSNLRDRNSTADL
ERVPQQLK
>gnl|bykdb|A0A2N6L3Y5 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Fischerella thermalis CCMEE 5318] (length=732 residues).
MKESEFHVEEIDFQKYLLVLQRRWMTAVGVFGVVFTLALLYALSTKPTYTAQASLLIKTSRTSSLTGLGEDLGRLESLVQ
DNSPVDTQAKIVTSVPVLQATITSLSLKNDEGEPLKVEDLQKKLKVEGVKGTDVLEVSYTHQDPQLAAKVINKIVEEYTK
QNIQANREEAISAGKFMLQQLPKTEEAVQKAELALRRFKERNKIIVLQEEATAAVNTISRLEDEIAQAQAQLVDVNARLQ
KLQTQARVNSQEAVSAVDLSQVPGTQKVLTELQEAQSELTVARTRYQPGHPTVVNLEEKVSALRSLLQQRIQQVGGNNQQ
ISTANLQMGEVRQKLIEDLANTDKERVGLERRIAELTNTWSVYKQRANILPKLEQTQRELERKLKAAQTTYETLLTRIQE
INVAENQNVSNARIISPALVPDEPSGTRKALIAAGGGVLGIMLGIIAALAVDLIDRSIKTVKEARELFQYTLLGVIPNVS
RNNKNSYSVQGLDRPIPRVVGRDIPHFPVGDAYQMLQANLKFLSYKQLKAITVTSSIPKEGKSEVSANLAVAMAQVERRV
LLVDADMRHPIQHHIWQLSNNQGLSNIIVDQVPLETIVHEVMPNLHVLTSGVMPPNPVALLDSDRMATLVASFTQKYDCV
IFDAPPLAGTADAAVLGKLADGILLVVRPEVVDYASANAAKEFLTQSGQTVLGMVMNGVSVKREPDSYFYYAKDSVESTG
VSRKSILVRNHR
>gnl|bykdb|A0A2N6LL61 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Fischerella thermalis CCMEE 5318] (length=728 residues).
METNSYTQATEIQQYLLILQRRWRLITTIILASIGLSGSALFMQKPEYQADGILLFKSDRTSSLTKVGEKIGDLEALMRE
GNPLETQAVIVNSHPMLQEVITALQLKDDQGKLIDPELLKVNVKPIVGTDVLRVSYASNDPKLAAAVVNQLMKSYVENNI
QTNRAQVSAAGEFIKEQLPASRQELERAAEALRQFKIQNKVIQLAEESTAAIDIIAKLDQEINQVKAALADVSAQEQQIA
SQLNVSENQAVTVTSLSQIPGVQEVLTELQKVQTKLANARAIYTEVHPTITDLKNQQATLNSLLQQRTQEYSGIPIVSPG
KLQIGKIREELTDKYVEFKAERQGLEKKIRTLSNIRANYQQQLAMMPSLEKKQQALERRLEAAKTGYENLVTRLQEIQVA
EKQTIGNARIVQPAQIPKKPVISKTKILLAGGSIFAGVLLSIAAAFFVDLIDRSLKTVKETETFFGYTLLGLIPKYKLNN
SVSGVQEIEAGVYPQVITTTSPRTVVHEAYQMLQANLKFISHRKVRKIVVTSSVTAEGKSEVSANLAAVIAQSGKRVLLV
DADMRKPTQHHLWGLINSVGLSHLLVGQGVFSQAVQKVTEFLAVLTAGVIPPNPLALIDSEGMTSLVDIFAENYDYVIFD
TPPLAGIADAAVLGKMADGILLVTRPGVLDAPSAAAAKSLLERSEANVLGIVANAVNAKQEPSSYFYYSNLRDRNSTADL
ERVPQQLK
>gnl|bykdb|A0A2N6LW63 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Fischerella thermalis CCMEE 5330] (length=732 residues).
MKESEFHVEEIDFQKYLLVLQRRWMTAVGVFGVVFTLALLYALSTKPTYTAQASLLIKTSRTSSLTGLGEDLGRLESLVQ
DNSPVDTQAKIVTSVPVLQATITSLSLKNDEGEPLKVEDLQKKLKVEGVKGTDVLEVSYTHQDPQLAAKVINKIVEEYTK
QNIQANREEAISAGKFMLQQLPKTEEAVQKAELALRRFKERNKIIVLQEEATAAVNTISRLEDEIAQAQAQLVDVNARLE
KLQTQARVNSQEAVSAVDLSQVPGTQKVLTELQEAQSELTVARTRYQPGHPTVANLEEKVSALRSLLQQRVEQVGGNNQQ
ISTANLQMGEVRQKLIEDLANTDKERVGLERRIAELTNTWSVYKQRANILPKLEQTQRELERKLKAAQTTYETLLTRIQE
INVAENQNVSNARIISPALVPDEPSGTRKALIAAGGGVLGIMLGIIAALAVDLIDRSIKTVKEARELFQYTLLGVIPNVS
RNTKNSYSVQGLDRPIPRVVGRDIPHFPVGDAYQMLQANLKFLSYKQLKAITVTSSIPKEGKSEVSANLAVAMAQVERRV
LLVDADMRHPIQHHIWQLSNNQGLSNIIVDQVPLETIVHEVMPNLHVLTSGVMPPNPVALLDSDRMATLVASFTQKYDCV
IFDAPPLAGTADAAVLGKLADGILLVVRPEVVDYASANAAKEFLTQSGQTVLGMVMNGVSVKREPDSYFYYAKDSVESTG
VSRKSILVRNHR
>gnl|bykdb|A0A2N6M5A8 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Fischerella thermalis CCMEE 5330] (length=728 residues).
MENNSYTQATEIQQYLLILKRRWRLITAIILASIGLSGSALFMQKPEYQADGILLFKSDRTSSLTKVGEKIGDLEALMRE
GNPLETQAVIVNSHPMLQEVITALQLKDDQGKLIDPELLKVNVKPIVGTDVLRVSYASNDRELAAAVVNQLMKSYVENNI
QTNRAQVSAAGEFIKEQLPASRQELERAAEALRQFKIQNKVIQLAEESTAAIDIISKLDQEINQVKAALADVSAQEQQIA
SQLNVSENQAVTVTSLSQIPGVQEVLTELQKVQTKLANARAIYTEVHPTITDLKNQQATLNSLLQQRTQEYSGIPIVSPD
KLQIGKIREELTDKYVEFKAERQGLEKKIRTLSNIRANYQQQLAMMPSLEKKQQALERRLEAAKTGYENLVTRLQEIQVA
EKQTIGNARIVQPAQIPKKPVISKTKILLAGGSIFAGVLLSIAAAFFVDLIDRSLKTVKETETFFGYTLLGLIPKYKLNN
SVSGVQEIEAGVYPQVITTTSPRTVVHEAYQMLQANLKFISHRKVRKIVVTSSVTAEGKSEVSANLAAVIAQSGKRVLLV
DADMRKPTQHHLWGLINSVGLSHLLVDQGVFSQAVQKVTEFLSVLTAGVIPPNPLALIDSEGMTSLVDIFAENYDYVIFD
TPPLAGIADAAVLGKMADGILLVTRPGVLDAPSAAAAKSLLERSEANVLGIVANAVNAKQEPSSYFYYSNLRDRNSTADL
ERVPQQLK
>gnl|bykdb|A0A2N6M8A0 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Fischerella thermalis CCMEE 5330] (length=714 residues).
MEKGLSSLPSILKRRALPALVTFAAVIGGAIAYLQITPHQYQTSTRLMLDQKRVSVSELGRDLTQLNSGTPGGSNPLADQ
AELIKSQRVLQRALTEVTAESGFRSPENELTVDQLSQGLKIKIVPATNILEVSYLNEDPILATKVVNAVSRAMVEDNTQV
IRQEAANVRKFLEKKVPEARKQLQEAEQKENRYRQSSGIVSFDEQTKSLVESLATLEQQENTLSAQLQELRSKEASLQQV
TDAKALNQAYAAVRGGQDEELKALRNKLAEIETQLVQARLSLTDNHPTVINLLGQRNGLGALYQQGLARVSPRNQSISSG
SVAGDQISQDLTSQLIINDVERLALENKLKLVQTNRANLQTRLAQLPIQQQQLTPLTRQREESAESLKLLQSKLEEARIA
EAQLVGNIQIIEAAQPPKKPSLPNKRSVLVIAIVFGTALATGIVLLLELMDHTLKDASEAEELLKLPLLGVLPRLPGHAI
ALEPSAQFLDHVGLVEPYRTLFKNLEFRSSEPLRSIVVSSTITGEGKSVVASHLAAISAMLSRRTLLIDADLRRPILHTL
FNLAPRPGITDVIDSERSLEETVQRTNIPNLSVLTCGELHGRPSHLLESEAMKSLLIEAVRQYEFVVLDTPPLSACADAH
TLGRQSDAILLVTRPGFTIKEVLQRAVSELTHNQIPVMGVVVNGITDQTERYYRYPVNSYSSLSSRRLSKGSSA
>gnl|bykdb|A0A2N6M9E1 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Fischerella thermalis CCMEE 5205] (length=714 residues).
MEKGLSSLPSILKRRALPALVTFAAVIGGAIAYLQITPRQYQTSTRLMLDQKRVSVSELGRDLTQLNSGTPGGSNPLADQ
AELIKSQRVLQRALTEVTAESGFRSPENELTVDQLSQGLKVKIVPATNILEVSYLNEDPILATKVVNAVSRAMVEDNTQV
IRQEAANVRKFLEKKVPEARKQLQEAEQKENRYRQSSGIVSFDEQTKSLVESLATLEEQENTLSAQLQELRSKEASLQQV
TDAKALNQAYAAVRGGQDEELKALRNKLAEIETQLVQARLSLTDNHPTVINLLGQRNGLRALYQQGLARVSPRNQSISSG
SVAGDQISQDLTSQLIINDVERLALENKLKVVQTNRANLQARLAQLPIQQQQLTPLTRQREESAESLKLLQSKLEEARIA
EAQLVGNIQIIEAAQPPTQPSLPNKRTVLAIAIVFGTALATGIVLLLELMDHTLKDASEAEELLKLPLLGVLPRLPGHAI
ALEPSAQFLDHVGLVEPYRTLFKNLEFRSSEPLRSIVVSSTITGEGKSVVASHLAAISAMLSRRTLLIDADLRRPILHTL
FNLAPRPGITDVIDSERSLEETVQRTNIPNLSVLTCGELYGRPSHLLESEAMKSLLIEAVRQYEFVVIDTPPLSVCADAH
TLGRQSDGSLLVTRPGFTIKEVLQRAVSELTHNQIPIMGVVVNGITDQTERYYRYAVNGYEPLSSRRLSGGGSA
>gnl|bykdb|A0A2N6MA45 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Fischerella thermalis CCMEE 5205] (length=728 residues).
METNSYTQATEIQQYLLILQRRWRLITTIIVASIGLSGSALFMQKPEYQADGILLFKSDRTSSLTKVGEKIGDLEALMRE
GNPLETQAVIVNSHPMLQEVITALQLKDDQGKLIDPELLKVNVKPIVGTDVLRVSYASNDRELAAAVVNQLMKSYVENNI
QTNRAQVSAAGEFIKEQLPASRQELERAAEALRQFKIQNKVIQLAEESTAAIDIISKLDQEINQVKAALADVSAQEQQIA
SQLNVSENQAVTVTSLSQIPGVQEVLTELQKVQTKLANARAIYTEVHPTITDLKNQQATLNSLLQQRTQEYSGIPIVSPG
KLQIGKIREELTDKYVEFKAERQGLEKKIRTLSNIRANYQQQLAMMPSLEKKQQALERRLEAAKTGYENLVTRLQEIQVA
EKQTIGNARIVQPAQIPKKPVISKTKILLAGGSIFAGVLLSIAAAFFVDLIDRSLKTVKETETFFGYTLLGLIPKYKLNN
SVSGVQQIEAGVYPQVITTTSPRTVVHEAYQMLQANLKFISHRKVRKIVVTSSVTAEGKSEVSANLAAVIAQSGKRVLLV
DADMRKPTQHHLWGLINSVGLSHLLVGQGVFSQAVQKVTEFLAVLTAGVIPPNPLALIDSEGMTSLVDIFAENYDYVIFD
TPPLAGIADAAVLGKMADGILLVTRPGVLDAPSAAAAKSLLERSEANVLGIVANAVNAKQEPSSYFYYSNLRDRNSTTDL
ERVPQQLK
>gnl|bykdb|A0A2N6ML72 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Fischerella thermalis CCMEE 5201] (length=732 residues).
MKESEFHVEEIDFQKYLLVLQRRWMTAVGVFGVIVTLALLHALSTKPTYTAQASLLIKTSRTSSLTGLGEDLGRLESLVQ
DNSPVDTQAKIVTSVPVLQETITSLSLKNDEGEPLKVEDLQKKLKVEGVKGTDVLEVSYTHQDPQLAAKVINKIVEEYTK
QNIQANREEAISAGKFMLQQLPKTEEAVQKAELALRRFKERNKIIVLQEEATAAVNTISRLEDEIAQAQAQLVDVNARLE
KLQTQARVNSQEAVSAVDLSQVPGTQKVLTELQEAQSELTVARTRYQPGHPTVVNLEEKVSALRSLLQQRVQQVGGNNQQ
ISTANLQMGEVRQKLIEDLANTDKERVGLERRIAELTNTWSVYKQRANILPKLEQTQRELERKLKAAQTTYETLLTRIQE
INVAENQNVSNARIISPALVPDEPSGTRKALIAAGGGVLGIMLGIIAALAVDLIDRSIKTVKEARELFQYTLLGVIPNVS
RNNKNSYSVQGLDRPIPRVVGRDIPHFPVGDAYQMLQANLKFLSYKQLKAITVTSSIPREGKSEVSANLAVAMAQVERRV
LLVDADMRHPIQHHIWQLSNNQGLSNIIVDQVPLETIVHEVMPNLHVLTSGVMPPNPVALLDSDRMATLVASFTQKYDCV
IFDAPPLAGTADAAVLGKLADGILLVVRPEVVDYASANAAKEFLTQSGQTVLGMVMNGVSVKREPDSYFYYAKDSVESTG
VSRKSILVRNHR
>gnl|bykdb|A0A2N6MQX9 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Fischerella thermalis CCMEE 5205] (length=732 residues).
MKESEFHVEEIDFQKYLLVLQRRWMTAVGVFGVVFTLALLHALSTKPTYTAQASLLIKTSRTSSLTGLGEDLGRLESLVQ
DNSPVDTQAKIVTSVPVLQETITSLSLKDDEGEPLKVEDLQKKLKVEGVKGTDVLEVSYTHEDPQLAAKVINKIVEEYTK
QNIQANREEAISAGKFMLQQLPKTEEAVQKAELALRRFKERNKIIVLQEEATAAVNTISRLEDEIAQAQAQLVDVNARLE
KLQTQARVNSQEAVSAVDLSQVPGTQKVLTELQEAQSELTVARTRYQPGHPTVANLEEKVSALRSLLQQRIQQVGGNNQQ
ISTANLQMGEVRQKLIEDLANTDKERVGLERRIAELTNTWSVYKQRANILPKLEQTQRELERKLKAAQTTYETLLTRIQE
INVAENQNVSNARIISPALVPDEPSGTRKALIAAGGGVLGIMLGIIAALAVDLIDRSIKTVKEARELFQYTLLGVIPNVS
RNNKNSYSVQGLDRPIPRVVGRDIPHFPVGDAYQMLQANLKFLSYKQLKAITVTSSIPKEGKSEVSANLAVAMAQVERRV
LLVDADMRHPIQHHIWQLSNNQGLSNIIVDQVPLETIVHEVMPNLHVLTSGVMPPNPVALLDSDRMATLVASFTQKYDCV
IFDAPPLAGTADAAVLGKLADGILLVVRPEVVDYASANAAKEFLTQSGQTVLGMVMNGVSVKREPDSYFYYAKDSVESTG
VSRKSILVRNHR
>gnl|bykdb|A0A2N6MXH6 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Fischerella thermalis CCMEE 5201] (length=728 residues).
METNSYTQATEIQQYLLILKRRWRLITAIILASIGLSGSALFMQKPEYQADGILLFKSDRTSSLTKVGEKIGDLEALMRE
GNPLETQAVIVNSHPMLQEVITALQLKDDQGKLIEPELLKVNVKPIVGTDVLRVSYASNDRELAAAVVNQLMKSYVENNI
QTNRAQVSAAGEFIKEQLPASRQELERAAEALRQFKIQNKVIQLAEESTAAIDIISKLDQEINQVKAALADVSAQEQQIA
SQLNVSENQAVTVTSLSQIPGVQEVLTELQKVQTKLANARAIYTEVHPTITDLKNQQATLNSLLQQRTQEYSGIPIVSPG
KLQIGKIREELTDKYVEFKAERQGLEKKIRTLSNIRANYQQQLAMMPSLEKKQQALERRLEAAKTGYENLVTRLQEIQVA
EKQTIGNARIVQPAQIPKKPVISKTKILLAGGSIFAGVLLSIAAAFFVDLIDRSLKTVKETETFFGYTLLGLIPKYKLNN
SVSGVQEIEAGVYPQVITTTSPRTVVHEAYQMLQANLKFISHRKVRKIVVTSSVTAEGKSEVSANLAAVIAQSGKRVLLV
DADMRKPTQHHLWGLINSVGLSHLLVGQGVFSQAVQKVTEFLAVLTAGVIPPNPLALIDSEGMTSLVDIFAENYDYVIFD
TPPLAGIADAAVLGKMADGILLVTRPGVLDAPSAAAAKSLLERSEANVLGIVANAVNAKQEPSSYFYYSNLRDRNSTTDL
ERVPQKLK
>gnl|bykdb|A0A2N6MZ77 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Fischerella thermalis CCMEE 5201] (length=714 residues).
MEKGLSSLPSILKRRALPALVTFAAVIGGAIAYLQITPRQYQTSTRLMLDQKRVSVSELGRDLTQLNSGTPGGSNPLADQ
AELIKSQRVLQRALTEVTAESGFRSPENELTVDQLSQGLKIKIVPATNILEVSYLNEDPILATKVVNAVSRAMVEDNTQV
IRQEAANVRKFLEKKVPEARKQLQEAEQKENRYRQSSGIVSFDEQTKSLVESLANLEEQENTLSAQLQELRSKEASLQQV
TDAKALNQAYAAVRGGQDEELKALRNKLAEIETQLVQARLSLTDNHPTVINLLGQRNGLRALYQQGLARVSPRNQSISSD
SVAGDQISQDLTSQLIINDVERLALENKLKVVQTNRANLQARLAQLPIQQQQLTPLTRQREESAESLKLLQSKLEEARIA
EAQLVGNIQIIEAAQPPTKPSLPNKRTVLAIAIVFGTALATGIVLLLELMDHTLKDASEAEELLKLPLLGVLPRLPGHAI
ALEPSAQFLDHVGLVEPYRTLFKNLEFRSSEPLRSIVVSSTITGEGKSVVASHLAAISAMLSRRTLLIDADLRRPILHTL
FNLAPRPGITDVIDSERSLEETVQRTNIPNLSVLTCGELHGRPSHLLESEAMKSLLIEAVRQYDFVVIDTPPLSACADAH
TLGRQSDGILLVTRPGFTIKEVLQRAVSELTHNQIPIMGVVVNGITDQTERYYRYPVNGYSSLSSRRLSRGSSA
>gnl|bykdb|A0A2P8QIL5 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Chroococcidiopsis sp. CCALA 051] (length=712 residues).
MEQKYALLPTIFYRRRLPALATFISVMLGALVYLIFAPRTYEAEARLMLDGKQLSLAGETGRDLTQESARLDSNPVATQA
ELALSQKVLRQAIYEAYTANNRNSNAEPPTVEELRKQLKVKTVPATSILEIKYSNKDPLIAAKLLNALTEAMINEDTAVI
RREAGSARQFLAVEVPKKRAQLAQVEATLSQYKQSQGIVSIADDQGRDNAQTTSIVESLAQIEEQERTTLAQLQEVKARN
SSLEQVTDSSTLKNTYATVRSGQNEQLQALRTQLVELEAKVASAQSKYKADSPPLLNLIEERDAARALYQQKIGSETGNP
AASTSNPATDKLSQDLATQLITGEVEASALEGRLAAIRRDRATLQERLNQLPIREQGLAALVRQRQEAVTSLEFLQRKLE
EARIAEAQKVSNLRPVDLAEPPRLPTWPNPAIVLVLATVAGGTLALGTVLLQEGLDGTLRNATEASSLVEVPIMGVLPVI
SPEVRGKEYADALMQEPAILESYRSLLRSSEFAANEDIKVIVVSSALSGEGKSLVSSYLAAVAATLSRRTLLIDADLRCP
TQHKLFKLAAKPGLAEVAQGKLALAEAVQTTGIDKLKVLCSGRPRSHPSELFESRQIQQVIAAAASQYDLIVIDTPPVTS
CVDAVSLCGNGEKLLLVARPSFTQRDIFTQAVAELRAKRVEILGVAVNGIDPQIDKYYRYAFQSYKTLTNVS
>gnl|bykdb|A0A2P8QQ72 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Chroococcidiopsis sp. CCALA 051] (length=727 residues).
MESRVESREAVDINLQNLQLAIKRRWLAAAGVFGFVLGLSTIVTLLQAPLYQAEGKLLLKKPSETSSLNPEKYEPRLEPL
SAESNPVSTESEIVSSIPLAQKTIAALTLKDEEGKPLKPTALISQLTLKNIPATDVLQVAYESKDPQEAAAVVNKLMSAY
VDYNIQSNRAEASAAEDFIVKQLPQTESTVRAAEASLRRFKERHQIVSLEHEAISAVEVLKELQDQITLAEAALVQTQGR
ATKLQKEIALTSQDVVPINSLKESPGIQKTLAELQRVEGDLVVLQTRFEDTYPEVQKLQQKRNALKQLLEGRIGQMLGNS
KQVSNRNLEAGELQQKLAEDLVRAEVERLSLSNRLKFLAQARTNYRQRATVLPQLEQQQRELERQVRAAQATYELMLKKL
QELRVEQNRNIGNASIIETALVPETPLLGKRVMTLGLGGIAAILLAIATITLLELSDASIKTLREVKQLFGYTLIGSIPQ
LGKFIKLKPGRQEDCPIPELAVRNSPRSLTAEAYRMLQANLRFLNLDRPLKAVVVTSSVPKEGKSTVCANLAVAIAQLGR
RVLLIDADLRSPIQHHIWQQTNVEGLSHVLVGGTDFQAAVEQVMPNLHVLTAGVVPPNPMALIDSQRMAALVSSLSDRYD
FVIIDAPPLVVAADALTLGKITDGILLVARLGVVDYSNAAAAREALKCSCQTVLGVVANSVPSENRPYSSFHYQSQDNLD
TTVVSSR
>gnl|bykdb|A0A2P8QUE1 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Chroococcidiopsis sp. CCALA 051] (length=747 residues).
MVRVNESNMPMTVEESDGGYGQLLAVLMRRRYWLLGVMGAVLTIATVFTLISKPTYQSEMQLLIEPNYQGKKDGTTPRQG
EQYADSGVTIDDYATQINVMRSSLLIQRAVDILRSEYPTLTVAEVKKNLVLKQVVEEKANTKIVEATYTANDPIKAQKVL
KAVHTVYQIYNREQQEQRLKKGLKFINEQIPAVTKTVDQAENKLEEFRKNNNLIDPEQQAATVNNSLNAIAQEREVIRAQ
YNDLQARYGQLQQQLARSPQQALVASRLSQSSRYQTLLNELQRTELALSQRRVVFTDEDPNVKKLLEQRQNLLSMMKQEG
GRVLGEGQASQAAAAGNAADGILQQGQLGALDLNLAGQLIEVQTNMNAMRARDNSLAQTQQKLRSDLKRFPVLLAEYNRL
VPFVQINRDKLQQLLRAQQELSLEIARGGFDWQALEEPRLGLKVGPNLKLNLLLGLVAGLMLGSLAAFLRDAVDDSVYSS
EDLEKQFELPLLGMTPELPRGRVAQPEVSLPFGKPLHLSPWTVQVRNWPPSWESLDLIYRNLQLMNEMAAFKSLVVTSAV
AGEGKSTLALGLALSAARLHQRVLLIDTDLRRPSLHQILNLPNDYGLSTLLSSDATLPIHNAIQSSGSYIDILTAGPQPE
DPANLLSSQRMRELMAGFEQNYDLILLDAPPLLGMVDAMIAASCCTGVVLVSRVGMVKKTELVQANAMLRKLNVIGVVAN
GVSNVSYGYGAYSREQGVELKKVWGNG
>gnl|bykdb|A0A2P8QVH5 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Chroococcidiopsis sp. CCALA 051] (length=771 residues).
MADTSLDNERLSVEHRVENRANATDLRQLFTVLLRRRLLILSLFCIPLSASSFLALMAKPTYQSSMQLLVSSNLYQGQNS
NAQGGVEESDFTDSNLKVDYTAQLSVMTSPKLVERAVELLRPEYPNITVEEINGKPAKVKQSPLKVTQVESGTKTLQTLS
QVFEVTFVAGDPIKSQKVLQALQNVYQIYNLEQQKLRLTNGLAFVNEQLPKIRKDVSQAEANLENFRKQNKLLDPEVQAK
NLLDALAAVESERRTIRAQFQDQQARYNKLQQQISRSPQQALIASRLSQSPRYQSLLDEIQALDVTLEKLRVQYRDDYPK
VQDLLKQRQNLIGLLRTEAGRSADRLPAQLSTTEKSLPKQLQLGDSDRKLVDALVDAQVVWFGLSARDQSLAKSEQQLRS
TLLKYPQLLAEYNRLMPEIAINRKTLEQLLQTQQNLGIKIAQGGFNWQIIRDPEPGVYMGTGRIMLLVSGAVFGLVLGIG
AAFLLEALDDTIHSCDELQKLSSLPVLGITPKLPNFELKKPSIALPFFKQQSLTSQRIQALNWFPFRESMDLIYQNIQIL
GSPLSFKSLLLTSALTGEGKSTLAAGMALSVARLQRRVLLIDADLRRSNIHKLLNLSNDRGLSTLLTEEADVRERDCIQS
VQPSLDVLTAGPTPTDIVKLLSSQRMKHLIESFEQSYDLVLVDAPPILGLADASIVASLCSGTVVVERLNRVTRFDLNQS
LEALSKLNVIGAIINESKECNSRYTVYDGTSQDNLERGFTTNPNLAGRGIF
>gnl|bykdb|A0A2P8QWJ3 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Chroococcidiopsis sp. CCALA 051] (length=738 residues).
MQERLIETSENLDLDFSKLWIILKRRWLPGTGVFTAILGLAIIAVCLQKPVYEATGKLIVKKNDQTAALTGLGQGIGDLE
GLNLQSNPVNTEIEVVRSIPLLQKTIAALNLKDDRTSEPLKPADIIGKLKLKNIGGTDVMQVTYKSISPDEAAAVVNKLM
NVYLENNIQTNRVTATAAGDFIAKQIPDVEARVRRAESALRRFKEQNHLIALEVEAQGAVTVIQTLEGQIAQVRAELANA
NTKLAKLRQQVGMDTDTSLNLNALNQARGVQRVLTEYQKTEAELAQLRTRYAETYPGISNLKQKRTALKALLSQRISQAV
GKTRTLADGKLQIGESKQKLTEAYIQLEVERLGLASRLASLSGEYNLYKQRANILPKLEQQQRELERQLKAAQSTYEILL
QKLQEVRVAENQNMGNARIIESALAPEKALLFKPMIILAAGILLSVVLSSGTVAVLEIKDTSVKTLKEARELFGYTFLGA
IPSLTKKAAADGKSAEATTIALPVRDTPRAPIAEAFRMLQANLKFSSSDKLKVILVTSSVPGEGKSTVSANLGAAIAQLG
NRVLIVDADMRRPRQHHIWEKANTEGLSDAIVGQVDYQSAIKEVLPKLHILTAGATPPNPVALLDSVQITSLIDNFAKSF
DFVIIDAPPVLVAADALMLGKMTDGLLMVARPGVVSSNTATTARDLLQSSGQKVLGLVVNGVILENESDSYYYYVKDYYM
EEDSTSRQRSTANRKAAS
>gnl|bykdb|A0A2P8VVX1 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][filamentous cyanobacterium CCT1] (length=737 residues).
MVSTSTLPTSTDQEFGYGQLFQILLRRWPWIIASLGVATAGAVFVSLRQEPIYRSNMQLLVEPNYQQELNSSDLSSFADQ
DPRDADYATQLALMRSGQFLQEAVDVLRTDYPEITVDELRAGFTLARLSEGRTGTRIFQASYTANDPTQPQRVLAALQDI
YLNYNQEQQAQRLSRGLDNVNNRLANTQQNLRDSQSALEQFRINQNLIDPNSQAISVVESLNQVQTQQQQLMVELSGLEQ
QYATLEQQLNLSPQSGVIAARLSQSPRIQSLLNSLQEAELALADRQILFTDEDPNVQVLKQQRENQLAQLRAEISAISRQ
NVTELDPTLLSYLQLGGIDFGLVSQILEADVTLESLEARMETLASLESILRDEVNRYPSLMAEYDRLQPAVDTERSTLQE
LLIQREQISAELSRGGFSWEVVEPPLPGQRIGPDPVRPLALGIVAGLFVGGALAFGVESIDQRVRTSDELKKQVPLPLLG
MLPRRPSSLPPLRRSEPDARGLHPELADSDLMKTVMWPQFRDSLDLIANNLQLLQNSHPSKAIAITSALPGEGKTTLTLG
LAFSLARMGQRVLVIDADLRRSGIQAGLGLVAEQGLSGLLTGEPAQNRPHRLDFGSVFVDVLPAGPIPDDPISLLSSPRF
RQLLARGKERYDLILVDTTPLIGMADALKVGAVCDSTVLVTRLDRITQSQLTEAMSLLTHLNVMGLIANGARQSPSRYVY
DSLPSADGQRLPAGASS
>gnl|bykdb|A0A2P8W4F7 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][filamentous cyanobacterium CCT1] (length=768 residues).
MPFPPSSTPRETNGHSNGHGNGHGSGRPEFVPMMAPPSLVEKGDDVDLKRLLGVFKRRAGVFLGVAALSFGGLTLWHLSQ
PPAYSGSVNLLVEPVTNAPPVGLEEVVGAQGNRGALDYDSQIRVLRGPAVIEPILADIQRRYPNITYNALLSRLSIVQEG
ESKVLRVTYNGADPAVVSFVLNQVVEGFVDYSVQDRQGDLRRGLTFLDEQLQEKWQEVEAIESDLSEFQKRYDIVDVNAT
SESVTQRLNQMLADQEQLRVDLTAMEPLYDSLRDQVGFDPDTAIRVANLNESPTYQALLGDLRELEQTIAAESARFQTDT
PMIEALEDQRQQLLPLLEAEAQRLVGEAVEANSLGYKGSVSQGLMQQLVNTANQMQVLQTQDQAIGQVVQQLQAEIQRLA
DLSRSFQQIDRELTVAESSLNQLLASRQELRLQMARQASPWEIISPLSESSITQTTNLPRKLLLSTVIGLMLGGVAALLR
DRMDQAFHSTDELIKTTQLPNLTTIPNAPALQKQPLLIEPNLAVTMADVLTQSQSPEKLYTSFSFAEAFYSLEANLRMLS
SDVPVQVVALTSSVPGEGKSTICAHLAIAAANMGRRVLLIDGDLRKPSQHLIFGQPNRQGLSDLITQAIDDPNDLVLQLP
GNPNLHLLTAGARPPAPGRLLSSRKMQQLTEQYRRHYDLIIFDTPPLSGMIDAKLTAAHADGLLLVVRLHRSERSEIQRV
LADLGNTAQAPLLGLVINGVPQSRQSGYDYYYGYYGRPQVAVGLEENL
>gnl|bykdb|A0A2P8W9H0 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][filamentous cyanobacterium CCT1] (length=749 residues).
MASELQLSSKGALHPEGDQEGGLRLDRFVAALRRHLLLIAGITTLTASAAVLKAITDAPTYQSSFDILTPSSTLETQIIS
TLNPNALSNQTEFGNSTIDETRLRILTSPRVIEPILKELQKSQPSVSYGQLITNLKIVPNQDGEILTVTYSSEDPEQVTD
VLEVVMAGYLRYSLEDRQNDIFRGLDFLDEQLPEVRERVSSLEAELEDLRQRSNLIDPLKQGEQLSTQTAKFTAEQFDLR
LQLEQSQQLYQELQQTLNNDGELAANSALLNSNRYQALLNQLLEVDSQLAADLTLYLENSPEIEVVESRRENLQPLIERE
GLRVQRELASYIRELENRDRALSETIVTLNQTTNRLSTVTRQYNALQRELEIATTNLNQFLTKREALRIDAAQRQTPWEV
LTPPSQPRASAASAKRNLLLGTLLGLLLGAGAAIVVDRFSGKIYTIDELKAAVRLPVLGNIPISSLLNSGGSVLFAVREI
NSIGLTSDFSLPPLSYELRTDQVAMPFLEAFRILATNIRLSNPEQPLKSITVSSAVPNSGKTTVSFHLAYTMALLGYRTL
VVDNDFRRPSLHTLCHLPNEKGLSNYVIGEYDFEDIVVNLPLDEKLFIVTAGPIPPSPLKILAAPRMQEFYDKINQEFDF
IIFDTPPLLGFADTPMIAEKTQGMLLAVHLGEVKYSQLQAALDELQIAQTSVIGMVANYSQEQIDSGYGYYHYYHQSTPV
NGKSNHKTAWTKKDKVSSLANSFFSFLSK
>gnl|bykdb|A0A2P8WHY0 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][filamentous cyanobacterium CCP5] (length=736 residues).
MTHAAYQPIPDEPEFGYGQLLGILLRRWPWIAGTLVLSVAGAVLVFLREDPTYRSSMQLIVEPNYEDDVTARELDGLANA
SDQSIDYNTQLTLMRSEQFLREAVASLEAEYPDLDVDQVVNTFSLQRVGGEERDKATRVFQATYVDSDPIKTQRLLEALK
EAYLEFNEAQQARRLERGLEHTNNRLDNTQKNLQQAQAALEKFRQSQNLIDPTLQSQAVVTSLNEVQSEQRQLMSQLTEL
KSRYQTLEQRTQLSPANALLAARLSQSQRVQQLLNDIQESELALADRQLIFTDQDATVQMLRQELDNNRKQLRQEIAAAI
RRPVETLNPDIASLLQLGGVDLSLVTDLLEADVAIAGISARWESLATQEQSLRQELNRYPSWIAEYDRLQPRVEIERATL
QDLLLQREQISAELARGGFDWQIVEPPDVGDQIGPDPLRPIALGVVAGLFVGGGLAFARDSMDKVVRTSDDLKRQVPLPL
LGILPVQPIRKGFSLPGRQDGGPPILHPELADSDLMQIVQWPTFREALDLVANNVQLMLKGKGNQAIAVTSSLPSEGKTT
VALGLAFSLARMRQRVLVIDADLRRSGIATELGLSTEGNLANLLKGVTRPSRPHRLDFGPGHIDVLPAGDPLNDPITLLS
SPRFQKLIHRCKSIYDVVLVDTPPLTGMADALKIGAVCDNVLLVARLDKITQPQIDVTMALLSQLQVLGIVANGARTVAA
SYSDYGHLSKPVRQTA
>gnl|bykdb|A0A2R5FPC0 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nostoc commune NIES-4072] (length=733 residues).
MESRESIDLDLSRYLLILKRWWLPGTAIFAATVMLSAVATQFMKPSYEAEGKLLFRIPSFKVVGSNLFPTNAEGGDPGDL
KSLLATQNPINTQIEVISSPNLLQRTIDKLGLKDEEGKPIEVEKLRKAVILKIINGTDVLRISYASRDPEQAAAVVNTIM
NLYLENDILTNRSEAAATRQFMAKQLPKTQEAVNNAEVALRIFKQKHQIADLSEETRSAVATIGNLDNEMNTVKAQLDEV
NAQTNELRQKVELNSQEAIAVSALSQSPAVQGVLAQLQDTDRQLAIERSRFLDDNPVIINLQAKKASLQSLLQQQIGQTV
GNQTQIPQRLLQIGDLRQNLIQSFLQSEIQRFGLAKRLSSLSNSRFTYEQRVKIIPQLAQNQRELERKVEVAESTYQTLL
KKVQELQLVENTNTPSSRIIAPAVVPNKPVIGKKIIILLLGVMFGLFLATTTVLFLSMRDRSLKTLKEVRDVFRYTLLGI
IPLSVKKVRRDSNVEPKIAVRDTPYSLTSEMYRMIQANLKFLSSDKVLRTIVVTSAVPKEGKSTVSANLAAAIAQLGRKV
LLIDADMRIPSQHHLWQLTNAVGLSEVLIGQAEFDVTVSRVMDNLDVLTAGVRPPNPLALLDSKRMASLIENFSSQHNYD
FVIIDAPPLLLAADALTLSQMTDGILLVARPGVIDSNSANAAQEMLERSNYNVLGLVVNGIIDKNESSSYLYHDHEYFKP
TKLAKEFQGLAKK
>gnl|bykdb|A0A2R5FRT9 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nostoc commune NIES-4072] (length=734 residues).
MTMESLPHVEEVNIQKYLEVIQRRWLPLVGIFGITVTLGCLYAFSLKPSYKAEGSLMIKTNRSSSLTGLSEDIGRLEALN
VNDNPLETQVRVIGSNPVIEKTINSLNLKDSKGKLLSIPDLAKQLKIEGIKGTDVVQISYKGGNPELAAKIVNEVIDSYI
ELNIKANQNEALIAKEVLVTEVPKAEEIVRRTESKLRLFKEKNKVVVLGQEASAAVDTISKLGNQISQALAQLDDVKGRL
EQLSSEAKIDSKQGVIASELTQAPGVQKVLAQLQETESQLALERTRFSPEHPTITNLQEKVAALQSLLKERIGQFAGTAQ
ITEGSLQVGQLRQSLIADITRAQAERVGLERQIATLVRQQEAYIKRANNLPKLEQTQRELERKLQAAQTTYETLLKKRQE
IDIAQNQKIPNARVISYALIPDKAEGPRKILFIVGGGGIGLFLGIIVAFGLDLVDRSVKSVKEAKEVMKYSVLGVIPTQS
KNGKDNPSIAGLDRAIPKIIGRDIPYFPLGNAYQVLQVNLKFLCSDKPLKSIVITSSVAKEGKSDVSANLAVTMAQAGRR
VLLVDADMRNPMQHHIWGLTNVTGLSNAIAGQVSLDVAIQEVMPNLEVLTSGILPPNPVAMLDSQRMATLISNFGIDYDF
IIFDTPPLSGIADAAVLSTLTDGILLVVRPGVVDLNSANSAKEFLTQSGQKVLGIVINGVNTKNEPNSYFYDNKKQQIQQ
DLVSSSLTKFSKER
>gnl|bykdb|A0A2S0Q8C0 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nodularia spumigena UHCC 0039] (length=730 residues).
MPSYQEDQDEIDLRQYWLAVKRRWFLIVIIIGSVFGITSFVTFNQKPIYEAEGKLIFDKQNSVSSLTGVSEGVGELSGLT
NSSNPLETQAEIIRSHPLIQKTIVDLQLKDQEGEPLKIDHVLGSLKVQAIRGTDLLQLSYRSVDPEVGKAVVNKLMNVYI
DDNVMTNRSQATAAREFLNKQLPLVEKQVAESELALRQFKEKYEVVLLEEEAKQGVERLYQISNQITLLRARLIDASSRS
DALQNQLALNTQKATALSTLSQSRAVQQVLSEYQKVQDQLAVERSRLTDEHPVVVNLLNKEQALKEQLEGRITQTLGSSQ
PIPEQDLQIGELKQALTANLVQVEVERLGLENQVGVLTNAFKQDRARLKILPKLEQQQLQLQRQLQVARTTYEQMLRRLQ
EVQVAENQNVGNARIVSQALLPEKSVSPRINLNLALGGFLGILLAVGSALLLDALDKSVQTAAEAEQLLDYPLLGKIPKM
IRDDNTSELPLLNNPYSSVNTAFEMLQINLGFTISDKELKVIVVSSCLPGEGKSFVAANLAVATAQMGRRVLLIDADMRR
PRQQEVWQVRNLMGLSNVLAGQTNLTQSSQEALVNLDLLTAGTIPPNPAALLDSQRMHELVQQASQDYDCVIIDTPPLTF
IADASIIGKMADGILLIVRPGIVNSDGIRTTKALLKNSRLSVLGMVVNAISGDSGYYYNNYNYYHSKNGAEKKHTIESQF
KEIAGKWLKK
>gnl|bykdb|A0A2S6VEJ8 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Chroococcidiopsis sp. TS-821] (length=734 residues).
MESNETIDIDLKRVWLILKRRWLPAAGVFGVVVAAATALASMQRPVYEAQGKLLFRKADRTAAISGLKDINVGELEALAA
KANPLNTEIEIIRSVPFLEKTITALNLRNDNGSLLKPQVLASRVNARNIPLTDVLQISYQSEDPEEAAAVVNKVMNLYIE
NNIITNRAEASAAGEFIAKQLPQMEATVRQAEQALRQFKEQNQVVALDEEAKTAVAAIKQLENQITETQAQLADTTTRSA
TLQQQVGMNPQEGITLTALNQSPGIQKVLQEYQQVEAELAVQQTRFVGDHPTILSLTERRDALRALLEERVQGAIGNAAA
TEVSPGNLQMGQIRQELTQNYVNSEIQRLGLVSRLNSLNNTYNAYRQRANVLPRLEQTQRELERRLEAAQSTYETLLRRL
QEVRVAENQNMGNARIIEFATVPENASVRKKAMILALGNVLALILAILTICILELSDRSVKTLREARERLDYTLLGTIPY
FGGKRFANRRNQEWSIPELPVINLPRSPISEAYRMLQANLKFLSSDKPLKVIVVTSAVPKEGKSTVSANLAAAMAQLGRK
VLLVDADMRHPLQHHIWELTNAAGLSDVIVSQAEFESVVTEVIPKLDVLSAGVIPPNPMALLDSKRMASLVQYFSDRYDF
VIIDAPPLVLAADAVTLGKMTDGILLVARPGVLDSSSAAAAKESLERSGQNVLGLVANGVIPENESDSYFYYAKEYANEK
NFPIEENPTVTTPR
>gnl|bykdb|A0A2T1CIL7 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Pleurocapsa sp. CCALA 161] (length=731 residues).
MIPTIVPSTHEEQIDFQKYWLVLKRRWLPATMIFTGVTGIFVLSALSKPPTYMAEAQLLIRIDKSSQLVGLEEERGQIEV
IGKDSNPVVTEAEILRSRPILEKAIKQLNLKNDQGNFLKYQEILANLEVKPIVGTDVLQVFYQDSDPKRAASIVNEVIDL
YVQEDTLSNRAAPASAREFIKAQLPKVELTVAKAEEDLRRFKTKNKIANLAQEASNNINATKSLESEIDAVRANLKDVNG
RFEQLRSQLNISWEEAVAISSLSQSAVPQLISELQQVRIDLIEQRDRFSDNAPQVNSLVKREVELEALLENQIEQIQGGK
QLGSLKSKLLSISDGASEQKMVAEYANLGVERSGLLGKLAELESNLQVRQQNLEKLPLLEKQQRELERRVEATQSTYQTL
LGQLQDTQVAENQNVGNVRIIADAIVPEKPTSSTQKKLITLIGSAMGVLLATAFAFLLDFKDRSIKNSKEAEEIFGYPLQ
GVIPDSGYSAETTVSRGMQELSFATSRDNNSSLSIPDLNLAAVRYNEAYNMLQANLKFLTTNWDRKAIAVTSSVPQEGKS
EVASNLAKSMADLGRRVLLIDADLRRPTQHHILGLSNTAGLSNVLLNETEWQEAVQRVMPNLDVLTAGVIPDNPLPLLRL
QRMKTLINSLSNIYDCIIVDTPPLTGVADTTIIGSVVDGILLVVRPGVADYDSAIAVKKLLANTEQHVLGIVANGVNLKN
EPYTQSYVEHY
>gnl|bykdb|A0A2T1CMF9 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Pleurocapsa sp. CCALA 161] (length=723 residues).
MDSNLPIGEHIDFSRYWQVVRRHWIPASATFAGVLALSLIAALASKNIYQAEARLLIEPEQTSRRIGIEDGNPEVKKTVL
EKDPIETEAEILGSRTIVEKVIQELDLKSEKGEPLTYKTVKKALKVEPVIGTDLLQISYENSDPDVAVSFVNRAVELYSD
GYALFNSEAALKDGDFIKQQLPKLETEVENAEANLRNFKNRNGISDLQGQITADIDSVAQVENQINQVSADLNDVNARYN
RLQSQLGVSWQEASAISSLSQSISLQETLAQLQKIKVELAQKSNVLSDSSPQIISLKEEQADLEDLLRQEVAGTLGPQQQ
GLAGQINILRLGELKQGQLTEFADLGLRKEGLEQRLASLKNSYNNYQKRSNLSPQLEEQQRQLERKLKSVTENYQTLLSK
ANEISIRQDYKVDKVRVISVAALAEDPVNPDAKVIVAAGAMMGLLFGTALAFLLDLKDNTIKNTQEVENMFAYPLHGVVP
DLSLGGNNQQFQLPGSEKANLPEQIVSEVSMMPLKEAYQNIQVNLNLLDADAKKKVIAITSSVPQEGKSSVSANLAVARS
QCSQRILLIDADMRRPTQHHIWEISNQIGLSEVLSGKVSWSETVQNVMPNLDVLTSGSMPNNPIALIDSPSFLNFIAEVA
LKYDQVIFDTPPILGIADTRIIGKVVDGFLFVVRPGVADYNSASAAKKMLDSTGLKVLGVIVNGADMKQEPYHYSSHYYA
NKK
>gnl|bykdb|A0A2T1CMT9 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Pleurocapsa sp. CCALA 161] (length=763 residues).
MDQNNWETETQGDLGYGELFSKLWHRRLWFIGAFTGVLAIAVPLALLKPAVYQSYMQILAESNYQAKDLQDNQRDSEEQF
ADANVELDYTTQIKVLTSHEILQRVVNQLKLKDQRSEQASSSYGGVISDSEATTAAIIAALRESIGVYQVLDESTDSNKD
SATKIIQVSYVGSSPVETKKVLTAIQEVYLKYNLEQQEKRLRDALTFINQQIPQARKELTQTETNLTKLTKENNLVSPEA
EATSVKENIRQIAQEREALKAQVGEIAGSSSALQEQLGVSVENALALSRLSQSPRYQNLLNNLKQMEQDLATQQTKFTNY
NPALKSAIEEKKILQDLLSEEAERILGELPPNFSSDLKLLQKQGLVGSDTGIANTVNDSQARLTGIRQRDLSLAQTEAAL
KQRLVGFPELISQYRNLTQESEIKRQAVQRLLEAKQKLEIELSRGGNNWQVIEPPQAGLQIAPNLAKDLLLSLVVASFVG
GFAAFVKDFTDETINTSKEIERRTSLPILGTAPGLSISSSNNLLTRLPFRSISSDTSSIQNVIQWQPFREAIDLIYENLK
LAYLNSSLVGSALKSIAITSAVAGEGKSTLTLGLALSIARDRQKVLVIDADLRSPSLHKSFALTNLSGLTNFLGGEISLP
LIHQVSLSGARIDLITSGTMTEDPVKILNSSRLGRFIEQQKENYDLILVDTPPAIGMVDAIKIASICDTSLIVSRLNKSK
VSKFLEVTALFGKLNVLGIVANDSQDVAKAYGKRPKYLLPQQV
>gnl|bykdb|A0A2T1CMZ0 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Pleurocapsa sp. CCALA 161] (length=730 residues).
MTNLQRNNVYNPNRRAEFDINIEEYLLKLKRRWLPALSVFVVTVGTTLFLTSFLEKTYKSEGKILFKKNTPNELLNLSEN
TNEFNSLLNTQTPLSTEKLRMISEPVLQQTIDQLKLENSLGEPLKVKEFKEKLAIEIVGGSDVISIEYKDPDPIIASKVV
NTLMGVYIKEHVRSNKSATVSADSFISSTIPKIETKLNSLEANLQSFYEKNQVVDLQEEKKSLVDEIGTLNRAISGVGAQ
LQGKKAQTDSLQNQLGLNLKQAISTVQLGNTPQVQSILDQLSTTETELSQERQRFKDNHPAVISLQEKKQNLNSQLQGLI
SQYVGAKVSEGLLQSDNLKDNQIEKFINLKIEELSLQTELSSLYQYQQVYLNRAKQIPSLEQQEQSLLREVDSARSTYKT
LLENKSDLDVLVNQQTGNAQIIESGIVPEEGSTGRLPLIVLGVLTGLFLANLTAILLEMQDHSLKTISEIKQKFAFQVLG
IVPLDTLQNNRGGLVVQREPDSFASEIYRMIQTNLKFLAVKQQPKVILMTSSVPGEGKSLVAANLAAAMAQLGRKVLLID
GDLRKASQHDLWQISNKVGVKDVVAHKTPLAQVVTQPIMQLNVLTSGTIAPNPLALLDSPEMSQLVAAARKEYELVIIDA
PPLAVTADVLTLSKLADGIVFVSRPGVVEHESAELAKETLYNAHLEKQVLGMVINGVKQKEFDRYSYHAKYSKSYFSAST
ETSQTKTVTA
>gnl|bykdb|A0A2T1DJL8 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Phormidesmis priestleyi ULC007] (length=771 residues).
MPSVASQKASFSSRSIASFRRFVWHRSDELSFAKGVPIVAESHLNLIAAADPDPGYGQLLSVLMRRRLWLIGGLGLSLIG
AALFTLFSKPTFRSSMQLLSESNYRSRKTDNPATPSFADSNVEIDNATQLNLMRSSQLLQRAVDQLKLNGSNLDVGDLQK
GLTVSQVIEQRGNDKINTSIFEMVYTGHDRQQTQAVLQAIQQVYQQYNLEQQKARLTKGLGFINEQIPQVEARVNQAEAA
LERFRKNQDLIDPELQSKSMVDSLAAVQKDQRANRTELQDLQARYGALQQQLARSPQQATIAARLSQSPRYQALLNEIQK
TEVAIVQQRLRFKKGPFIDQLSEQRQKQQALLQQEVQRILGAQAAAIAQSGDGLVAIGQLGENDLKFASALVESQVNLVA
AQARDRSLTNNELQLRGELKRFPSLLAEYNRLQPNVQVNRDTLQQLLKARQDLGLEIARGGFDWQVVEQPKVGQQIGPNW
LRNLLLGAVGGLMLGGVAAFLREAADDAVRTSEDFKQQVPLPLLGMVPEVPLGEINPRSIAMPFQKAENLAPSMMQVIHW
APFRESLDLIYKNIQLLTAANPLRSLVVTSALAGEGKSTIALGLAISAARLHQRVLIIDADLRRPGLHKQLELPNEQGLS
TLLSGDRMLSQNAIQLAGTYSDLSISVLTAGPAPSDPVKLLSSRRMKELMTVFEQSYDLVIVDVPPVLGIVDAMLAASFC
DGTLLVGKVGQVTRNEVTQAVTAMNRLNLVGMIANGAAIPGNQYYRNVAVS
>gnl|bykdb|A0A2T1DNG3 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Phormidesmis priestleyi ULC007] (length=729 residues).
MTAAQPKLNLSAATDPGYGQLFAILKRHYLWVLAAGTVSVAIAFAYTLKQESTYISGMQFLVEPNYQGKNSGADPFTDAT
VEVDYATQISLMQSSNLLKKAMTLLQTEYPELDPDNPGSVGGFRGALTIVQVGTKKVDTKIFSITYTSNDPIKTQKVLQA
VQKVYQDYNLQQQQDRLTRGLAFVDKQLPQVEGKVKDAEAALEQFRRDQSLIEPSAEAAAQTEMLNRLQADKQATLVQIR
ELQTRYGDLQQKVNLSPQQAVLTARLNQSGRYQAVLNEIQKTELAIQQQRVRFKENTLNMQPLLDQRQRQLKQLQLEASR
LLGSSSPGSGESLLSTGQLGGFDQTLIGQFVETQGSLSTAQARYLSLLSSEQKVRAELQRFPQLLAQYERLKPDIELNRD
TLKQLLKAQQDLGLEIARGGFAWQVVEQAQIGAKTGPNLQKNLMLGLVVGILLGGVAAVSREVLDDSVHSSDELKQQTAV
PLLGTIPELSLGAMSGKPSLRLSGQTQALLPPITQLTKWRPFRESLDLLYQNLQLINATAELHSIVVTSTLAGEGKSTLS
VGLAISAARLHQRVLLIDADLRRPNLHKLLNLPNEQGLSTLLVSQSPIPQQIETQDANLRGNISVLTAGPTPADPAKLLS
SQRMKEIIATFEQTYDLVIVDAPPALGMVDAVLTASCCSGVLLVGRINQVTRPKLTQSIEMLNQLNLIGVVANGVSSPTV
RETYYSAQD
>gnl|bykdb|A0A2T1DWE8 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Leptolyngbya frigida ULC18] (length=735 residues).
MVVVTVGNLANTVETDPGYGQLVAALFRRKLWLLGIFLTVLSAVTIYTLLKKPIYQSSMQLLVEPNYQSKKDSGAGSENQ
FADSNVEIDYSTQLTQMRSSQLLQKAVVLLQAEYPKLEAAELQKALVLTQVEEDKVKTKIFQAVYTSDDPEKTQKVLMAV
QQVYKDYNREQQKLRLTRGLAFVDEQLPLVEKQVDRAEDAMERFRKSQNLVDPEVQSRALIDALSNLQKEQQTNQAQIRE
VQGRYQTLQQELALSPQQALIAARLSQSSRYQSLLNEIQKSELAIAQQRLRFKAASPYVQQAIDQRQRQRDLLAAEVQRI
LGNNAAQVNVKGDGGLSVGQLSATDLTLANALVDAQVNLVALQGRAQSLNEAERSLQQQLRRFPSLLAEYGRLQPNVQIG
RNTLQQLLKARQDIALEIARGGFDWQVVEEPKLGKQIGPNVKQNILLGAVAGLMLGSVAAFIRDTMDDAVHNADDLKQVA
VPLLGMVPALQYEGGLAALVPFREVGVPAPPIMQVIHWQPFRESLDLIYKNIQLLPSAAGLRSLVVTSALAGEGKSTIAL
GLAISAARLHQRVLLVDADLRRPSLHQQLDLPNNYGLSTLLTRHTPLRHHGDFQPSHRYTDIPLSILTSGPTPTDPAQLL
SAERMGDLVQALEQAYDLIIIDAPPVLGIVDALLTASFCSSMVLVGRIGHVTRAELTQATALLSKLNVIGVIANGSDLTA
NRYLSYERQGQLATL
>gnl|bykdb|A0A2T1E9V8 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Chlorogloea sp. CCALA 695] (length=725 residues).
MEAPENIQFYNYWCIFKRHWLPALAIFSTITGGSYLYTSAKTPIYSAQGQILFKQDKTSSLIGLDSDAQAMDSQSNSSLN
TESRLILSENILRKILDIVNENSSQKTPLSVGDLQAGLEVINIEGTDILQVTYKSNNPEIASLVVNQLMNVYVNRNLLGN
RAAAISAGNFITSQLPKVKANVYNADAAIRKFKEKYKLTDLAQTQRSVAENIERIGSQVDSIEAQLSDLNSRSKGIQQKL
GMSPQEAIVTASVSQSSAVQGVIKELQEVQRKLANARSLYKDDHPIIVQFKEKEAQLNILLNSETTRILQGQKISSYSNL
QVGSIQQDLITTLTKLEIDRLGLITQKTTLLKQQAFYQKKAATLPELQQQQGELERQLLASQSTYETLLKSLQEIKVKEN
RTVGNVQIVEYAEIPVVATNASNKSSMIAASLAGILVAGAVVYFLELTDKKIKTVKEARELFDYRLLGTIPIFNKIAEIG
SGAVPVIEDPRAFISESYRMLQFNLEVASSKALKVIAITSSVPNEGKSTTCANLAAVMAQLEHKVLIIDADFRHPSQHLI
WQISNEEGLMNVIAEKVSFSDRVIQTVRKNLDVITTGESDHNQNILLDSRKMGAFINQCPKQYDYVIIDTPPLAISADAN
ILGKFADGVILVTRPGVADTISSKVVKERLDQSGQNILGIVINGVFADNKFYRYYHAESEYEVSGSKKHNNIKKLLGKLK
FFNRS
>gnl|bykdb|A0A2T1FKP8 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanosarcina cf. burmensis CCALA 770] (length=738 residues).
MQEQLIETSENLDLDFSKLWIILKRRWLPGTGVFTAILGLAIIAVCLQKPVYEATGKLIVKKNDQTAALTGLGQGIGDLE
GLNLQSNPVNTEIEVVRSIPLLQKTIAALNLKDDRTSEPLKPADIIGKLKLKNIGGTDVMQVTYKSISPDEAAAVVNKLM
NVYLENNIQTNRVTATAAGDFIAKQIPDVEARVRRAESALRRFKEQNHLIALEVEAQGAVTVIQTLEGQIAQVRAELANA
NTKLAKLRQQVGMDTDTSLNLNALNQARGVQRVLTEYQKTEAELAQLRTRYAETYPGISNLKQKRTALKALLSQRISQAV
GKTRTLADGKLQIGESKQKLTEAYIQLEVERLGLASRLASLSGEYNLYKQRANILPKLEQQQRELERQLKAAQSTYEILL
QKLQEVRVAENQNMGNARIIESALAPEKALLFKPMIILAAGILLSVVLSSGTVAVLEIKDTSVKTLKEARELFGYTFLGA
IPSLTKKAAADGKNAEATTIALPVRDTPRAPIAEAFRMLQANLKFSSSDKLKVILVTSSVPGEGKSTVSANLGAAIAQLG
NRVLIVDADMRRPRQHHIWEKANTEGLSDAIVGQVDYQSAIKEVLPKLHILTAGATPPNPVALLDSVQITSLIDNFAKSF
DFVIIDAPPVLVAADALMLGKMTDGLLMVARPGVVSSNTATTARDLLQSSGQKVLGLVVNGVILENESDSYYYYVKDYYM
EEDSTNRQRSTANRKAAS
>gnl|bykdb|A0A2T1FLY5 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanosarcina cf. burmensis CCALA 770] (length=712 residues).
MEQKYALLPTIFYRRRLPALATFISVMLGALVYLIFAPRTYEAEARLMLDGKQLSLAGETGRDLTQESARLDSNPVATQA
ELALSQKVLRQAIYEAYTANNRNSNAEPPTVEELRKQLKVKTVPATSILEIKYSNKDPLIAAKLLNALTEAMINEDTAVI
RREAGSARQFLAVEVPKKRAQLAQVEATLSQYKQSQGIVSIADDQGRDNAQTTSIVESLAQIEEQERTTLAQLQEVKARN
SSLEQVTDSSTLKNTYATVRSGQNEQLQALRTQLVELEAKVASAQSKYKADSPPLLNLIEERDAARALYQQKIGSETGNP
AASTPNAATDKLSQDLATQLITGEVEASALEGRLAAIRRDRATLQERLNQLPIREQGLAALVRQRQEAVTSLEFLQRKLE
EARIAEAQKVSNLRPVDLAEPPRLPTWPNPAIVLVLATVAGGTLALGTVLLQEGLDGTLRNATEASSLVEVPIMGVLPVI
SPEVRGKEYADALMQEPAILESYRSLLRSSEFAANEDIKVIVVSSALSGEGKSLVSSYLAAVAATLSRRTLLIDADLRCP
TQHKLFKLAAKPGLAEVAQGKLALAEAVQTTGIDKLKVLCSGRPRSHPSELFESRQIQQVIAAAASQYDLIVIDTPPVTS
CVDAVSLCGNGEKLLLVARPSFTQRDIFTQAVAELRAKRVEILGVAVNGIDPQIDKYYRYAFQSYKTLTNVS
>gnl|bykdb|A0A2T1FP73 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanosarcina cf. burmensis CCALA 770] (length=747 residues).
MVRVNESNMPMTVEESDGGYGQLLAVLMRRRYWLLGVMGAVLTIATVFTLISKPTYQSEMQLLIEPNYQGKKDGTTPRQG
EQYADSGVTIDDYATQINVMRSSLLIQRAVDILRSEYPTLTVAEVKKNLVLKQVVEEKANTKIVEATYTANDPIKAQKVL
KAVHTVYQIYNREQQEQRLKKGLKFINEQIPAVTKTVDQAENKLEEFRKNNNLIDPEQQAATVNNSLNAIAQEREVIRAQ
YNDLQARYGQLQQQLARSPQQALVASRLSQSSRYQTLLNELQRTELALSQRRVVFTDEDPNVKKLLEQRQNLLSMMKQEG
GRVLGEGQASQAAAAGNAADGILQQGQLGALDLNLAGQLIEVQTNMNAMRARDNSLAQTQQKLRSDLKRFPVLLAEYNRL
VPFVQINRDKLQQLLRAQQELSLEIARGGFDWQALEEPRLGLKVGPNLKLNLLLGLVAGLMLGSLAAFLRDAVDDSVHSS
EDLERQFELPLLGMTPELPRGRVAQPEVSLPFGKPLHLSPWTVQVRNWPPSWESLDLIYRNLQLMNEMAAFKSLVVTSAV
AGEGKSTLALGLALSAARLHQRVLLIDTDLRRPSLHQILNLPNDYGLSTLLSSDATLPIHNAIQSSGSYIDILTAGPQPE
DPANLLSSQRMRELMAGFEQNYDLILLDAPPLLGMVDAMIAASCCTGVVLVSRVGMVKKTELVQANAMLRKLNVIGVVAN
GVSNVSYGYGAYSREQGVELKKVWGNG
>gnl|bykdb|A0A2T1FT70 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanosarcina cf. burmensis CCALA 770] (length=771 residues).
MADTSLDNERLSVEHRVENRANATDLRQLFTVLLRRRLLILSLFCIPLSASSFLALMAKPTYQSSMQLLVSSNLYQGQNS
NAQGGVEESDFTDSNLKVDYTAQLSVMTSPKLVERAVELLRPEYPNITVEEINGKPAKVKQSPLKVTQVESGTKTLQTLS
QVFEVTFVAGDPIKSQKVLQALQNVYQIYNLEQQKLRLTNGLAFVNEQLPKIRKDVSQAEANLENFRKQNKLLDPEVQAK
NLLDALAAVESERRTIRAQFQDQQARYNKLQQQISRSPQQALIASRLSQSPRYQSLLDEIQALDVTLEKLRVQYRDDYPK
VQDLLKQRQNLIGLLRTEAGRSADRLPAQLSTTEKSLPKQLQLGDSDRKLVDALVDAQVVWFGLSARDQSLAKSEQQLRS
TLLKYPQLLAEYNRLMPEIAINRKTLEQLLQTQQNLGIKIAQGGFNWQIIRDPEPGVYMGTGRIMLLVSGAVFGLVLGIG
AAFLLEALDDTIHSCDELQKLSSLPVLGITPKLPNFELKKPSIALPFFKQQSLTSQRIQALNWFPFRESMDLIYQNIQIL
GSPLSFKSLLLTSALTGEGKSTLAAGMALSVARLQRRVLLIDADLRRSNIHKLLNLSNDRGLSTLLTEEADVRERDCIQS
VQPSLDVLTAGPTPTDIVKLLSSQRMKHLIESFEQSYDLVLVDAPPILGLADASIVASLCSGTVVVERLNRVTRFDLNQS
LEALSKLNVIGAIINESKECNSRYTVYDGTSQDNLERGFTTNPNLAGRGIF
>gnl|bykdb|A0A2T1FTR8 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Chamaesiphon polymorphus CCALA 037] (length=750 residues).
MDEIAQYWLVLKRRWMPAALVFALTTAVATVWTFKQQEIFQAKGQVILKKTNKTSALLSSATNAASGGAIGELEGLTGST
PVNTQAEILKSLTTIKGALIELRDGKYANRPERKRLDKFINKNESFVQQLKVSSIKNTDLLEVTFQDPSRELSRDVVEKI
MEIYIRDDRTNQRREAEAARKFVAQELPKIENEVKQAENDLRLFKEQYNVVDLPTESVKAVETITSLNKEITSASAQLAA
ETSRLEGLKNLFGGRDAQATIQSGLVSESPGLQKSLKELQEVEAKIATERTRFSDNDPSILNLKEKRQALVEILQKRFKQ
SLVGEQQFQGKLVELQPSGIQGNLIADYAKSEAQRTSLQKQIAALVYVVDAYKQRMNALPKLEQQQNALGRKLETTRTNY
KTLLSKLQEIEIAENQTLGNSRILTHAELPQEALSPKKGQNIAIGGFLGLFLGAATAFLLDGADKRIKTSEEAKSLLPGY
PILGQIPVFEKSRQLPKLSKGAARAPGQLVLTGMTTGIEGESFRMLQTNLQFLNADDSLKVVVVSSSQSGEGKSTVAANL
ALAVAELGKRVLLVDADMRKPAQHLIWRQGNYEGLSNVLSGQCDRKTATTEIQPNLFLVTAGVVPPNPVVLIDSVQMSTS
IAQWSQEYDLVIIDAPPLTVAADAAILGTQAGGLVFVLRPGVADKESVEYAQEILNQSKLKVLGMVLNGVDLDKQSRYNH
YYYSAQTTRGDEGSIGSKLLTGTTTNRTRS
>gnl|bykdb|A0A2T1FXY4 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanosarcina cf. burmensis CCALA 770] (length=727 residues).
MESRESIDLDLSQYLLSLKRRWLPAVSIFATTVTLSVVAATLMRPSYEGEGQLLFKTPSFNVVGSNLLPSISEGQETGDL
RALVSTQNPISSQMEVISSPALLQRTIDELQLKNDRGELQEVEAFKKAVKLKIVGGTDVLRITYKHHDPEKAAAVVNKIM
ELYLENDILTSRSEAEATRLFMAKQLPKTQADVHQAEVKLRIFKQKNNIVDLSEEAKTAVANIGSLDNQIDNLKAELDQA
NTQTKELRQKVGLNPQQASAVSALSQSPAVQGVLIQLQDTERQLASQRSRYLNNNPIIVDLEAKKSNLEALLKKQIKQTV
GSQTKVAAGLLQIGELRQDLIENLLQSDVQRRSLAQKLASLSNSRSTYEQRKNIIPQLVQNQHELERRLVVAQSTYQTLL
KKVQELQVAENKTTAHARIIAQALVPNKPVLEQKLIVLVLGTMFGALLSTSTVLFLELRDRSLKTLEEIRQRFSYTLLGV
IPLVGNKVRSNDWDVESTNPEIAVRDKPHSLTSEIYRMIQANLKFLSPDRVLKTIVVTSAVPKEGKSTVSANLAAAIAQL
GRKVLLIDADMRDSSQHHLWQLTNAAGLSEVLVGQAQLSIATSKVINNLDVLTAGVTPPNPLALLDSQQMAALVEGFSSR
YDFVIIDAPPLLLAADALTLSQMTDGILLVARPGVIDANSANAAQEMLQRSGQNVLGLVVNGIVDKNEYSSYFSHANEGS
VTTGSSI
>gnl|bykdb|A0A2T1GMT4 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Chamaesiphon polymorphus CCALA 037] (length=770 residues).
MESQESIDLNLSHYLFAVKRHWIPAVSIFAATVALSIAATSLLKPSYQAEGRLLFKNSTFRVIGPNLIPNSMEGSESGDL
KSLVSTQNPITTQMEVIASRPLLQKTADRLKLKNDRGKLIAASDLHSGLTTKIVGGADILQVSFKGRNPKDAANIVNTLM
NVYLENDIQASQLEAETARQFIEQQMPKTLAAVNAAESAVRSFKQQNNIVDLSEEAKSAVSVIGNLDNNINAVRSELEQA
NAQSQELYKKVNLNSQDALAVSAISQSPAIQGILTQLQDVDRQLATESSRFSDDNPIIVSLKEKQSKLKTLLSQQIRNTI
GSQAQIPQGLLKIGDLKQNLITELLRSQVQQTGLVNKLNSLQSSRAAYEKRVSVIPKLVQTQRQLERKLEVSQSTYQSLL
KKLQELQVARNKSTSNARIISSAAVPEKPDPGPKLIIGILGGLVGALFGTSAIAYLELRDGSLKTVKEIDKVFGYTLLGM
IPATQRKKNRARATTPEQTTLEIAVRDTPQSITSEMSRTIQSNLRFLGADKPLKTIAITSSVANEGKSKVAANLAAAIAG
MGQKVLLIDADMRVPYQHRFWKLPLKKGLSELIERKSKFQQISWTVMENLDVLTAGGKPSNPLSVLESKHMKSLIQEVSK
FYDFVIIDVPPILVASDALTIGQITDGVLLVSRPGVINAKDAKAVQEKFKMSQCNVLGLIVNGVIQKYETEDYFSASQEY
FSVEEETEVPWTDYMTKLGETIADRSQSDTKFIETDGATTMLGKLTKFNN
>gnl|bykdb|A0A2T1M1V6 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Aphanothece hegewaldii CCALA 016] (length=691 residues).
MNHALSVVRRHWPPLLALNLLLIAATVYVITNIEKFVSPTWKANAQLNIPIKGDKLNANLGTLGNLSDGGSDFTREVNPL
YTQSAILMSDSVLGRVLTVDPEKSEFSNLEDYKKLFTIEPQTQTTVIDLEVEATSPELAYQRVKTLMNSYQKRLNELRQQ
DVKSQDQFAENALKKAQNNLILAQNKLTQFQQSTGLFESETQTQELMQSINKLRATQTEISSEAESHATQARVAAAQLGM
NPQHALNSLRLAENKEYQSIRDKLSATEIELSESRGIYTDKMPQVKSLLLKRDELRREANRQMAQVLPGVSSSQVDVTLG
DSSTDSRTAIVADLIRSQSTAQGLKQQASLLEKELDKLNNEVKFIAKNQGILIELQRKYEIAEGVYKGIIAQLSQNKINA
FDAYPNVQLIDGPSLNPKPLTASRKLIALGGLLASLFGSLSVLLLLESRNPLFNSKDLQQAGLPLVLRFPRLRSLSLEKG
LDEKSEVEFQRLAAIVSSFELENRRLMITSATRSEGKTTLTLGLAWALVQLGFRVLLVDADLRQAEMSRKLGYPQFRRGT
GYPEILLPIHPGFDLMLAPLIQPNKIGEFFLRGEFEQRLNRAQASDNYDFILIDSPPVNLTSETSLMSRLIQNVMFLVRP
GSSDRYSVFDSLEQLKQQDAEIKGLIVNGVETRTANYRYYGNRQELLEAES
>gnl|bykdb|A0A2W1JIN9 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Acaryochloris sp. RCC1774] (length=703 residues).
MDQSLSRLPLVFSRHRWSALAAFSAVMCGLCLYVVFAPRLYTSKVRLILDGTPSTSVSDFGSTIAQQPGNGALANQEEIV
SSKRLLERALQSYRQQWDDPVDIPLSVGELKQSLQTGIVPGTDIFQLQYTSSDPELASRMLNSIAQTVVQENTETIQAEA
KSAREFLEGQIPQRRQELLQVEARMSKFKQEYGYVTLSAEGNNNEANQLLVNSYAQLEGQIRDLTSQIQEVDARNLSLST
LTNAGSINNTYTSVRTGQDPELQNLKSAVTNLESQVAARRTELTDSHPIVIQLVQELDAARTLYNQRLSQLGGGSSVNIA
PESARVGQDLSVQLIQGKIERLSLQERLEAARGSMKQLESRRQQFPILEQWFTQMDRRREALFNSIQLLERKLDEVRVAE
AQLLSNFRILDLSEPSGKPSDPNIPVVLILGTLAGAVLSIGTVILLEALNRKLYSADEIEELVELPVLSTLPRLSKNTLN
LGEPASFYENSAILEAYRALFKALEFRGLEEFHTLVVSSAISGEGKSVVTSYLAAVAAMLSRRTLIIDADLRRPTIHKQF
QLPNKSGLSDILSGDVSLESAAQSTSIDNLSVVTAGSSCVLPSRFFESDGMKILLEEARSSYDLVIVDTPPVTSCVDAMA
VSSEGYPLLLIARPNVTEKDLLKRSAAELIEHNINVLGVAVNDGIPKTDRYYQYRLESYQETA
>gnl|bykdb|A0A2W1JVB9 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Acaryochloris sp. RCC1774] (length=745 residues).
MPAEYQLEEEVIDLGKYWLILKRRWLPATIIFLLMFSTATLAAFLKAPIYQSQGTLRIKESQSGLTELDLGGISPLSGDS
SPLDTEIETILSVPVLQEALKQLKLTDDEGEPLKIFDFEEQLSIKKARAGDVIELAYESEDPEEAALVINTLMKVYLADN
LRINRLEASSARQYIDQELPKTREKIENLEEQLRRFKETNKIVAIDKEAEVAVEAVIRLAEKINEAQGRAISAQAQSDSL
RKQLGIDKQKSIASTTLSQSPGVQVVLQQLQEVEGQLAVEGTRLTPENPILQDLQEQASTLRATLQNRVGEALGVPSSPT
QGTGQLQVGELQQRATSELVRFETERLAAEQVAAALATSQTDFQQRTEAIPALEKQLRQLLRDVEISQEIYANLVRKLQE
IQVLEQQNLGNARILSPALIPEEPIAPRKLLYIFSGFVLGSLLAFGVALLLDSRDKSVKTLEDIKALFSDYTMLGVIPAI
EGVQTKIKEKGASVAADVKRDLYVRDTPNSPPSEAVRMVQSNLKYLNSDKPLKVIVMTSGIPSEGKSTASANLAMAMAEL
GQKVLLVDADLRRPVQHRTWELLNRVGLSDVLVGEATLEDAIQEGETNLDVLTAGVLPPNPSALIDSDHMVNLLQEFGRR
YRYVIIDSPPLSAAADTLTLSRMADGLLLVVRPGVAETGSVALSKELLKQPGHNLLGVIANGVTPDQQPSYSSYYYSYNQ
INHEDSEPSVPIGDVPVKSKDRPRE
>gnl|bykdb|A0A2W4UY24 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Leptolyngbya foveolarum] (length=752 residues).
MPQKELEIDFQKYWLVLKRHWLLALAVCGLTTAAAAFLGSTQALLYKAEGKLLFESSKPVTAIVGLDTGEGNLTPLTSQS
NPLDTQVEIFLSKPIAEKVINQLKIEDSEGAPLEANALLQDMSVRAIPGTDVLAVSYESTSPALAQAVVNAMMAAFIQAN
VQANRTAAIAAQSFVASQLPASKAKVGKIESDLRAFKEANGIVNLEEESQNTVKTLSTVTDSITQLRSDLADKNAQFAQI
QQQLRLNPQEAYAVGLVSESPGVQEVITTLQAVQSQLAIALTRYREGHPEIASLRSQEVALLTLLQTRVGLALGSDQIAL
PDDDLQAGELEQSLILSFLQLDAERAGLQQRLNQLTSAQAAQQSRAQLLPGLEKRNRELERELDAAQTTYETLLASRQQA
QVLEKQDVGNARTISLADLPEESISPALKLYLLAGGVVGALLGIAIAFLADLLETSVKTVTEGQKLYDYPLLGVIPDWRK
RTARNRELDAPRIIVKQRHRVPLVESYQSLQANLKFSYFDGSLKAITVTSAVGGEGKSEISANLALTLAQLGHSVLLIDA
DMRSPIQHHIWDISNLKGLSNLVAGQLPLKQAIVRQEPNLHLLPAGSIPPNPLAIIESKRMASMLEVFKQTYDYIIIDSP
PLLGLADTLTLGRISDGVLLAMRPGVVDSGSIRAVKQLLGQSQSKQRILGIVANGIDDRNGPERYFYHSQEYVADTQWQN
AEDLEAANRYQKDSSAETRVKVEAHGGDNDLR
>gnl|bykdb|A0A2W4W6M5 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Pseudanabaena frigida] (length=738 residues).
MSEYPKAISTGKYVDDSFKLAKFFRVLRKRWIVVAAVSVTVFAGNAYYTFSRTPQYRSNASLLINNSTIAVSDIQVPGLP
SASLINLGTEIGILRSRPLIEVAVSKMRQSPSANTYKEIDAGTIMGGLEIRPEKDALILRLTYTDSDPKRAREVLNALSQ
TYVEYSLSDRRTKSSTAIKFIQDKLPQVKQQLDKSALAVTQFRKTYNIVDPETYAASVYKMREALEVKAQELQIQIAQVQ
QQYKALSRQVGKSPDAAIGGAILQQDIPYQSLVKQFQDVETSYFLERTRFREDHPNVQALKDRRDELYKLLETRAQSVVG
VRGGNVNLTNEPNSTIQQNLATQLFEAQTTLAVSQAQLESIRNAQAEVSSAFSKIPQIQQRYVEIQRQLALDTSTYNKLT
EKLEELRISEAQEISSWKVLEPPLIPTRPSSPDIEKGLIAGAFFGLVLGISSALILNRLDQRIREVEEVREIIDIPLLAS
IPMTEVASLSAMISHGILPTSSYYAFKEALSSLALNLRYLGTDNMMKVIAFTSSVPSEGKSTLTYNLATILAALGYKVLL
VDADMRKPTVHKLTKLSNKVGLSTALATPSPWQDLIQVADDKGNLHVLTSGSIPPNPMLLLESAKMTALLQEWRQEYDYV
LVDTPPVIGITDAQCLTSKVDTFILVAAINRSTRSGISRALEVLSSARANVSGLLINMIGTSDSEYHYGYYDQYYLNPTE
TEEEEPEPTVTAIESSKS
>gnl|bykdb|A0A2W6ZAV2 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanobium sp] (length=762 residues).
MPDPLPSPDELLPPGTLVTLGASSGQVVLIPQEAETQPAPGGSEELKLGNLLPILRRRQRLLVAVFAATVAIGAAATLFQ
RVVSPVYQGDFRLLVSDPIDASSTEGAADSSLRALALQPQDRANTPVLIEVLTSPLLLEPIAQRLNVSPDKIASGLKIVS
GGDASGVMDVSLLWDDRREGQQILEAISAEYLAFSMRQRQERLAQGLEFLDTQAPVLQQGVVELQQQLSSFRRQNSFLDP
SSQGEAIQTQRQALNVRLDDLRQTEAKLLGMASAVGSGMLTGPQVQGSAGDPGSGSQDKPAQGTMTTTTSSLLGDLTDLE
KQLAEAEASFSPTSPQVRSLRSRVNQLRPLLQRRKLDSIKATLAENRSEQAEVNRQALQLSRQFATNPNLVKQYEAIEQR
LEIARANLSTYIKTREDFRLEVAQRTRPWRIISPPEFEDTPDKPNLRNSLMLSILIGGVAGVGAALLRDRLDHVFHQPQD
VEDGLGLPLLGRLPFLPVQDGLSITEVVEGMEPEARFGLRESLRNLFSSFRLLRADKVVRLFSVTSTVELEGKSTASALF
AQTMADLGQRVLLVDADLRRPSLHRLMSVANGEGLSNLLTEPTLQPERLIQPISERLDLITAGPAPPDATKLLSSERCSA
LVEQIRSLPGYDVVLFDTPPSLALSDALLLSEHLDGTVFLVSLQQVDRDLPAQALRRIRSFGVDILGLITNQVTKSSGSD
IYAYGYGYSPIPAGAATTIKATSKRAEWKGANRLMRWLNDRG
>gnl|bykdb|A0A2W6ZXF3 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Pseudanabaena sp] (length=736 residues).
MTEYPKANYVGRYVDDSFKLAKFFRVLRKRWIVIVAVSASVFAGTTYYTFTRTPQYKAGAALLINNSTIAVSDIQVPGLP
GASSINLGTEIGILRSRPLIEIAVAKMRQSPTASSYKEIDAGTIMNGLEIRPERDALILRLIFTDSDPKRAREVLNALSQ
TYVEYSLSDRRTKSSTAIKFIQEKLPQVKQQLDKSALAVTQFRKTYNIVDPETYAASVYSMREALEKQAQDLQIRIAQLQ
QQFEILSRQVGKTPDAAIGSAILQQDVPYQSLVRQFQEVETNYFLERTRFREDHPNVLALKDRRDELYRLLETRAQSVVG
VGVGNNFTNEPNSPIQQGLATQLFETQTTLAVSEAQLESIRSAQSEVSRAFSGIPQIQQRYVEIQRQLALDTSTYNKLTE
KLEELRISEAQEISSWRILEPPLIPTRPSSPDIERSLITGAFVGAVLGILSALALDRLDQRIREVEEVKEIIDIPLLASI
PMTEVASLSAMISQGILPSSSYYAFKEALSSLALNLRYLGTDNMMKVIAFTSSVPSEGKSTLTYNLSTILAALGYRVLLV
DADMRKPTVHKLSKLPNKVGLSTALATPTPWQDLIQSGDEKGNLDVLTSGSIPPNPMLLLESTKMSALIQEWRQVYDYVL
VDTPPVIGITDAQCLTSKVDTFILVAAINRSTRSGISRALEVLASARANVSGLLINMIGSSDSEYHYGYYDQYYLNPAGD
SEEDPEADAGTIELSK
>gnl|bykdb|A0A2W7AN33 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Pseudanabaena sp] (length=733 residues).
MPAYPKATYVGKYVDNSFKFAKVLRVFRDRWTVIATVSVTMLAGSALYTFTRTPQYRSIASLLINSTISAPNIQPTGAST
SSMVDLGTEIAILKSRPLIETAVCKMQQSPTAIPYKDIDTLAIMDGLDIQPEKNAMVLRLIYTDSNPKRAQEVLNALSQT
YVEYSLNNRRTNSSTAIKFIQDKLPQVKQQLDKSALAVTQFRKTYNIVDPDIYAASVYKMREALETQAQDLQIKIAQVQQ
QYEVLSRQVGKSPEAAISSAILQQDAPYQSLVKQFQEVETNYFLEQTRFRGDHPSVIALKDRRDELYRLLETRAQSVVGD
STANITNQPNSAIQQNLASQLFDAQTTLAVSQAQLQSIRNAQSEVSKAFSQIPQIQQKYVEIQRQLAIDSSTYNKLSEKL
EELKVSEAQEISPWKILEPPLIPTRPSSPDILMNLFVGGISGLALGVLLALLLNRLDQRIRDVGEVREIIDVPLLASIPF
TDPVALISMAKGQFPNNNYHAFKEALGSLALNLRHLGMDNLMKVIAFTSSVPSEGKSTLTYNLAVILSSLGYRVLLVDAD
MRKPTIHKLAGLSNKVGLSMALATPSPWQDLIQVGSDHNNLYILTSGSPPPNPMLLLESNKMTTLLEEWKQEYDYVLVDT
PPIIGITDALCLTSKVDTFILVAAINRSTRSGISHALGILSTARANICGLLINMIDSSDSEYHYGYYDRYYLNPSGSVEE
NAEVEAIDCPACE
>gnl|bykdb|A0A2Z5WX66 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Pseudanabaena sp. ABRG5-3] (length=738 residues).
MTEYPKANYAGKYIDDSFKLAKFFRVLRKRWMVIVAVSVTVFAGNTYYTFTRTPQYRSNASLLINNSTIAVSDIQVPGLP
GTSLINLGTEIGILRSRPLIEVAVAKLQQSASSNASKDIDAVTIMNGLEIRPEKDALILRLTYTDSNPKRAREVLTALSE
TYVEYSLKDRRTKSSTAIKFIQGKLPQVKQQLDKSALAVTQFRKTYNIVDPEVYAAAVFKMREALEAQAQDLQIKIAQFQ
QQYKSLSSQVGKSPNAAISSAILQQDTPYQSLVKQFQETETNYFLERTRFREDHPTVKALKDRRDELYKLLETRAQSVVG
LKGSANIAREPNSTIQQTLATQLFETQTSLAVSQAQLESIRSAQAEVAKAFSQIPQIQQKYIEIQRQLALDTSTYNKLTE
KLEELRISEAQEISSWRVLEPPLIPIRPSSPDIEKSLIIGALGGLVLGVLFALLLNRLDQRIREVEEVKEIIDIPLLASI
PMTEVASLGAMLSQGILPTSSYYAFKEALSSLALNLRYLGTDNTMKVIAFTSSVPSEGKSTLTYNLSTILAALGYKVLLV
DADMRKPTVHKLTNLSNKSGLSTALATPNPWQDLVQVADETGNLHVLTSGSLPPNPMLLLESTKMTALLQEWRQAYDYVL
VDTPPVIGITDAQCLTSKVDTFILVAAINRSTRGGIARALEILSTARANVSGLLINMIGSSDSEYHYGYYDQYYLNPKGT
EEEIEPDSEVTAIEIAKP
>gnl|bykdb|A0A2Z6CPH0 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nostoc sp. HK-01] (length=748 residues).
MAKNIMESRESLDLDFSHYLMILKRRWLCVTSIVIGTIALSALAATLIKPSYEAEGKLLFRMPSFKTVGTNLLPNNNEGD
QAGDLKSLVSTQNPISTQIEVISSPLLLEQIIDKIQLKDENGESLKVEELQKKLKLKIIGGTDVLRVSYQSNNPEEAAAV
VNTLMNLYLENDILTSRAEAEATRKFMAKQLPISQASVNRAEVALRVFRQKNNIADLSEETKSSVGIIANLDNEINAIQA
QLAEVNAQSSELRQKLGLNSQNALAVSALSQSPAVQGVLTQLQDVERQLANERSRFLDDNPVIVGLEARKANLTNLLQQQ
ITQTLGQQSQFAPRLLQIGELRQNLIQNFLQLEVQSFGFKQRLASLYNSRSVYERRMRFIPQLIQTQHELERKVEVDQST
YQNLLKKVQELQLAENRNTANARIIAQALVPEKPTSGKKLIILVMGVMFGAFLSTTTVLFLEMRDKSLKTLKEIREVFEY
PLLGVIPLSAHKTHSRKLDTKKLTTPEIAVRDMPHSLTSEIYRMIQANLKFLSSDKVLKTIVVTSSVPKEGKSTVSANLA
AAIAQLGRRVLLIDADMRVPSQHHLWQLTNVAGLSEVLVGQSEVDTAVNQVMDNLNVLTAGVRPPNPLALLDSKRMAALI
KDFSSKYDCVIIDAPPALLAADALALSQMSDGILLVGRPGVIDSSSASAVQEMLDRANHQVLGLVVNGIIDKNESSKYFY
HTSEYFSPQEFKKEVVLQKQIGDRSSSL
>gnl|bykdb|A0A318AJV1 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nostoc sp. 3335mG] (length=713 residues).
MLKQTSDHRVSHLAPPQDQARLGDAVAAAKRMLRRRWATMLGVSSVVFVVALSVVACLPPRYVAVARIRIDPSLNPMSQD
QGQGVIGAETMETEAGLMASRGLAVAVVRKLHLDRDPEFASPSRLTHRPATPDQIVTRVTKSVGVSRDQLSYIISLGFKS
RDAAKSSRIANAFADTYLDMRVHGEASSSVQQAAFFRQRLDELARQVNDADTRLAAYRAGTGLSADGAGSNVVDQQIATL
SGQLANAEAEAAGARSSASVAQGQVRSGNVDAVVGVQGSNVIRDLRSQRADIVRNLGEVEGRYGPKHPESIRAHQQLADI
DQQIRDEAQRVVGSLQAQARAGDAQVASLRSTMAGLEAARARNTRNSADAERLERDAASARAQFDKMSAMSLESTQAAHA
AIAQAQIIDRADPPVSPAPPGKVLLSGLAMLASLGCGLATVIVMEMLQGGLRTIGEVEARLGLPVLASVPAEGGRRWFRS
RGRVSPADLIGVAGATVYSEAIRNLRASLIGVRQASGMRVIGFTSALPGEGKSNTALAFARMLAVNGARVLLVDADLRNS
KFPGSMAIGPGKGLIEALRGRAPLVATVIPDRIGGLDILPVAQTLFISRDIFSPSTVQNLLENGRALYDFVVMDLPPVLG
VADARLLAAMADANVFVVRWGSTPPEAASLALSSLDADGVNVHGAVYTMVDPAAEAIGGLYYSQNSARYYRAA
>gnl|bykdb|A0A318B4H2 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nostoc sp. 3335mG] (length=743 residues).
MNTNLTYEEAPFDPSAASVVTPVAVDKPAGQRLDERAVSALERYWRAMLNRRLLILAVLLASMTVGVIVYLMATPQYLAT
ARIEIQRSQAKVVNVGGLEMEDRSRDLQFYETQYNLLKARSLAERVARVLGLQNDDKFFAMYGGEEPSAAAPRTRSAQEQ
GKRLDQAASILLDNITVEPIGASALVDITFKSPSAELSSKVANSWAAEYIQSNLDRRFATTADARGFLEQRLAQLRSRLE
ASERELVAYASGKGIVSFSSGSTEKGGGGGERTLVTDDLSSLNTALNAAVAERVAAESAVRAASVSPNSASQGTIASLRQ
KRAELSARYSALLTKFEPGYPEAEALRTEIMGLDKAIAQEGGRSRSDAEAALRAAQSKEAQFREQVANLTKNFNTQRTNL
IEYQILQREVDTNRTLYDGLLQRYKEIGVAGVGSNNVAIVDAAEVPGGPSEPNLNKTLLVSLLIGLVLAVGLVVLAEEID
QSLRDPADVQRELGLPLLGTIPKVEDKDVAEELQNKKTQLYESYLAVRTNLSFLTDHGAPGVLMLTSSRPNEGKSLSAYA
LSRLFAETGASVVLIDADMRNTRLDDLVALDARPGLSNYLSGANEIGDVLQEPRGEGFAMIPAGPTPPNAAELLSSDRFK
DMLATLRQRYRHVIIDAPPVLGLADAPLLSRTVDGILFVVESNVGKLRMVRGALRRLELPGAKVFGAVVTKLDNRNNSYG
YGYGYGYGYGYGRKRDGQEDAKA
>gnl|bykdb|A0A318BG22 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nostoc sp. 3335mG] (length=733 residues).
MIRSLTNDTRPGPIDDLQSRRGAMRPAAEVEQWDGGSISLQRYVATLTKHRLLILGTTIAAALLALIVTMLTEPRYVART
TFEVQREAPRVLDVNSAESDSRPSDSMFMETQLAFIRSRAMAEGIVKRLHLDQNDAFVDDAATGGGDGKAPAVRQRRIDA
ATAVVMRNIEAAPLVGSSVIELRYTSNDARLSAAIANAAVDQFIESTTQRQYAASSYARSFVGNRLTQQRARLEESERQL
VAYAEQNGIISVTDAKTAGTGSGAQSLDSASMAALNDRVAAARANRILAEQAWNLARSPRADSLPEVRDNVQIAALTGQL
ATLEADYQQKRQTYKPGYAPMEALAAQIASVRGQIATLRGRIVGGFRAAYELALNQERALQVQLDQLKGSVSDLQTRSIQ
YMILQREVDTNRALYDALLQRFKEIGVAGGSGANNVSVIDTARAPGAPASPILWLNLLLAIGFGVLAGVGIAFIIEFVDD
SIKMPDDVEQKLHLPLLGITPTVEGAEIPALLANKRSSLSEAYYSIQTALQLATPGGLPRTLLVTSAAMAEGKSTTSAAL
AQGVADRGKRVLLVDADLRKPTLHHRFAQTNQVGFSNLLTGELPLSDVRIRLQDQGFDIITSGPLPPNPALLLSSGLQSQ
IDALMADYDLVILDGPPVMGLADAPLLADVAEATVLVIEARRSRRGAIRSALRRLGDARGMLAGVVLTKFSSRDAGYGGY
YYSSYYSYGQPSS
>gnl|bykdb|A0A318BJ18 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nostoc sp. 3335mG] (length=737 residues).
MSFISSNLGSPGAIGSAQSAIASPTIADGPSVLRHYLRIAMRWRWVILGVTIACVLLGLVVTLLMTPTYTATATVEIARE
ASQVTNFQGVERQSSLVDQEFYETQYGLLRSRALSERVATQLRLVDDPKFYEMYKFNSDDPAFQLVNGRYTSTGRAERVR
IAGEILRDNLTIGSTRLSRLVDITFSSPDPDFSARIANAWAENFIQTNLERKIQATSYGRNLLQRQLALQKERLDDSQRQ
LVAYASAQQIINLPAPGSGIGGTTTVERSIVADDLAALNASLAQATAERIQAEARSQQGGRAGASAEALRNQAINNLRQR
RAELSAEYQRLMVQFEPGYPAALAIQNQIDQLDRSIAREESRVSGSIQAEYREAVQRENALQARVNQLKASYLDNRRRSI
QYNIYQQEVDTNRALYDGLLQRYKEVGVAGGVGVNNISVVDTADAPRHPSSPKLLINLLLSLLAGLGIGALAAFVLEQMD
EAIADPIEVTRRLGLPLLGSVPKTAEGTTPREQLLDRKSNLVDAYLAINTNLGFTTEHGVPRSFLVTSTRPAEGKSTTAL
ALATMLARAGKRTILVDGDMRSPSVHQLGGVDHDHGLSNFLSGEDDIDSLVFSMSDLGFSAMTAGPIPPNAAELLTGQRL
NILLDRLLERYDHVVIDSPPVMGLADAPLISSRVEGVVYAVESHGTRSTLVKTALGRLAAANARIFGGVLTKFEASKAHY
GYGYDYGYGYGRTDAQA
>gnl|bykdb|A0A328I8B9 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Hapalosiphonaceae cyanobacterium JJU2] (length=696 residues).
LPALVTFAAVIGGAIAYLIITPRLYEISTRLILDQKRVSVSELGRDLTQLSPGTSGNSNPLADQAELIKSQRVLQKALAK
VAAESGFSSLENELTVGQLSRNLKVKIVPATNILEVSYLNKDPTLATKVVNAISQAMVEDNTQVIRQEAANVRKFLEKKV
PDARKRVEEAEQKENKYRQSSGIVSFDEQTKSLVNSLATVEEQENTLVAQLQELRSKEGSLRQVTDAKALNQAYAAVRGG
QDEELKALRTKLAEIETKLVQARLSLTDSHPTVMNLLGQRNGLRALYFQGLARVSPRSKSISSSSVAGDKISQDLTSELI
VNDVERLAVEKKFRSVQANRNNLQARLAQLPIKQQQLTPLTRKREEAVESLKLLQSKLEEARIAEAQLVGNIQIIEAAQP
PKKPSLPNKKAVLAIAIVFGTALATGIILLLELMDHTLKDASEAEDLLKLPLLGVLPSLPAHAIALEPSGQFLDHVGLVE
PYRTLLKNLEFRNPESLGSIVVSSTITGEGKSVVASHLAVISAMLSRRTLLIDADLRRPMLHTLFNLAPQPGITDVIDSQ
RSLEETVQRTHIANLSVLTCGDLYGRPSHLLESEAMRSVIIEATRLYDFVIIDTPPLSACADGQTLGRQSSGILLVTRPN
FTIKEVLQKAVSELTHNQIPIIGVVVNGITQQTERYYRYPVNSYRPSRHLSEGSSA
>gnl|bykdb|A0A328IGA1 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Hapalosiphonaceae cyanobacterium JJU2] (length=727 residues).
METNSYTQETEIQQYILVLKRRWQLIASIILASIGLSGLALFMQKPEYQADGILLFKSDRTSSLTKVGEKIGDLEALMRE
GNPLETQAVIVNSHPMLQEVITALDLKDEQGKIIDPELLKINVKPIVGTDVLKVSYASNDPELAAAIVNQLMKSYVENNI
QTNRAQVSAAGEFIKEQLPNSRRELERAAEALRQFKIQNRVIQLAEESSAAIDIISKLDQEMNQIKAALADVTAQEAQIA
SQLNVSENQAVTVASLSQIPGVQEVLTELQKVQTKLANARAIYTERNPIIIDLKNQQSTLNSLLQQRTQQYSGIPLVSPS
KLQIGKIRESLVDNYVQLKAERQGLEKKFRTLFNIRVNYQQQLAMMPSLEKQQQSLERKLESAKNGYENLVTRLQEIQVA
EKQTIGNARIVQPAQIPKKPVISKTKILLASGSIFAGVLLSIAAAFFVDLIDRSLKTVKETETFFGYTLLGLIPKYKPNN
FVSAVQDIEDGVYPQVITTTSPRTLVHEAYQMLQANLKFISHRKVRKIVVTSSVSAEGKSEVSANLAAVIAQSGKRVLLV
DADMRKPTQHHLWSLINSVGLSHLLVGQAVFSEAVHKVTEFLSVLTAGVIPPNPLALIDSEGMTSLVDVFAENYDYVIFD
TPPLVGIADAAVLGKMADGILLVTRPGVLDSPSAGAAKSLLERSEANVLGIIANAVNVKQEPNSYFYYSSLRDRKSVADL
ERLAKIQ
>gnl|bykdb|A0A328IH74 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Hapalosiphonaceae cyanobacterium JJU2] (length=731 residues).
MKESEFKVEEIDFQKYLLVLQRRWLTAVGICGVVLSLALLYAFSLKPTYTAQASLLIKTNRTSSLTGLGEDIGRLESLVR
ENSPVDTQAKIVISVPVIQETITSLSLKNNEGEPLTVEELLENLKVEGVKGTDVLEISYTDENPELAAKVINKIVDTYIQ
QNIQANREEATSAGRFILQQLPKTEEAVQKAELALRRFKEKNKVIVLQEEATAAVNSISKLEDEIAEAQAQLVDANARLE
KLQNQARVSSQEAVSAVDLSQVAGTQEVIKELQEAQTELAVARTRYLPGHPTVSQLAEKVSALKNLLQQRVEQVGGNNQQ
ISTANLQMGEVRQKLIEDLANTDKERAGLEKRIADLRNTWSLYKQRANTLPRLEQTQRELERKLKAAQTTYETLLTRLQE
INVAENQSIGNARIISPALVPDEPSGMRKALIVFGGGVLGILLGIITALASDLIDRSIKTVKEARELFQYTLLGVIPSVS
RSGKNSYSVEGLDRPVPRVIGRDVPHFPVGDAYQMLQANLKFLSDKQLKAITVTSSIPKEGKSEVCANLAVAMAEVERRV
LLVDADMRHPIQHHIWQLSNKKGLSNIIVDKVALETVVHEVMPNLHVLTSGVIPPNPVALLDSERMAALVANFTQDYDCV
IFDAPPLAGTADAAVLGKLVDGILLVVRPEVVDFASASGAKEFLTQSGQKVLGMVINGVSVKRERDSYFYYAKDSMESSS
VSKSSILVKNR
>gnl|bykdb|A0A350Y0P6 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanobacteria bacterium UBA11370] (length=738 residues).
MESKQYVEDIDFQKYWLILRRRWLPSTVVFGFIFTLATTVAFVKKPSYSAYGKLLLQKRSATSALVTEAGEKIGQLEALN
NFINTPLDTEAQIITAQPILEKTIAKLNLKTAEGTPVQPSSIGAGLKVEGIKGTDVMEVSFTSDNPKKAAAVVNQLMNVY
VENNILTNRAEAVAAGEFIAKQLPQIQNRVRQAESALRNFKEQHNIVSIDEEGTAAVEIMADLDKKISETKAQLQEKTTT
ATELQDKLGLNSQQAIALNKLNQSRAVQQALIELEQVQEQLNIEGTRFQNEAPIIVSLKEKEAARQRLLNQRVEQVIGLK
QSIPLNNLQSNEFQQQMMATLVNAEAERLSLAQRVASLEQTKLTYKRRANILPKLQEGLRDLERQLEASQATYDILLKNY
QQIRIAENQNVGNARVITYASIPEAPVSPKKKLILVGGIVAGSLLYIVTAFVLDLMDPSIKTAKEIRQLFKYTWLGMIPE
SRKKGFFWRQKLNGNVPQLVVRDVPHGITSEAYRMLEANLKFLSPDHVLKRIVVTSSVAQEGKSTVSANLAIAMAQVGRR
VLLVDADMRHPMQHHIWDLANTVGLSEVIVHQTQFEFAVREVMDNLDVLPSGVIPPNSLALLNSKRMASLVEYFSQKYDF
VIFDTPPLVLTADAMTLGKMTDGILLVARPKVVDRVSATASKEFLLRSGQQVLGLVINGVSVEGEPDSYFHHAKAYYKEE
LITSTIPDSKTKKNHIRF
>gnl|bykdb|A0A350Y374 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanobacteria bacterium UBA11370] (length=731 residues).
MQSTDSPDLDFYKLWLVIKRRWLVGGGVFVLMVGLTIPVALTQMQKGDYEAQGKLLFKVNRTTSLTGLGKEVGNFAPLTT
DSNPISTEIEILSSLPLLDKTLNTLNLKDDQGEPISPESLQKKLKIKTIGATDVIEIIYKNKDAKTAAAVVNQLMKLYIE
NNLRNNRTELVTAQEFITKQLPKAEANVNQAEAAVQEFKERNQVVALDTEATTAVEVIAKLDEQIAQVQSDLKNINSQSA
ALRDKVGMDAQEAIAITSLNQSPGVQDILKEFQKVQADLTIQRTRFQEADPTIISLKQKEAALKSLLEERVGQTIGYDQF
VATQNLQIGEFKNQLIKDFVNSEVNRLGLKSKLDQLTNSRLIYKQRLNTLPKLEKEQRELQRRLDAAQLTYQTLLQKLQE
LRLAENQNIGNARIVEPAQIPDSRSSGKSVLILLLGAMAGTLLAMATIIILEVRDNSIKTLKEVKDLFGYTLLATIPTFG
KKTVSRFTAQERTIPELPVRDNPLAAISEVYRMLQANLKFLSSDKPPKVILVTSSVPQEGKSTVSANLALAIAQLGRRVL
LVDADLRYPVQHHIWQLTNAAGLSDVLVVQAEFETAVNKVMDNLDVLTAGVIPPNPLALLDSKRMASLIEYFSEKYHFVI
IDAPPLIIAADALTLGKMTDGVLLVARPKVVDAVSATTSKELLERSGQNVLGLVVNGVKLDNRSDQYFHYYSQGKLVKDK
PFAPIQERLLQ
>gnl|bykdb|A0A350Y472 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanobacteria bacterium UBA11370] (length=765 residues).
MGPKVDYQPLLVNANDKPSSVSPPIYPSGFSLVEEEKLDLRQILAVAQRRAIIIAGVAIAVSGGIVSQVLKQEPNYEGKF
QLLVGSPSGEDQAEQLTEALSKTGTVQVQGPDYETQIQVLWSPQVMAPIVAQIQSRYPEVDYSALRTKLTISRLQETKIL
EVRYQDSDPNKIQFILEQVANGYVQYSEAEQRTAVTQGLAFVNKQTQKLQELVNDLQQQIQNLRQTYQIVDPETQGQLLT
NRVSDIVKQRQETQSQLIESQQLYAELQTQLGQLGVTPDGAIAASALSEAPRYQDLLNQLSEVESQIATELARFKEENPA
IETLREKKERLLPLIEEEAANVVGNAAFGIPNNPESLASPSSIRLNLTQKLVETKNQIQVLEVRRNEIADAEIRLSQQLK
TLPVIARRYGDLQRRLTVATESLNRFLAVQEKLQIDESQKTPPWQQLSQPQKPQQPISPNIPRGIALGAIAGLLAGAGAG
MLAEKLDKAFHSTDELKDTTGLPLLGTIPFSKELKKNITRSATPSKSHSEPLELELRRRSSRYNASPLLEAFRSLHANLH
FLSPDKSIRSLVVSSAVPADGKSTVAAFLSQAAAAMGERVLLVDADLRRPQVHVKTDLPNVWGLSNVISSEINVSDVIQQ
SPLEDNLFVLTAGQIPPDPTRLLCSKKMQNLVERFHGAFDLVIFDTPPLLGLADARLLAAHTDGIIMVVGLGKTDRAVLT
HVLYGLKTSHAKVLGMVANGVKDYRASSYDYYNRYYSQVPQQTAV
>gnl|bykdb|A0A350Y7Z1 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanobacteria bacterium UBA11370] (length=738 residues).
MIQSNLPGDETNLGYGQLFSILLRRRFWMLGVFCGVLAIAIPIALNKEPTYQSSMQLLIEPYVQQKQEGKPQTEEQFTDS
NVEVDYATQLNLMRSSQLIQKAVDRLHPKYPEIQVTDIKESFSLTGVQEEDTDIKDTQTKIVKVVYTSNDPIQTQDVLAA
IQTVYQDYNLQQQQVRLTEGLAFINDQLPTARDNVIQAEKALEQFRETQNLIDPVQQATTITDALSTVEQEQQAIRAQYQ
ETQARYRVLQQQLERSPQEALTSSRLSQSPRYQALLNELQKTELAIAQQRVKFTDAEPRVEQLLEQRQRQLALLQEEAQR
VLGETSTQIAFSTQNLLTEGQLGNNDLTLSSQLAEAQTTLQALQARDRSLAITQQQLRAKLNRLPELMAEYERLQPEVQI
RRDTLQKLLEARQELGIEIARGGFKWQVVEPPKPGKQMGPDTRRDLMLSVVVGLFLGGLAAFGREALDDAVHSSEELKRQ
VALPLLGIIPELPRTGGSGLLVHLPFRRTQVAAASTLPMVYWLPFRESLDLIYKHIQLLNSSATLRSIVVTSALPSEGKS
TLVVGLAFSAARLHQRVLLIDADLRRPSLHKQLNLANEQGLATLLVEDSSIPSPQRLSLSGSEIDVLTAGPIPPDPVKLL
SSQRMRQLMAGFEQNYDLILVDTPPILGMVDALQAASFCNGVVIVGRISRVTQSELTEAIAMLSHLNAIGIVANGANGST
NRYIAYAEQNGSPLFQLN
>gnl|bykdb|A0A352AAQ3 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanobacteria bacterium UBA9273] (length=765 residues).
MALTGDYQPLLPTSNGKQLSELMPIYTNGFSEIQEDKLDLGQILGVVRRRFIVIAGVAIAVTSGIVARVLKQTPNYEGKF
QLLVGSVSGEDRVEQLTEALSKTANIQVEGPDYETQIQVLWSPQVMAPIVKKIQARYPTVDYDTLRTKLIISRLQQTKIL
EVRYQDSDPEKIRFILEQVADGYVKYSETEQRTAVTQGLAFVNKQAKELQGIVNDLQQKVQDLRQNYKIVDPETQGQLLT
NRVSEIVKQRQETESQLVEAQRLYTELQDQLGQLGVTPDQAIAAAALSEAPRYQQLLNQLSEVESKIAAESARFTEDSPT
IQALREKQQRLLPLIEAEAANVVGSGSSGVPNNAESLASPSSLRLDLTQKLVETENQIQVLQVRQTEIADAESRVSQQIK
ELPIIARRYTDLNRRLNVATESLSRFLAVREKLQIEESQKTPPWQKLSDPQKPQTPISPNVPRGIVLGTVAGLLAGAGAG
MLAEKLDKAFHSPDELKDSTGLAVLGTIPFGKELKKGIARPVPAATPEGQQLESEFNQRSYRYTASPVLEAFRSLHANLH
FLSPDRPIRSLVMSSAVPADGKSTTSAFLAQAAAAMGERVLLVDADLRRPQVHVKTDLPNVWGLSNVISSEISVDDVIQQ
SPWEENLFVLTAGQIPPDPIRLLCSKKMQNLVAYLQKSFDLVIFDTPPLLGLADARVLAAHTDGIVMIVGLGRTDREVLK
QVLYGLKTSNARVLGMVANGVKGYRASSYDYYHRYYGRSPQQARA
>gnl|bykdb|A0A352AE27 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanobacteria bacterium UBA9273] (length=676 residues).
MLARIATITARHWKFLLALNVLVLAAAASNYVTSPKVWTAKAQLILPDTTSSLDANLGTLGSLTNDEPVFSNQLNPLKVQ
AYILTSDALMQRLWASDTENSQFGLRSYKKLFEISPQEQSTTISLTVKGSSPELAHQRAIALIEAYQQRLNELRQTDGVA
RAQFSQKQLEQAQQRLNQAQMELAQFQKSSGLVNSEEQTRGLVQSISELTTAQAQAQAQALASINEVRTLSNRLGLTPDQ
AIRSLGLAENPDYQFIRQKLTEVEAKLVEAKATYTMENPRVEGLVIQRDELQRQLQQYITQAAGDASIDTTMTGERQGRA
TLIQQLILAESTASAQQRQATQLQSQAEQLNATLKLIPGHQAKLLELKRQYEVAEGVYKGLVAQIQKVNIDAFNAYPNVQ
VLDPPTVSSNPTDPKKTLIALNAFVASVVGSIALLLLLEARNPLLSPKDLQTLKFAIVVRIPRLKQSVVGLGLTTETEVE
FQRLASAISLQPLKNRRLLVTSATMGEGKTTVTLGLATALVDLGFRVLLVDGDFRKAQLSHRLGYARELLPPEKPVQLRP
SLDLVPTLPKQGKIVEMVTRGRFEESLVAAQSANEYDYILVDSAPVSLTSETVLMAAITRNVLFVVRPGISKRNFVNDSL
AQLTQHNAELFGLAINGMEIPSISYTYRANGYLVKG
>gnl|bykdb|A0A352AG88 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanobacteria bacterium UBA9273] (length=733 residues).
MDSAESLDLDLQKLGLVIKRRWLIGAVVFLGMVGLTIPMALLQSQQTSYEAKGKLLFKVSRTADLTGVGQQVGELAPLTT
NSNPITTEIEILRSVPLAKETIAALNLKSEDGTPLSPEALHEKLTIENLAETDVLELAYESSNPQEAAAVVNYLMNLYIK
NNVKANRAEVVAAVKFLNEQLPKAEANVNQAEMALRQFKEVNKVVSLEEESRAAVDTLAKLDQQITEVKSQFKDANARSA
ELRDQVGMNSQEAIVASSLSQSPGVQQVLQEFQQVQSKLRVEQTRFQDEDPTIISLKEREAALRNLLQERVVQTIGVVRP
VSASSLQMGDFRQELTLNLVNAEVERLGLASQLNELENVRLAYQQRLTILPKLEKDQRELQRRLDASQSTYEILLKKLQE
VRVAENQNIGNARIIEPAEVPLLPSSQMVQTVLPVVGGGALGILLAIVTIITLEVRDTSIKTLREVRELFGYTLLGVIPS
LTKKGISRSRDLEGTIPELPVRDTPRLPISEAYRMLQANLKFLSSDKTPRVIVVTSSVPKEGKSTVSANLAAAIAQLGRR
VLLIDADLRHPLQHHIWDLTNTAGLSDVLVGQADFAATVRTGMDSLDVLTAGVIPPNPLALLDSKRMASLIDDFSKTYQF
VIIDAPPLILAADALTLGNMTDGVLLVARPGVVDSTSAAAAKESLERAGQNILGLVANGVKQENQADKYPHYYEFKDSTS
AAAPAQAKATSLS
>gnl|bykdb|A0A352JGJ6 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Pseudanabaena sp] (length=737 residues).
MTEYPKATYAGKYVDDSFKLAKFFRVLRKRWIVIVAVSASVFVGNAYYTFTRTPQYRSSASLLINNSTIAISDIQVPGLP
GSSLINLGTEIGILRSRPLIEVAVTKIKQSSASSKIKDIDAVTIMSGLEIRPEKDALILRLNYIDSDPKRAREVLNALAQ
TYVEYSLKDRRTKSSTAIKFIQDKLPQVKQQLDKSALAVTRFRKTYNIVDPETYAAAVFKMREVLEVQAQELQIKIAQTQ
QQYKSLSRQVGKSPDAAISGVILQQDTPYQSLVKQFREVETNYFLERTRFREDHPTVQALKDRRNELYKLLETRAQALVG
TKGTNITNEPNSPIQQTLATQLFEAQTSLAVNQAQLESIRGAQSEVAKAFSQIPQIQQRYIEIQRKLALDTSTYQKLTEK
LEELRISEAQEISSWRILEPPLIPTRPSSPDIEKSLIAGTFIGLTLGILCALLFNRLDQRIREVEEVKEIIDIPLLASVP
LTEVASLSAMVSQGILPTSSYYAFKEALSSLALNLRYLGTDNTMKVIAFTSSVPSEGKSTLTYNLATILAALGYKVLLVD
ADMRKPTVHKLSKLSNKFGLSTALATPSPWQDLVQIADEKDNLHILASGSLPPNPMLLLESTKMSALLQEWRQAYDYVLV
DTPPVIGITDAQCLTSKVDTFILVAAINRSTRAGIARALEVLEIARANVSGLLINMIGSSDSEYHYGYYDQYYLNPKEHE
EGLEPDSEVTAIKIAKK
>gnl|bykdb|A0A352X2A7 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanobacteria bacterium UBA11367] (length=733 residues).
MTQSNLPETESDFGYGQLFAILLRRKFWLLGVFCSVLAIAIPIALKKEPTYQSSIQLLIEPLVQEKQQRRSEENQFTESN
IEVDYTTQINLMRSSQLIQRAVNLLQDKYPTIKVEEIREFLTITRIIEDETETKIVKIDYISKDPIQTQEVLKAIQKIYQ
NYNLEQQKQRLVDGLSFIDNQLVTAANNVNKAERSLEEFRENQNLIDPLQEASNVGETLTKIEQERQAVRAQYQETLARY
NSLQKQLNRSTSEALTSSRLSQSPRYQSLLDELQKTELALAERRTRFTDADPSVQKLMEQQSRQYRMLQEEGERVLGRVA
RGEDLTSNTLLTEGQLGENDLDLSQKLAEAQSSIQGLQARDRSLAQTEQKLRTKINTLPQLMARYERMQPEVQLKRDTLQ
KLMQARQDLGIEIARGGFKWQVVEAPLPGEQIGPNTKQDIMLAVVVGLFLGGIAAFGREFIDDGVHTSDQLKRNLTLPFL
GIIPELPKTRSSSIFVNLPFRKSSVTEISTSHLAYSSAFRESLDLIYKNIQLVNAGRLLKSLAVTSALSGEGKSTLVMGL
ALTAARLQQRVLLIDTDLRFPTLHRQLNLPNEEGLSTLLADDNSIPNPQHVSLLGSNIDVLTAGPIPLDPVKLLSSPRMK
KLMASFEQTYSLILLDSPPILGMVDAMEVASFASGVIMVGRMNRVSQSQLTEAIAMLSKLNAIGVVANGASGSSSPYISY
KSQYNNSSLEKLF
>gnl|bykdb|A0A352X442 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanobacteria bacterium UBA11367] (length=736 residues).
MESTEYIEEIDFQKYWLVLKRRWLPAVGVFGGIVAVAGLAVIRQVPSYQAQGTILIQKDRSASLTGLDEALSQFDKLAQK
SDPIATAAAIVKSRPIAEKTVAELNLRDETGNPIKPEVVLQGLQVKPVAGTDVMTLTYQSKKPDVAAAVVNKVMEVYIAD
DIQANRAKAAAAREFITEQLPRLKQNVSIADAELRNFKEQNKIVDLVNEAKSSVETVADLDTQIAQTQAKLAEATAQTET
LRSQVGLNSKTAVAVNSLNQSAGVNQALAELQKVQSQLAVERGRFLEEAPIVQKLKEQETKLQTLVNQRIGENLGSEAEV
ATTNLQIGQTKQDLAAKLVAAEVEQSGLSRQLAVLTTARIAYKERSNSLPRLQEKEKELERRVEATQLTYSQLLQKLDET
RLIENQNVGNARIVEAAAVPEKPTSSKKKLIAAGGVVVGGLLGIAVAFLVDLIDHSVKNVKEAKELFGYTLLGVVPAFGK
LGNRGFSFKKSEAKDVRLVARDTPGSPIAQAYQMLRANLKFLSSDKQIKAIVVTSSVPQEGKSEVSANLAAAIAQVGRRV
LLVDADMRHPSQHHLWNLTNAVGLSNLLVGEADFSTAVQEVMPGLEVLTSGVIPPNPVAILDSKRMANLMETFAKGYDAV
IVDTPPMAGIADAPILGKMADGILLVVRPGVVDAGSAKAAKEFIARSGQTVLGIVANGVTIKNEPDSYFYYSKENYYTKK
VDVNGVSVSLGGNSQN
>gnl|bykdb|A0A352X940 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanobacteria bacterium UBA11367] (length=738 residues).
MESKQYVEDIDFQKYWLILKRRWLPATMVFLLSIGVAVGVAYTRQPIYEAGGKLLLQKKNKTSALVTKAGEKIGELDSLN
AFINTPLDTEAQVITSLPLIQKTIERLNLKTENGSPIKPENLLGRLTVKGLKGTDVMTVSVKSQKPKEAAAIVNKLMEVY
LENNIQTNRSEAVAARKFIERQLPKTESTVRQAEAALRRFKEENNIVAIEEEAKSAVQAMAELDSKLSQTKSNLEDATAR
SIAIQNQLNLNENEAVALNSLSQSRAVQQILVDIEQIEAQLTVQRTRYQEEHPIIQNLKRREDAQKSLLQERISKVLGTG
EILPTENLQIGDLKESMTKDLVKAEVERLGFVRQAAYLERAKLAYQQRANLLPRLQEGLRDFERQLGAAQSTYEILLRNY
QDVRIAENQNVGNADILARALVPEDPVSPKKKLILGGGIIAGSLLYIIVAFVLDLMDPSIKTAKEVRQLFRYTWLGMIPN
LRKKGLLSRRKSDGDIPQLPVRDAPHAIVSEAYRMLEANLKFLSPDKMLKVIVVTSSVSREGKSTVSANLAAAMAQLGRK
VLLIDADMRHPIQHHIWDLANAMGLSEVIVNHAEFKDAVREVTDNLDVLPSGAIPPNSLALLNSKRMAFLVDDFAKTYDF
VIFDTPPLVLTADAITLGKMTDGILLVSRPGVIDRVSASASNEFLVRSGQQVLGLVVNGVRIENEPDSYFHHAKIYYKGE
EISGKLKQDNRIKNLSKF
>gnl|bykdb|A0A352XE00 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanobacteria bacterium UBA11367] (length=770 residues).
MNLNGDGKVLSINGNAQQSLEVPGINSKNVADIPNHQVDMRQIIAIARRRFILTAGVAVAVTSGVATRVLQQVPKYEGKF
QLLIGPVSGGDRLDELSQSLAQNTGSQGNAPDYETQIQVLWSSQIMIPIVKKIQAQYPEIDYNLLRTKLTISRLQQTKIL
EIRYQDSDPEKIKFILDQVANGYINYSRQEQQTTTQQGIQFVKDQLPKLQERVNQLQAQLQEFRQAYNLIDPDSQAQLLT
QRATSIVQQRQDAQSQLAEAKALYNQLESQLAELGVSPDRAIAASALSEAPRYQDLLNKLSEVETKIAVESARFTEESPT
IQALRDEQKNLLPLLEKEAGTALSSAKLTQSDNLASLASPSSVRLEITKKLIDTKNEIQSLSVREAALERTENLMESQIK
QLPIIARQYTDLQRELKVATESLNRFLAVRETLQIESAQKTLPWQLIAPPQTPIKPISPNVPRGLVLATVAGLIAGAGAG
SLAEKLDKAFHSLDELKDSTGLPILGTIPFDKVVKNSKKQIKTNSKVYQNSQVNREVLELAFSGYSRYRPSPFLEAFRSL
HTNLNFISPDRPIRSLVMSSAVPADGKSTTSMFLAQAAAAMGEKVLLVDADLRRPQIHVRMNLLNMWGLSNAISSDINVD
NLIQESPVDENLFVLTAGQLPPDPTRLLNSKKMQNLVEYFQSKFDLVIFDMPPLLGLADARLLAAYTDGILMVVGLGKTD
REVLKQVLYSLRMSHAKVLGLVANGVKDYTSSSYGYYHRYYRKIPQETMT
>gnl|bykdb|A0A354B169 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Synechococcales bacterium UBA10510] (length=779 residues).
MGAMGVAEEIDLRELWLALRRRRKLVTVTASTVLALTVMVTAYQRIFTPVYLGSFSLLITDPISSENSNGNSNATALSGT
MFEQLARNTTSNDLPTLIEVLRSPMLLNPIAQHFDLTYLNLSSRLKISIGGEKSQEAEGVLNVSLTGHDPVQDELVLKAI
SAAYLHAALEQRQKRLADGLTFLNKNAPTLQQKTSQLQSDLAKFRERHNLIEPTEEGGAIKGRLAQLESQLLGLEAERNR
LQRVRAEISSGRLSARGFQEAISTGSGGSSSDNSGKGLSVGDVDQSLLQLLLKVESELAAARSKYKPSSSMVQGIEARQR
QLQPMLLRSQLEAVDGALKLNAGRLAMARSQQQALTFQFLRQPALIKQFTDIMQDLKIAEENLAGLVSARENFQLEMAQR
SVPWRVIAPPQINPRPIEPSISRNLALGAILGLVAGAFAGLLRDRLDHVFHTAAEAKADLRLPLLGHIPHVNFFQGVREG
KRFQLQELDQLVANPASEAFEKYRSQLFYCQEAFRSLFTSLRFLNSEKPLRLIAISSSLPREGKSLIIVLLAKTLAEMGK
KILVIDADMRRPQLHQRLGLNNLVGLSNLLADDCLHWRNCVQSLPGYEHWDVITAGLPPPDSTRLLSSNRMRDLMVDLGH
CGDYDLVLFDTPPLLGLTDAVLVAENCDGLVLLVSLDLVDRALPKQAIEIIHNSGCPLLGLVANSIKSGGETELNSSDNN
YSYGTYYASSVYANYAGDANVAVGSNQDAQSGAPSPHGWWALGGKIRRLPGNLLRWIDR
>gnl|bykdb|A0A355DPX0 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanobacteria bacterium UBA11162] (length=731 residues).
MQSTDSPDLDFYKLWLVIKRRWLVGGGVFVLMVGLTIPVALAQMQKGDYEAQGKLLFKVNRTTSLTGLGKEVGNFAPLTT
DSNPISTEIEILSSVPLLDKTLNTLNLKDDQGEPISPESLQKKLKIKTIGATDVIEITYKNKDAKTAAAVVNELMKLYIE
NNLRNNRTELVTAQEFITKQLPKAEANVNQAEAAVQEFKERNQVVALDAEATTAVEVIAKLDEQIAQVQADLKNINSQSA
ALRDKVGMDAQQAIAITSLNQSPGVQDILKEFQTVQADLTIQRTRFQEADPTIISLKQKEAALKSLLEERVGQTIGYDQF
VATQNLQIGEFKNQLIKDFVNSEVNRLGLKSKLDQLTNARLIYKQRLNTLPKLEKEQRELQRRLDAAQLTYQTLLQKLQE
LRLAENQNIGNARIVEPAQIPDSRSSGKSVLILLLGAMAGTLLAMATIIILEVRDNSIKTLKEIKDLFGYTLLATIPTFG
KKTVPRLKAQERTIPELPVRDNPLAAISEVYRMLQANLKFLSSDKPPQVILVTSSVPQEGKSTVSANLALAIAQLGRRVL
LVDADLRYPVQHHIWQLTNAAGLSDVLVVQAEFETAVNKVMDNLDVLTAGVIPPNPLALLDSKRMASLIEYFSEKYHFVI
IDAPPLIIAADALTLGKMTDGVLLVARPKVVDAMSATTSKELLERSGQNVLGLVVNGVKLDNRSDQYFHYYSQGKLVKDK
PFAPIQERLLQ
>gnl|bykdb|A0A355DVB4 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanobacteria bacterium UBA11162] (length=765 residues).
MGPKVDYQPLLVNANDKPSSVSPPIYPSGFSLVEEEKLDLRQILAVAQRRAIIIAGVAIAVSGGIVSQVLKQEPNYEGKF
QLLVGSPSGEDQAEQLTEALSKTGTVQVQGPDYETQIQVLWSPQVMTPIVKQIQSRYPEVDYSALRTKLTISRLQETKIL
EVRYQDSDPDKIQFILEQVANGYVKYSEAEQRTAVTQGLAFVNKQTQKLQELVNDLQQQIQNLRQTYQIVDPETQGQLLT
NRVSDIVKQRQETQSQLIESQQLYAELQTQLGQLGVTPDGAIAASALSEAPRYQDLLNQLSEVESQIATELARFKEENPA
IETLREKKERLLPLIEEEAANVVGNAAFGIPNNPESLASPSSIRLNLTQKLVETKNQIQVLEVRRNEIADAEIRLSQQLK
TLPVIARRYGDLQRRLTVATESLNRFLAVQEKLQIDESQKTPPWQQLSQPQKPQQPISPNIPRGIALGAIAGLLAGAGAG
MLAEKLDKAFHSTDELKDSTGLPLLGTIPFSKELKKTITRPATPPKSHSEPLELELRRRSSRYNASPLLEAFRSLHANLH
FLSPDKTIRSLVVSSAVPADGKSTVAAFLAQAAAAMGERVLLVDADLRRPQVHVKTDLPNVWGLSNVISSEINVSDVIQQ
SPLEDNLFVLTAGQIPPDPTRLLCSKKMQNLVDRFHGAFDLVIFDTPPLLGLADARLLAAHTDGIIMVVGLGKTDRAVLT
HVLYGLKTSHAKVLGMVANGVKDYRASSYDYYNRYYSQVPQQTAV
>gnl|bykdb|A0A367QD86 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nostoc sp. ATCC 43529] (length=737 residues).
MESRETIDLDLNRYLLMLKRWWIPAATIFIATVMLSAVATRFMKPSYEAEGKLLFRIPSFKVVGSNLLPTTTEGGSTGDL
KSLIASQNPINTQIEVISSPPLLQKTIDKLQLKDKEGQPLTVKALQKSLVLKIIGGTDVLRITYSSLNPEEAAAVVNTVM
NVYVENDILTNRSEAASTRQFIARQLPKTQEAVDKAERELRIFKQKNRIADLTEETKSAVGIIGNLNNEINTVQAQLDEV
NAQTNELRQKVNLSSQNAIAVSALSQSPGVQGILTQLQDIDRQLASERSRFQDDNPAIINLEAKKANLRALLQQQISQTI
GNNAQVPQNLLQIGELRQNLIQDFLQSEVQRYGLSQRLASLYNSRSNYQKRVQVIPQLIQNQRELERKLEVAESTYQTLL
KKVQELQLVENTNTASSRIIAQALMPTDPVAGKKFLVLLLGVMFGLFLATTTVLLLGMRDRSLKTLKEVRDVFRYTLLGI
IPLSVKKVRSRFSSAESITQKVAVRDMPHSLTSEMYRMIQANLKFLSSDKVLKTIVVTSAVPKEGKSTVSANLAAAIAQL
GRKVLLIDADMRVPSQHHLWQLTNVVGLSEVLVGQAEFNTAVSKVMDNLDVLTAGVRPPNPLALLDSKRMASLIDNVSSQ
SNYDFVIIDAPPLLLAADALTLSQMTDGILLVSRPGVIDSNSANAAQEILERSNYNVLGLVVNGIIDKNESSTYLYHEHE
YFQPRELTKEFKGLAKK
>gnl|bykdb|A0A367R4K6 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nostoc minutum NIES-26] (length=743 residues).
MTMESLPNVEEVNIQKYLEVLQRRWLTVIGIFSIAVTLGCLYAFSLKPSYKAEGSLMIKTNRTSSLTGLPEDIGRLEALN
VNDNPLETQVKIVGSNPVLEQTIKELNLTDNHGKLLSIRDLAQQLKVEGIKGTDVVQLSYQSNNPELAAKIINQVIDNYI
DLNIKANQNEAFAAKQVLVAELPKAEEIVSRAESQLRLFKEKNKVIVLDQEASAAVDTISKLDNQIYQAQAQLDDVKGRL
EQLRAQAQVNSQQGVIASELSQAPGVQKVLAQLQEAESQLALERTRFQSGHPTIINLEGKVTALRSLLKERIEQVAGEAQ
VTEGSLQVGQLRQSLIADITRAEAQGVGLERQINTLLQQRYAYARRANYLPKLEQTQRELERRLKAAQTTYETLLKKRQE
IDIAQNQKIPNARVISYALIPDKPEGPRKLLFIVGGGAIGFFLGIIAAFSLDLIDRSVKTVKEAKEVLRYTVLGVIPTLG
RNGKEHSSIAGLDRPIPKIIGRDIPYFPLGDAYQILQVNLKFLCSDKPLKSIVVTSSVPKEGKSEVSANLAVTMAQAGRR
VLLVDTDMRHPIQHHIWELKNTVGLSNVIIGQVSLDEAVQEVMPNLEVLTCGTLPPNPVAMLDSQSMTKLISSFGRDYDF
IIFDTPPLSGIPDAAVLSSLTDGILLVVRPGVVDLDRANSAKDFLTQSGQKVLGIVINGVNVKSEPDNYFYYTKRQQLEQ
SSVSGGLKKIAPKSLISRKDNER
>gnl|bykdb|A0A367RIS1 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nostoc punctiforme NIES-2108] (length=736 residues).
MPSHQDDQDLINFQQYWRILKRRWFLIAIIMGSVFGVTGLVAFSKKPIYESEGKLLFNKESGLSSLTGVNEQLGQLSGVT
NLSNPLETEAEIIRSNPLTQKTIAELHLKDKLGQPLEIDTFLSNLKIKSIRGTDILQLSYRSANPQQATAIINKLMSAYL
ENNVRINRSQARAAREFLNKQLPLVEAKVAEGEAALRQFKEKYEVVSLEVEAQEGVRSLNELSNQITQLRARLVDARSRS
GALQNQLALNTKQAMALSTLSQSRAVQEVLSEYQKVQDLLAVERSRFTDGHPVITSLLSKEQALKEQLERRVTQTLGSAQ
PIPDQDLQIGELKQTLTANLVQVEVERLGLENQVGVLMKAFVLYQARLRTLPKLEQLQLQRQRQLQVAQTTYEQMLKRLQ
EVQVLENQNVGNARIVSEALLPKKPISPRILLNLALGGFLGFFLAIAAALLLEAGDTSVKTTEEAQELLDYPLLGTIPVF
EQKDKLARGESITELPVLNNPYSSVNAAFEMLQINLGFTFSDKELKVIVVSSSVMNEGKSFVAANLAVATAQMGKRVLLI
DADMRRPRQHEIWQKPNLMGLSNVLVGQATLAGAAKEVVSNLELLTAGTIPPNPVALLDSQRMNGLLKHAAQDYDCVIID
TPPLSVLADASIVGKMADGMLLVVRPGVVNSAAAKTTKALIEHSRVLVLGIVVNGVNTGNNHYMYSYYHTQTGENNSGKK
DRIKSNLSRITGLHLF
>gnl|bykdb|A0A367RMI4 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nostoc punctiforme NIES-2108] (length=742 residues).
MSEKSMESRESIDLDLNRYLLILKRWWLPAFSVFVATVILSAISTQFLKPDYEAEGKLLFRVPSFKVAGNNLYPDTSEGG
DAGDLKPLVATQNPISSQIEVISSPALLQRTIDKLQLKDNDGEPLEVKKLLKLLNLKVIGGTDVLRISYKSHNPEEAAAV
VNTIMRFYLENDILTNRSEAGAARQFMAKQLPTTQAAVNNAEVALRIFKQKHQIADLSEETRSAVATIGNLDNEMNTVKA
QLDEVNAQTNELRQKVELNSQEAIAVSALSQSPAVQGILTQLQETDRQLAVERSRFLDDNPIIINLEAKKANLKSLLQQQ
VGQTVGNQTQVPQNLLQIGELRQSLIQNFLQSEIQRFGLTQRLSSLYNSRVSYEQRVKLIPQLAQNQRELERKVEVAEST
YQTLLKKVQELQLVENTNAPSSRIIAQALVPKDPTLTKTIIVLVLGVMFGLFFATTTVLFLAMRDRSLKTLKEIRDVFRY
TLLGIVPLSVKKLRSRYSNAESISQTIAVRDTPHSLTSEMYRMIQANLKFLSSDNVLKTIVITSAVPKEGKSTVSANLAA
AIAQLGRQVLLIDADMRVPSQHHLWELTNEVGLSEVLVGQAEFDIAVSKVMDNLDVLTAGVRPPNPLALLDSKRMASLIE
SFSSHYNYDFVIIDAPPLLLAADALTLSQMTDGILLVARPGVIDSNSANAAQEILERSNYNVLGLVVNGVIDKNESSSYR
YHSHEYFKPRELTKELKGLAKK
>gnl|bykdb|A0A367S084 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nostoc punctiforme NIES-2108] (length=734 residues).
MTMESLPNFEEVNIQKYLEVFQRRWLPLVGIFAISVSLGCLYAFSLKPSYKAEGSLMIKTNRSSSLTGLPDDIGRLEALN
VNDNPLETQVRVIGSNPVIEKTINSLNLKDSQGKLLSIPNLAKQLKIEGIKGTDVVQLSYKGGDPELAAKIVNEVIDSYI
DLNIKANQNEARTAKQVLVTEVPKAEEVVRRAESKLRLFKETNKVVVLEQEAAAAVDTISKLGNQISQALAQLDDVKGRL
EQLSSEAQVDSRQGVIESELSQAPGVQKVLAQLQETESQLALERTRFSPEHPTITNLEEKVLALKNLLKERTGQVAGGAQ
ITQGSLQVGQLRQSLIADITRAQAERVGLERQIATLKQQQNAYIKRANNLPRLEQSQRELERKLQAAQTTYETLLKKRQE
IDIAQNQKIPNARVISYALTPDKAEGPRKMLFIIGGAGIGFFLGIIVAFTLDLIDRSVKTVKEAKEVLRYSVLGVIPAQG
RNGKDHSSIPGLDRPIPKIIGRDIPYFPVGNAYQILQVNLKFLCSDKPLKSIVITSSVAKEGKSDVSANLAVTMAQAGRR
VLLVDADMRHPIQHHIWGLTNTMGLSNILINQASLDTVVQQVMPNLEVLTSGVLPPNPVAMLDSQRMAALISNFGRDYDL
VIFDTPPLSGIADAAVLSTLTDGILLVVRPGVVDLNSANAAKEFLTQSGQKVLGIVINGVNTKNEPNNYFYETKKRQIEQ
DLVSSSLTKFRKER
>gnl|bykdb|A0A370CKT2 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Mastigocladus laminosus WC112] (length=715 residues).
MEKGLSSLPSILKRRALPALVTFAAVISGAIAYLQITPRQYQTSTRLMLDQKRVSVSELGRDLTQLNSGTPGGSNPLADQ
AELIKSQRVLQRALTEVTAESGFRSPENELTVDQLSQGLKIKIVPATNILEVSYLNEDPILATKVVNAVSRAMVEDNTQV
IRQEAANVRKFLEKKVPEARKQLQEAEQKENRYRQSSGIVSFDEQTKSLVESLANLEQQENTLSAQLQELRSKEASLQQV
TDAKALNQAYAAVRGGQDEELKALRNKLAEIETQLVQARLSLTDNHPTVINLLGQRNGLGALYQQGLARVSPRNQSISSG
SVAGDQISQDLTSQLIINDVERLALENKLKVVQTNRANLQTRLAQLPIQQQQLTPLTRQREESAESLKLLQSKLEEARIA
EAQLVGNIQIIEAAQPPTQPSLPNKRTVLAIAIVFGTALATGIVLLLELMDHTLKDASEAEELLKLPLLGVLPRLPGHAI
ALEPSAQFLDHVGLVEPYRTLFKNLEFRSSEPLRSIVVSSTITGEGKSVVASHLAAISAMLSRRTLLIDADLRRPILHTL
FNLAPRPGITDVIDSERSLEETVQRTNIPNLSVLTCGELHGRPSHLLESXXXMKSLLIEAVRQYDFVVIDTPPLSACADA
HTLGRQSDGILLVTRPGFTIKEVLQRAVSELTHNQIPIMGVVVNGITDQTERYYRYPVNGYEPLSSRRLSGGGSA
>gnl|bykdb|A0A3B8JH60 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanobacteria bacterium UBA8553] (length=687 residues).
MGKIAAIASRHWKSLLVLNLLVLAATAGKLATSPKVWTANAQLILPNTTGDLDANLGTLGSLRNGGSGFSTEVNPLKVQA
SILTSDELLQKARAIDPEKNKAPKPSQYKKLFKVSPQEQSTIISLAVNGSTPEVARQRAIALLKVYQARLNELRQADGMS
RKQFSQKELEQAKERLAQAQMALAQFKQSSGLVNSEAQTEGIVTTINNLSTAQAQAQALAQAGQNRVSVLSAPLSLTPDQ
AIKSLGLGENQNYQFVRNXXKLAEVNANLIRTRATFTDNHPTVQKLISERDDLQRQLQGYIAQSAAGTRVDTTVSTNNEG
RATLIQQLATAESEASAQQRQADQLKSEIEKLNASLKALPGNQARVLELQRQVDVAEGVYKGLVAQVQKNNIDAFNTYPN
VQVLDSPTVDPKPSSPKKLLAALNALIASIVGSVALVLFLESRNPLLSPKDLQAIKFPIVVRIPRFKQSDRALKLGTDTE
VEFQRLASAISLQPLQDHRLLVTSAIMGEGKTTVTLGLATALADLGFRVLLVDGDFRKAELSRRLGYGRELKGTEAPLFA
DVAQQPVQIQPSLDLVPISPKKGKIVELVRGGRFEQSLEAIQSAGDYDYILIDSAPVTFTSETALMASIVPNVLFVVRPG
TSYSNSVNDSLEQLAQHQAEILGLVINGVETKSKPYPYRSNSSLVKS
>gnl|bykdb|A0A3B8Y8H9 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanothece sp. UBA12306] (length=749 residues).
MTDLPNNSLAVNSPQPQVNQTIQSQLREQNEEDISLSVSQIVPWLRRRFWLIGSISLAVSLSAVSYAFTRAPVYEESFQI
LVDTPGDSNRGLPGGINSSLGNFLGVSTNSDNYFLTQIQILYSYKIIAPVLEKLNKVFPPETEEEKVEYQAFIENQLSIN
RPKDTNIIIVSYQDIDPRKVTFILNELAKVYLDYSLNDPRMKKTQGLQFVEDQLPKLDQEVSSLQKELERFRKKHNFIDP
QSQSRILSSNLTNIIQKKQENQSLLQEQEIRYRNLQQQLAMGEQEAIDLTALSESPRYMNLLEKLREVDTKLAEESTRFT
EDNPTIKKLRQQRRNLVPLIEEEAQAILGNIPQTSLTDLTALTSPNTIREDILSSLLKAETQLEELRARQKELIGLENDI
RQEIAQLARLTSEYVDLQRKIEIANQSLTSYLVFQQELELERAKTIYPWRLVSEIRTPEEPVSGPLKLSVLGTFMGIVLG
MGAGLLAEKLDDTFHNAEELKQETRLPLLATIPQLPRKLLQNKTDFPGSNPNFSLFLEAFLGLQTNLVLLNPKQTIKSLT
ISSAIPEEGKSTVAAHLAQAAAKMGQKVLLVDGDLRLPQLHHQPGLTSSNQYSLEDILNQDLAPDQAITISPLNPNLYVL
VGTAKSPNPSASLSCEKFATLSRQWQEKFDLVIFDAPPLLGLVDAKLLTAKTDGLLLVVRLDKTNKDLVKKAVEEMQSAQ
LPILGLVANQAQPYTMKINRYNQRYLQQV
>gnl|bykdb|A0A3C0N2P0 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanobacteria bacterium UBA8543] (length=774 residues).
MGPDGDYQPLLPNGNGKQLSQLSTLNAAEFSVLNEDKFDLRRLLAVARRRIILVAGVAIAVTSGVAAKVLRQVPIYEGSF
QLLVGPVSSSEDKLGKLAQSLNEGGGSSSNTPDYDTQIQVLWSPQVLSKIVKEIQTRYPDIDANTLRSQLQISRLGETKI
LEVRYQDSNPEKIQFVLERVAQGYVNYSAKEQQDSVTQGLGFVNEQTKNLQKRVNELQKSIQSLRENYKIVDPESQGQQL
SNRASEIVKQRQDTESQLSEAQKLYTELQTQLSQLGVTPNQAIASSALSEAPRYQALLNQLSEVESKLAKESARLTEDHP
TILKLREEQRRLKPLVDQEAATVMGNAASGVPDNAESLASPSSIRKDLAQKLVDTQNQIQVLEVRRNKIAKAESVVGQQL
TALPDIARRYTDLQQQLKVATESLGRFLTVQETLQVEKARTSTSWKKISGPQKPQAPISPNVPRGILLGIVTGLMAGAGV
AFLAEKLDKVFHSPDELKDSTGLPILGTIPFTKKLKEDIGSLSDGSMIDPENLEFQLSAQSYGYNASPLLESFRSLNTNL
QFVSPDEAVRSVVISSATPGDGKSTITTFLAQAAAAMGQRVLLVDADLRRPRIHETTDLPNVWGLSNVISSEINFEDVIQ
RSPIEDNLFVLTAGQIPPDPTRLLSSKKMKNLVERFQEAYDLVIFDTPPLMGLADAKLLATHTDGIVMVVGLGKTDRSVF
KEVLYGLRTSHAHVLGVVANGVKGYTTSTYDQYLRHYTKAPQKKLSEGYRLPKS
>gnl|bykdb|A0A3C0N766 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanobacteria bacterium UBA8543] (length=685 residues).
MGKIAAIASRHWKSLLVLNLLVLAATAGKLATSPKVWTANAQLILPNTTGDLDANLGTLGSLRNGGSGFSTEVNPLKVQA
SILTSDELLQKARAIDPEKNKAPKPSQYKKLFKVSPQEQSTIISLAVNGSTPEVARQRAIALLKVYQARLNELRQADGMS
RKQFSQKELEQAKERLAQAQMALAQFKQSSGLVNSEAQTEGIVTTINNLSTAQAQAQALAQAGQNRVSVLSARLSLTPDQ
AIKSLGLGENQNYQFVRNKLAEVNANLIRTRATFTDNHPTVQKLISERDDLQRQLQGYIAQSAAGTRVDTTVSTNNEGRA
TLIQQLATAESEASAQQRQADQLKSEIEKLNASLKALPGNQARVLELQRQVDVAEGVYKGLVAQVQKNNIDAFNTYPNVQ
VLDSPTVDPKPSSPKKLLAALNALIASIVGSVALVLFLESRNPLLSPKDLQAIKFPIVVRIPRFKQSDRALKLGTDTEVE
FQRLASAISLQPLQDHRLLVTSAIMGEGKTTVTLGLATALADLGFRVLLVDGDFRKAELSRRLGYGRELKGTEAPLFADV
AQQPVQIQPSLDLVPISPKKGKIVELVRGGRFEQSLEAIQSAGDYDYILIDSAPVTFTSETALMASIVPNVLFVVRPGTS
YSNSVNDSLEQLAQHQAEILGLVINGVETKSKPYPYRSNSSLVKS
>gnl|bykdb|A0A3C0NJ41 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanobacteria bacterium UBA8543] (length=749 residues).
MESRESLDLDFQKLWLALKRRWLPGVAVFAVVVGLTVPLALSKKQKTDYEAKGKLLFKVNRTASLTGVGQVERLEGGQTA
QQPVGGLGALTQTGNPVSTEMEILHSIPLAQKTIAAFNLKDNKGKSLTPEDFQKKLKAKIVGGTDVVELSYKGANPQQIA
AVVNKLMSLYIEDNLRTNRAELVAAQDFIAKQLPKAETNVGQAETSLRRFKQENQVIALDEEAKSAVGVMANLEQQITQV
QAELQQANAQTAALQNKVGMNSQEAINTTALSQSAGVQEVLKQYQDIQAQLTLQRTRFLDDSPVIVSLKEKEASLKSLLQ
DRVSQTVGSQQQVPTGNLQIGQFKEQLTSDFVKAEVERLGLANRLTQLSNTRSAYKQRLSILPKLEKEQRELQRRVEAAQ
STYQALLKKQEELKLAENQSIGNARIIEPALVPETRSPINAIITLLFGGTAGTLLGMATIILLEVRDVSLKTLKEVREQF
GYTLLATIPLLGKKPRRRTKHQERTVPELPVRDTPRSPISEAYRMLQANLKFLSSDKPLKVIVVTSSVPKEGKSTVSANL
AAAMAQLGRRVLLVDADLRHPFQHHMWELTNAGGLSDVLVGQAEFKAVVTEVMDNLDVLSCGVIPPNPLALLDSKRMASL
IESFSQTYDFVIIDAPPLVLAADALTLAKMTDGVLLVSRPGVVDSTSAAAAKESLERSGQNVLGLVVNGVIVENESDSYF
YYTKNDSSDENFTTREKAKSKTGKYADPF
>gnl|bykdb|A0A3D1PBA3 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanobacteria bacterium UBA11049] (length=742 residues).
MARVNEHNLPINTETDGGYGQLFSVLMRRRFWLLGVLGSVLTIATVFTLISKPTYQSTMQLLIEPNYQGKRDTDAQRPSQ
QYAESGVKIDDYATQINVMRSSLLLQRAADILRPEYPTITAKEIKANLKLRQVLEEKVNTKIVEATYTANDPVKAEKVLE
AVYKVYQIYNREQQQQRLQKGLKFINEQIPVVSKTVDQAENKLEQFRKNYNLIDPEQQATAVSQSLNAIAQERQVIRAQY
KDLQARYNALQQQLARSPQQALAASRLSQSSRYQTLLNELQKTELALSQRRVTFTDEDPQVKKLLEQRQNTIEMLKSEGG
RVVGKEQAQSGSTGENILTQGQLGGIDLNLTNQLVDVQTNLNALRARDVSLEQTQKQLRTDLNRFPVLLAEYNRLQPLLQ
INRNKLQQLLQAQQELSLEIARGGFDWQALEEPKQGQQIGPNLKLNLLLGLVAGLMLGGVAAFLREAVDDSVHTSEELEK
QVELPLLGMTPELPKNKLAKPQISLPFGKPHLLAPWTVQVSNWPPTWESLDLIYKNIQLMNELASFKSLMVTSAVAGEGK
STLALGLALSAARLHQRVLLIDADLRRPNLHEMLSLPNEQGLSTLLSSDATLPGQGVIQSSGAFIDILTAGPLPSDPANL
LSSQRMRELIAEFEKNYDLILLDAPPVLGMVDAMIAASLCTGVVLVSRVGQVTKTELTQARAMLNKLNVIGVVANGVNGV
NHGYAAAYTRENGAVLNKVWGN
>gnl|bykdb|A0A3D1PG43 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanobacteria bacterium UBA11049] (length=729 residues).
MESREAIDINLQNLWLSIKRRWLPAAGIFGCVLGCSALAASLQQPMYQAQGKILLKKIDNASSVTELSQTDNSELEPLSQ
LGNPSQTEIEIMSSRPLAKETIAALNLKDKKGATVQPTELLGKLKLKNVPATDVVQVAYESKNPEEAAAVVNKLMSLYVQ
NNIQSNRAQTTAVGEFIAKQLPTVQGTLRQAEAKLRRFKEQNQVVNLDEEGKSAVEVIKQLEDQVTATQAALVQAKTRSA
NLQKEIGINSSDIIAVNSLNQPAGGAQKVVAELQQVEADLVVLQTRFLDGHPKIAELQNKKAALKALLQQRITQTLGEPK
QVPIKDLQMGALKQKLTEDFATSEVERLSLSSRLAYLSKNLSAYKQRANVIPKLEQQQQELERQVKASQATYEILLRKQQ
EVKVEENRNIGNASIIETALVPEQPTGGKKLIILGLGSVLATLLATGTILILEISDRTIKTLREVRDAFGYTVIACIPHV
GKKVGFRNQKQEWAVPEISVLENSLSPIAENYRMLQANLKFLSSERALKAVVVSSSVPKEGKSTVSANLAAAIAQLGRRV
LLVDADMRCPVQHHIWNINNVAGLSNVIVSQTEFQTTVQQVMTNLDVLTAGVMPPNPMALLDSQRMASLVNYFTQLYDFV
IIDAPPLVVAADALTLGKMTDGILLVARLDLLDFSSAAAAKEALDRSYQKVLGLVVNGVTMPNHQYYKFHTRRDSDRDSE
QLISSRKFS
>gnl|bykdb|A0A3D4C6Q6 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Anabaena sp. UBA12330] (length=729 residues).
MSINQETQDSSVDIQQYWLIFKRRWLVASIVFASVFGATALVTYLTKPVYESEGKLVFTKKSGASSLSGLSQQMGELGAL
TNLSNPVDTESEIIRSYPIVIKTITTLNLTDDQGKQLSLEVFLKKLKLKTVRGTDVMQLSYKSTNPQEAANVVNSLMKYY
LESNVRTNRREATSAREFLSKQLPEVESRVTKAEMNLRRFKENNRVVALDVEAKTGLESLGRLNEAITQSQGQLAAALTR
SVALQNEMKLDRQQAVDLSTLSQSRGVQQVLTEYQKTQSELAVARTLYTDDNPKVVDLVMKEASLKKLLEERVGQTVGNF
ESLSQQNLQIGELKQTLTQDLVKSEVERLALTKQVEELQRVFIFNRRRLDSLPRLEQQQLQLQRQLTVAQITYQEFLKQY
QLVQVLENQNVGNSRVISEALVPELPVFPKIPLNLALGGFLGVLLGAGTALLLESMNQSLKNIEEANRLLGFPLLGTIPQ
HGEKNPKNRQEGRQELPLLDDPYSPVSTSFEMLQTNLGFTVSDKELRVILVTSATPGEGKSFVAANLALAGAYVGKRVLL
VDADMRRPRQHRVWEIHNLLGLSNILAGQTQLKNAVQEVSPLVKMLPAGKIPPNPVALLDSQCMADLVEEASKDYDFVII
DTPPLTAVTDPLIVGKYVDGLLLVVRPGKVEYSAVNAAKSLLTQAKLPILGMVVNGIVKESGYGGYYYSSGYYGDKGERN
KQHAEASVR
>gnl|bykdb|A0A3F3KPR9 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cylindrospermopsis raciborskii S05] (length=746 residues).
MLIFCVMVEPVIATGVYMPINKKETDVIDLQIYWLILKRRWLVILLVIASVLGAAISYTYSQKPVYQAKGKLLFEKKDGV
SSLTSLATSVGELGGLGNNSNPIDTEAEVIRSHPLITKTINQLGIKNTKGEPIEIDRFLKQLKLQTIRSTDVMELSYNST
NPQEAADTVNTLMKYYLDNNILINRSEATAARKFLSQELPRIEKQVIKAELELRRFKEINRVVALDAEAKVGIETLGRIN
EVITQAQGQLAAAYTRSLALQNELQLTTQQAVALSNISQIPGVQQVLTEYQKTQQELAIAETTYTSDNPKVVNLQLKEQA
LKKQLQERVSQTLGNAEVLQQSNLQIGELKQGLTQDLVRSEVERLALANQVKALQSVFIINKRRLDSLPRLEQQQLQLQR
QLQVAQGTYQQLLKQLQEVQVLENQNVGNARVISSALVPEIPISPRTALNIGIGALVGVVLGVGTALLLETLDKSVKNIE
ELNRILDLPMLGTIPQYENTKRQKNAGGEESQRELPILDNPYSPVSTSIEMLQTNLGFATDKELRVILLTSSSPGEGKSF
ISANLALAASHLGKRVLIVDGDLRRPRQHKVWGLPNFVGLSNVLVAQTQLENCLQDVSSVHVLTAGKVPPNPVKLLDSQS
MASLIAAARRDYDFVIIDTPPLTAVADALIVGKLVDGVLLVVRPGQVESSAVKASNSLLAQSKVPVLGMVVNGVSEDSGY
GGYYYYRGYYGDLKDKREGDSLAIKR
>gnl|bykdb|A0A3M1PML8 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanobacteria bacterium J069] (length=740 residues).
MSLVSQDYSEEIDFQKYWNVLKRRWLPATSVFLTLTLLSAAVAIRQKSSYQAETLLQVRSSGAAKLTGVGEGLGELEKLT
LQSNPVDSQAQIIQSAPIVSEVIRSLDLRDEKGEPVLVKDFLSKLKANSIPATDLLRVTYASEDPEETAAVINRLVDIYT
KNNVLVNRAEAAAARDFIAKELPKTEAAVKAADSDLRRFKEANGVVLLESEAQEAVNIISKLEDQVTQARAELSDTSARL
SQLQGRVGADPRRATVIAALSQSPGVQEALTQLQLAQQELAVERTRYTEDHPAIANLQRRVRSLEDMLQSRAVSVAKSDW
SSIRNDLQAGALQQDLIGELVRLEVQRQGIVLRLNTLSEASNAYRQRASALPRLEQQQRELERRLNAAQTTYEALLLRLQ
EIQVAENQNIGNVRVVSPAIVPDDPLPSQKKLFLIAGSLAGMLLGVATAFGLDLFDRSIKTVKEAKEALGYTLLGVVPAF
SRNAKSNVPLGALDYPAPRVVVRDMPQSPIAASYQMLQANLKFLSSDKAVRSFVITSSVAQEGKSEIAANLAATMAQLGR
KVLLVDADLRRPAQHHTWNLVNAAGLTNLLIDQVSSESVIQEVMPGLHVLPSGVVPPNPVALLDSKRMASLVEDFLKEYD
FVLFDTPPLAGIADAAVLGKMTDGMVLVVRPGVVDSSRALAAREFLKQSGQQVLGMVLNCVDVRNEPDSYFYYAGNQYRF
SAPSAAEVPQLAESLSSEKR
>gnl|bykdb|A0A3M1SVZ4 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanobacteria bacterium J055] (length=709 residues).
MESGGESTIQLDRAFPIVKRRWLPASVVFAAIFTVFYIAAQKDRPVYIAEGEILIEKVSSTPSVTGVGSEVGLLDPLTKE
NSPLDTEAEIISSVPIVEQTIAALQLKNSEGKLVEYSDVLKNLKLSKVQSSDILTISYQDENPKKAATFVNSLIEVYLED
DILRKRAELTATREFIEAKLPDAEYTLSQAEQELRQFKEENNFFALQEEAAAATQLMTGLQQRITDTQSQIASTNSRYNA
LQNQLGMNPKQAAQRTVISQSTTIQEARQQLQEAEAQLAVEKTRLTENHPTIIDLQDKVATLRSMLQSRVGDVSGSLKSI
GNLEFSQMEQELTQELVSLESERQGLNSQISALAQLQAGYQERLNVLPQLEQEERRLERQLELAQATYSQLQQKLQEVRL
AESQSLGNASLVSPALVPDKPISKKSLYQAMGIFLGGLAGVATALLLEVQDRSIKSVGEAKAQLQFALLGVIPQVRKSNR
LLGHRRSIPQIIVRDNPRSLISEAYRMLQTKLKFACAEQSVKTIVVTSAIAKEGKSTIAANLAAAISQVGRRVLLVDADL
RRPLQHEIWNLGNEMGLGNTISGQVDFHLALQPTMPNLDVLTAGTLAPNPIALLDSQRMVSLMEEFADRYDFIILDAPPL
NVAADASILGKMSDGILWVVRPGVADSTSTTVAREIVEQSRQTVLGVVINGAIGENEYSYDRAQRSVYA
>gnl|bykdb|A0A3M2GIL5 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanobacteria bacterium J007] (length=743 residues).
MENQIYTEDIDFQKYWLVLKRHWLPSSCVFLLIFALAFAFAYTRKPTYEASGKLLIKKRNTTSALVTEAGAKLGELDSVY
QLNSPLDTEAEIISSTPIIEQTIAELQLKGPEGNLIPPGGLLSGLGVKGIKGTDVLLITYQAGNPEEAATVVNKVMEVYI
ENNILVNRSEAAAAREFINKELPEIEARLSRAEAELRNFKERNNIVELEEEARSAVFVMGEIETEKSKKEAALADATARS
AALQQQMGLNSAQAIALGAIGESMAVQNLFRELQQVENDLAVQRTRYQSKHPIIANLTRKRVSLQALLQERIRDILGSQL
QLPRESFEIGLVQQQLLLDLVDSEVQRLGLVSQVRALEEARYSQQQRANVLPRLQEGLRELERKVNAAQSTYEILLKNLQ
EVQIVENQNVGNARVIASASPPEFPVGSGKKLYLAAGIVAGGMLYVVTAFLLELIDPSIKTAKEVREVFRYTVLGMIPKY
RKKGFFFQNKIDQITPDLPVRDRPHWVVSETYRMLQANLRFLSPDKELKTIVVTSSMAKEGKSAVAANLALAIAQLGRRV
LLIDADLRHPIQHHIWDLTNIAGLSDAIVSQVELDQATLDVSDNLDVLPSGVIPPNPLALLDSKRMAGAIEQFAQDYDFI
LIDTPPLVMAADALTVGKMSDGIVLVVRPGAIDRVSAAASQQLLRQSGVNVLGIVVNGVIMQNEPDSYFHHAQAYYKQDH
PIPMKKMVAPSQSAPPQVPQADE
>gnl|bykdb|A0A3M2GQQ6 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanobacteria bacterium J007] (length=744 residues).
MQNAIAINPIQDYKNDTDFVELGRTLVKRWSIIAIVMTSVFATVAVSTLRTTPQYRSETLILVDDRSSVPVVPGLESPYP
GPQKDLSTEIQILRSHALVAKAIAALGDTDNPIGVKQVASNLSIHKAGEADVLIVSYTDTDPARAKAILDVLGKTYVDYS
LERQVSQASNAIEFIEEQLPKAQQELSESALAIQSFRQTYGIVDPESYANQVLDIKQSLEKDAQSLEITLTRSQRLYAEL
RSQMVEAGQNPDTALVHSLLSQDSVYQQLASELKAVEAQYTLEASRFYETHPVVKNLAIQRDNLFRQLQQRSRRVLGDAV
AKVDLDEVTGSGAIKESLATQLLQVETEMSAGLSQLARIRQAQQDVAIQFENIPQLQQRYAELQREFKVKSEAFNRFLEK
LQELQIAEAQETAPWRVLEPPYEPQLPISPNVRRNLLLGLIAGGLLGVAAAILVERSDQRVKHVDEAKELTGLPSLGMIP
KVSCPLVSQRKGEGRSLPSYYTEPFTEAVRSLALNLRYLGAEDEAKTLALTSATSGEGKSTLTYNLGRVLSELGQRVLIV
DADMRKPTVHEFIKQPNALGLSSAIATDRNWSDLIHRSESGRLHILTSGPTPPNPVALLESQKMTQMLTQWRQAYDYVLI
DTPPILGLSDSQSMVTKVDRVVLVCAIEQASRSSLMQTMETLRHTGCTLAGVVINMVKSSRDGYYYNYYSYYEHDDRTNG
KVEEPFEEAIARTHSMFDDFMNRE
>gnl|bykdb|A0A3M9ZEU1 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Leptolyngbya sp. IPPAS B-1204] (length=738 residues).
MHPKDHLEEVDLQKYWLVLKRRWLPATGVFGTVVALSTLAAVMQKPTYTATASLLVKADRSSSLVGLTKVETGELQALTT
ANSPVETQAEIVRSAAIARATIEALDLRDDNGKRLQPQDISKQLKVKNIPSTDVLHLAYTDSDPERAAKVVNQVINVYIE
NNVAANRAEAAAAREFISREIPRVEAAVRQAERALREFKEANQIVALDTEATAAVNIIASIDQQIADTEAELAKMVARSS
ALRNQLGMDSRQAALLASLSQTPGVQEVLSQYQNVQSQLAIEQARYRSSHPTVANLQRQADQLRTLLQERVQQAIGMQIP
ISEGGLQLGTLRETLTANLIDAEVERISLLGQTQTLRNTLSAYRQRASTLPKLAQTQGELARRLQAAQSTYETLLTRLQE
VQVAENQNVGNARVISSAIVPEEPSGLSKKVYLLAGGIVGALLAITTAFLLDLCDRSIKTVQEAKALFGYTLLGLIPDYT
KLGASGRKSAEPATLRIFPRDLPRSPISEAYHMLQANLKFLSSDQEIRVVVVTSAVAKEGKSTIAANLAAAAAQVGRRVL
LIDADLRYPQQHHIWDLLNTGGLSNVIVGQQELSTAIQPAMPGLDVLPAGVVPPNPVALLDSKRMAGLITTFAHTYDLVI
LDTPPLVEVADAAILGRMSDGILLVVRPGVADSTSATAAKEFLTQSNQPVLGLVANGVPLDQERDGYFYHRREQLDVELE
PNSRLVPLASPHQENARN
>gnl|bykdb|A0A3S0Y9N9 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Chlorogloeopsis fritschii PCC 6912] (length=701 residues).
MEEYLQYWLIFKRRWLPVSIVFFTVVALSIVKTLLETPIYQATAQLVLKKNATSSLTGVGSQLGQLENSVSGKPMGTEVA
VLRSLPIAERTINALSLNLNPLVFLKELQVKNIEQTDILEISYADTNPRMAASIVNTLMKIYIENDIDINRAQTRSARSF
IAQQLPLSKAALQAAEKKLQDFKQQYKVLDLKSEATSSVTILTDLEKQVAETISELASQTAKMKSIKQLFGVNSQEAVVA
GFASESPSTSLVLGQLKETQQKIEMARLRLTDNHPTVINLKEQETVLKQELKRHIEQSFIGEAGRLNKSKDSESIVQLKP
QGLQQGLLTNYASAEAERLSLQVRLKALAEMIQSYRQRADTIPQLELQQRQLEREISATESSYQTLLARYQELQVAENLQ
VSNARVITPALIPTVPIKSRQYINLLQGFIGGILLGVATAFILEKMDKTIKTPESARELLGYNLLGYIPPFTNNSPIPEV
VVKNKPDSPVSEAFRILQTNLRFFNSKQHIKVIVVSSAVPQEGKSTIAANLAFSISQIGRKVLLVDADFRRPSQDKIWNI
MNHAGLTNVIKSQLDLDNAMTKVTSNLQVITAGEQTNNPSALINSTQMAVFIAQVAQKYDFVIIDSPPFTVAADATILGK
LANGILLVVRPGVVDADSASLAKELLEKAGQNVLGIAVNGVVDKQKYYGDYHYGNYAKSKV
>gnl|bykdb|A0A3S0ZSX0 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Chlorogloeopsis fritschii PCC 6912] (length=728 residues).
MEKGFSSLLLIFKRRAFPALATFAAVIGGAIAYLQVTPHRYQTSARLMLDDKRVSVSELGRDLTQMPTNIPGGPSPLADQ
AELIKSQRVLRRAIARVIPQLNSSSLSTPLTPEKVRQGLKVKIVPATNILEVSYEHKDPALASKLVNAVSQAMVEDNTQI
IRQEAANVRKFLQQQVPEARQRLEKAELIENKYRQDSGIVSFDEQTKSLVNSLATLEEQEGTLSAQLQELRSKEVSLRQV
TDAKALDQAYASVRGGQNEELKMLRAKLAELEAKVIETRLYFTENHPTVIKLVEQRDGLRAFYQKELARVSPQNQAIPTN
AVASDRISQDLTSQLLVNDVERTAVENKLRVVQANRANLQTRLAELPIRQQKLTPLIRQREESAASLKLLQSKLEEARIA
EAQLVGNIQIIEAAQIPLKPTSPHKKAVLAIAIVFGSALATGIVLLLELMDNTLKDASEAEELLDLPLLGVLPRLPAKTL
MLEPSERFLDNSALIEPFRMLFKNLEFRSSEPLRQIVVSSTISGEGKSVVASHLAAVCAMLSRRTLLIDADLRRPAQHTL
FNLAPQPGITDLIYGERSLQQTVQPTRIENLFVLTCGELYGRPLQLLESDAMKSLLAEAVQQYDCVILDTPPLSACADAH
TLSRQSDGVLIVTRPGFTIKEVLQRAVSELTHNQIPIMGVVVNGITDQTEQYYRYPVNGYEPRSSSSFRRLANLGGAGRN
SSNSSRSR
>gnl|bykdb|A0A3S1ATK5 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Trichormus variabilis SAG 1403-4b] (length=753 residues).
MSKTPMESREDIDLDLSRYLLMIKRQWIPAASIFVATIALSALATTRLQPSYEAEGKLLFKLPSFQVLGNNLLRSNSEGE
GDLKSLVSTQNPISTEIEVISSRPLLQQTIDKLGLKNKKGEVLEVEDLQKSLTLKIVGGTDVLKLTYKSRDPKEAAVVVN
TVMNFYLENDIETNRAEAETTYKFMARQLPKTQAAVYAAEVALRKFKQENRIVDLPEETKSAVGIIGNLENEINTVKAQL
EDLNGQTETLRQKIALNSQQAIAVSSLNNSPAIREIVIQLHEIERQLATERSRYFDNNPVIISLEAKKANLNNLLQTQIK
ATIGSSAKIPEEQLQKTIASIGSGTQFPQGQAGEIRQKFIQDFLQVEVQRIGLSKRLASLYNSRSGYQRRVKIIPMLVQN
QRDLERKVEVAQSTYETILKKAQELQVAQNKNTANARIITQAKIPEKPASGKKPIVVAIGVLLGAFFGTTTILLLEMRDR
SLKTLQEVRDIFGYTLLGILPSLSKKSLFWHQNADYITPEIASKDAPQSLTSEMYRVIQANLRLLSSDKVIKSIVVTSSI
SKEGKSTVAANLATVISQLGRKVLLIDADLRVPTQHHFWQISNSPGLSEVLVAQVEYSNSIFRVMDNLDVLPAGVRPPNP
LALLDSKRMAALIEEFSSAYDFVIIDTPPLLVGADAVTVSQMTDGMLLVARPGMIDYHNANTAKEMLKRSNYNVLGLLVN
GIIEKNEPNNYFYSPEEYYSASKTVTEKDRIKA
>gnl|bykdb|A0A3S1C4K5 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Calothrix desertica PCC 7102] (length=735 residues).
MPSNQEDQNEVDFQQYLRILKRRWLVTAGVMGSVFGLTALVTFSQKPVYESQGKLLIKNNGASSLTGLSEKVGALSALTN
TSSPLDTEAEVIRSNPLVKKTISELELKDKKGKPLKVEPFLKLLKVKSVKGTDVLEMTYRDTDPKVAADVINTLVKYYIE
NNIRVNRLDATSAREFLSKQLPNIEGRVIAAEAGLRKFKDENKVVSLPEEAKYGVEALKDLSGDITKAQALLSDASSRSV
ALQKELELTTQQAVELANLNQSTGVQQVLAEYQKAQDELAVLQTRFTAEHPKVRDSEAKVQALREQLEKRVGKIVDTKQP
VSEKNLQIGQLKQTLTLDLVKSEVDRLAVNNQVQVLQTAYLNYQGRLTAIPRLEQQQRALERKLQVAQSTYQQVLKQLQE
VEVVEQQKVGNARVVSAAEVPEIPVSPKIPLNLALGGVLGIILGVGAALVLEAMDKSLKSVEEAKRLLGYPLLGTIPQLG
GSKGNGDDLPVLKDPYSPATSAFEMLVTNLSFTLSDQALRVIAVTSSVPGEGKSFVAANLAVAKVQMGYRVLLIDADMRR
PRQHKVWEKANFMGLSEVLVGQAEYVAIAQEAIHNLDILTAGTIPPNPAALLDSQRMRALLEEASKDYDFVIVDTPPVTA
VTDALIVSKLTNGILLVARPGVVQTDAANAAKMQLEQSGQQVLGMVANGVNASNVHGGYYHSKGYYGMKASEKAEQNGKV
EAPLLRIGERPSGKG
>gnl|bykdb|A0A3S1CIN8 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Calothrix desertica PCC 7102] (length=727 residues).
MEQQHNRSEDIDIRSYWLVLKRRWLIASGILFTSIALSGFAISLQRPTYQASGKLLFQANRASLLTGVGEKVGDLESVRR
EANPLSTQAEILQSRPIIEEVIKKLDLRDKNGELLKPESINIKIDPIPGTDVLKVAHISGESKKAADVVNQIMRSYVNSN
IQNNRQETIAARKFIEGQLPRAEGELNRATEQLRSFKAANQVINLEQETEETVKSIGELDKQLNEVKGQLAEVTSQQAEL
RSQIKIPSSEAVDRTSLSLIPGVQEALGELQKVQSQIATQQALYTSDNPIMITLREKEASLSQLLQQRASQSLGTNVKVS
PDKLQLGQLKEQLVGESVRLQAQRLGLESKVQTLSGLHQQFRQRAQVLPNLEKKQGDLERRVMVAQKTYETLLGRLQEIR
VAENQTIGSARIVQNAVVSPNPARMRMMLLLGAGGIFIGTLLGVAAAFLVDVIDKSIKTVKEAQDVFGYTLLGLIPKFDT
NSASIEQTMEGASPRVVVGTLPRSVIHEAYQMLQANLKFISHKTVRTIVVTSSVPGEGKSEVSANLAAVIAQAGKRVLLV
DSDMRNPSQHHLWGVMNLTGLSNVIVGQDRIRNCIQTVTRNLSVLTAGVIPPNPQALLDSEGMSALIQALSQHYDYIIFD
TPPLAGTADAAVLGKMADGVLVVVRPGVADLKSALAAKTLLMRSEANVLGMVANGVNIKHEPDRYFYYNSTRDTNNSSLV
VQASLRK
>gnl|bykdb|A0A3S5K358 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Calothrix desertica PCC 7102] (length=712 residues).
MEKGFWSVLSVLKRRGLPALITFTAVIGGAVAYLKVTPRLYESSSRLIFDDRRTSVSELGRDLSQTSVTSPGNSPLANQA
ELIKSERILTQALAIVGNSDVENSEDGQNGSTKLTVDELSQGIRVKTIPATNILEISYQSKNPDLAAAYANAVAMATIRD
NIKSISSEATKVRQFLQQQLPQARTQLQAAEAAENNYRQQSSIVDFDEQTKSLVQSVASLEDQQRTLATQLQEANSRLDS
LRQVTQAKGLDTAYESVRGGQDQELQKLRAKLAEQETQLIEARLKFTDSHPTVVKMLQQRDALRNLYAQELSRVAPGAGV
NNSNNIAGDPISQDLTSQLITNEIERAAVAQKLQLTQNNIAQLRNRLTQLPLQQQPLTALIRKREEAAASLKFLQAKFEE
ARIAEAQKVSTLQVIQAAKAASFASSPKPNVVLALAGAFGLLLATGVVILLEVMDNTLHDASEAEELLKLPLLGVLPRLP
AKTLALEPADGFLDNVALVEPYRMLFKSLEFRTSELQLLVVSSTISGEGKSIVASHLAAVSAMLSRRTLIIDADLRRPVQ
HTIFNLPGKPGISDIVEGNISLKEAVQPTEIENLSVLTCGGIYGRPSQILESAAMKKLIAEAAANYDFVIIDTPPLSACA
DTATLAKQCEGVLMVTRPNITVKEVLQRAVSELNNNHIPIVGVVVNGMTSQTEQYYRYPMSGYQMKRLKAKI
>gnl|bykdb|A0A433NM31 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Chlorogloeopsis fritschii PCC 6912] (length=738 residues).
MQSNKQEEYIDLRQYWLILKRRWLPASAVFGFVLLLTALVTFLQKPVYQAQGKLLLKRTGSTSTVTGLGKELGQLDSLVD
SPESNYPVNTQAEIINSVAFAQRTINELDLKNEQGEPLKIKEFQQRLEVKNIKGTDTLLISYKSTVPEQAQAVVNKLMDS
YLRNNMMATRTEAIAARNFIESQLPKSKISVQKAEAQLREFKERNNILDLENEAKAAVTLVTDLENQIAQAQINLANANM
RSAALQREIGINVEQAKVINALSQSAGVQKALADYQEVESKLANERSRYQENTPVIADLKLKQASLREVLEKRVQQVFKG
QQPLLDQNLQIGELQQKLTEDYVKTEVERIVFNNQLSALSKVYSNYKQRAGIIPQLQQKQRELEREVDAAQSTYATLLKK
LEEVRIAENQNVGNAQIVDVGRVAEEPVAPKKLLNFALGGVAGIILAVFIALARDAVDTSIKTLREAKEVLGYTVLGVIP
NFDKIDKLNSRNENPEQTLPKIPVKCTPRSMISEIYGMIYANLKFLGSDQELRVITITSAVPKEGKSTVSANLALAIAQL
GFKVLLVDADMRSPSQHQFWELGNNKGLSNLIVEQIDLETVVTKVEQNLYVLTSGVLPPNPLAILNSRRMASLVEVFSSS
YDFVLIDTPPLSAAADARIIGAMTDGIVMIVQPQLLDTGSAISAKELLEQSSQNVLGMVVNGVCPENEPDSYFYVKEYNT
EKDLVTSDINAKDRAKVS
>gnl|bykdb|A0A433NN38 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Chlorogloeopsis fritschii PCC 6912] (length=739 residues).
MDSIKHTHSLEEIDFQKYWLVLQRRWLPAVGIFGTVLTLASVYAFSLKPYYQAQASLLIKTNRTSSLTGLGEDLGRLEAL
VSQSSPVDTQVKIVTSVPVLQETIKALDLRDSLGNPLRIEDLAAALSVVSVKGTDLLEIYYADSDPIMAAKVVNKLVEIY
IKQNIQTNRAEAVSARKFMWEQVPKTEQAVKQAEANLRKFKEANKVVVLQQEAAEAVSTISKLEDNIATAQAQLVNVTAQ
SQKLKEQIEVESQKAITYAELSQIPGTQQLLSQLQKTQADLEVARTRFQPEHPQIVNLEEQISALSQVLQQRVEQVAGKN
QQVSLKNLQIGGVRQNLIQDLANTEKVRLGLEKQIADLNNTLFEYKQRANILPKLEETQRELERKVKAAQTTYENLLTRM
QEVDVAENQNVGNATIISPALIPDKPSGPRKTLLIAAGGILGILLGVVAAFSLELVDQSVKTLKEAKELFQYTLLGVIPN
LSRYGKTLTGRLDRPTPRVIGRDIHLFAIRDAYQMLQANLRFLSDKQLKAIAVTSSVAKEGKSEVSANLAVVMAQVGRRV
LLVDADMRRPCQHHIWGLTNAQGLSNAIVDDQIPLNTVVQEVMPNLYVLPSGVIPPNPLALLDSQRMTALVTIFARSYDC
VIFDTPPLAGTADVSVLGKLVDGLLLVVRPGVVNAANANAAKEFLTQSGQKVLGMVINGVNVKNEPDSYFYYTQESPESF
SISQDSARVRQKREKGTGY
>gnl|bykdb|A0A433UNK7 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Trichormus variabilis SAG 1403-4b] (length=696 residues).
MEEYLRYWSILKRRWLPTSIVFLSLLALSIVKTVLETPIYQAGGQLVLKKNSTSSLTGVGNQLGQLESSVSGRPLGTEVA
VLRSLPLAEQTINAIRLNINPLVFLKDLEVKNIENTDILEVYYTSTDPRTAASVVNTLMKVYIENDINANRAQTRSARDF
IAQQLPLRKAALQTSERRLQFFKQQNRVLDLKAEASASVAILTDLDKQVAATRSDLSSQTARMQSIQKLFGVASQDAVVA
GFVGESPSTVAVLGQLQDVQQKIQVIGLRLTDTHPTIMDLKKEEVILRQELKKRIEQSFIGKSGRLNQSVEPEKIVQLRG
QGLQQGLLGNYANVEAERLSLQVRLKSLAGVIESYRQRANTLPQLELQQRQLEREIAATDLSYQNLLARYQELQVAENLQ
VSNARIVTPALIPGVPIRSRQYINLLQGLIGGIVLGVATAFVLERLDKTIKTSKSAKDILGYNLLGYIPPFPNGNFIPEV
IVKNQPDSSVSEAFRMLQTNLRFFNSEQSIKVIVVSSSVPKEGKSTIAANLAFSISQLGRNILLVDADLRNPSQHKIWEI
PNEVGLSNVLKRQVDLDQAVTEIVPNLEVLTAGELNHNPASLLDSSQMAVFVAQVAQKYDFVIIDTSPLTVAADATILGK
LVNGILFVVRPGVADSHSVSLSKEMLEKADQNVLGVAMNGVNANQPDSSYYAVSRA
>gnl|bykdb|A0A433UXH8 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Calothrix desertica PCC 7102] (length=717 residues).
MAVNTENDSINFRQAWRIMKRRWLAVTIVLSSVVGITGAVTFSQTPIYEAEGKLLFNKANLYSSLTGITEGQNIDVPGIN
SNNPLETQAELIRSQPLVQKTIDALELKNSKGQPLTIEEFSQKLKVTGVKGTEVLQISYRSSNPKLAANVVNTLIKNYLE
NDIRTNRTEVVAAREFISKELPEVETKVRSAEYGLRQFKEKNRIVELQEEAKTSIKNQSDLADEIIKSEAQLVNISSQIQ
ALQNQLGFNSRTAVALYSLSQSTAVQQLLNEFRSSQDKLAMERTRYSDEHPIVIDLANKVQVLRQQLELRVVQTLGKVQN
LNERDLQIDPLKQNLTAELVKLEVERTGLSNRVATLGNAFNLYKQRAKILPSLEQNQRQLERNLQVARQTYEQLLRRLQE
VQVIENKTIGNARIVSEAQVTNRPVSPKLYLNLALGGFLGIILAVGAALTLEALDGTVKTIEEAQELLGYALLGTIPRLS
VSRHYRNRDISTLPIRDNPWSPASAAFEKLQSTLEYTLPDQVLKTIVITSAIPNEGKSFVSANLALAMAQLGRRVLIIDA
DMRCSNQHQIWKVENSQGLNEILENKIDLQTASRKVANNVYLLTAGTTPSNPFATLASPRMNALIATAQQEYDFVIIDTP
PVIYAADALVLGKLVDGTLVVVRPGAANSAISQEMKSLLTQSTQRVLGMVINDVMDETDSYYGYGVQKGYYRLPVTK
>gnl|bykdb|A0A433V7A0 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Chroococcidiopsis cubana SAG 39.79] (length=743 residues).
MKYPKHTTTIDSREPEEIDFQKGWLTIKRHWKPALGIFGVVFIITGIGVLMKSPSYTAYGKLLFRVDTTPFLIGIKTKDE
NVSPLVPLTFEGNPLSTEAEILLSEPLIRETISALNLKDEQDNARLETNLKKQFQVKNIAGADVMQISYTSKDPQESASV
VNQLMSIYIKNNISANRLQAVAARKFISSQLPTSEADVVRAEMALRKFKELNQVVDLNQEATSTVKVIEDLEKAITQTQA
ELAEVNNYYQILQNQIQSQIGMSVQDALARSTLSQSAGVQDILKKIQQVQSELAVQQTRLSNDHPSINNLKKQETALKSL
LEDRVKAVVMQQPIPKGNFQFGETHQKLLEELVKTQAKNLSLSSRLTSLENAKVRSQRRVSNIPKLEKDQRELQRKLDAA
QSTYQLLLQRLQEVRVAENQNIGNARIIESASIPRHASDFTIKIIILGLGGLVGTLLATATIFVLELTDKSIKNIEEARK
IFDYTLLGVIPYYGSFEKHSSRHKEIEQTALNVHVRDNSRSFIYELYCMIQANLKFLCSDKALKVIVITSTVPSEGKSTV
AANLAAAIAQLGKQVLLVDADMRHPSQHTAWNLINEVGLSNAIVSRDNPRVAVKEVMSNLDVLCSGVIPPNPLALLDSDR
MASLISDFSNNYNFVIIDTPPVVLAADALILGEMADGVILVTRPGVVDTDSAHIVKEALHRSGLNILGLVINGVVQKNEP
NSYFYYSNRYSEQNSQTCQKTTM
>gnl|bykdb|A0A433VBU6 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Calothrix desertica PCC 7102] (length=722 residues).
MEKGVSSLWAVVRRRSLPAFLTLSAVMAGAVTYLAVAPRMYETSSRLMLDSKSVSVSALGRDITQLDAGTPGGASPLADQ
AELIKSQQVLEKALTALKANPQTASSSEKLSFKQLSRDLKVKIIPATNILELRYKAADPVFATRLVNAVTDAMVEENIKT
MSSEATKVREFLEKKEVPNAQQRLKAAEIKENKYRQTSGVVSFDEQSKSLVTSLANLEDQERMLFAQLQEARSRDASLRQ
VTNSSNLGSAYASVRSGQDEQIKNLRVKLTELQTQIVALQQRFTPEHPELNSLIQQRDTLRAVYQQELARVSSGNALTSV
SNDNLSQTLNSQLVTNTVEGTAIANKLRTLQAERVKLQTRLAQLPIKQEPLTALTRTREQAAESFKALERKLEEARIAEA
QKVSNIRVIEVATVPTVPSTPKSTIILAIAGAFGILLSTGMVLLLEMMDNRLHDVAEAELLELPLLGVLPRLSKSNLALA
EADLFLDDMGLVEPYRMLLKTLECRSASKLHSIVVSSALSGEGKSVVVSHLAAVSAMLSRRTLLIDADLRRPKLHRVFNL
QNAPGLSDAITERRRLADFVQPTAIENLFVLTCGSMSTRPSQLLESTYMKALMMEAAESYDLVILDTPPLSACADATTLG
QLSDGIMLVTRPRYTIKEVFQKAVSDLTRDRIPMLGVVVNGINTLSDKYYRNYRNINDDQTTLPRGLARIGGAFNPNNTS
ER
>gnl|bykdb|A0A433VDI0 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Chroococcidiopsis cubana SAG 39.79] (length=737 residues).
MEPTKPIVEYSESINIDFQKYWSILKRRWLPAVIVFSGVVGLSVVVVLLQKPVYQAEGKLMLKKVDWASAATGVGEQIGE
LDTLAQQSNPLKTETEVLRSIPLVQRTIAELNLKDEAGVPLEPEDFIKELKVKQLSATDILQLAYKSTNPEEATAVVNKL
MNLYIENNILTNRDQAVEAVEFIAKQLPRTETTVRQAEAALRQFKEQNRVVNLDEEAKSAVEIIQELESQINQSQTALAG
ANARHTSLYKKVGMSSEQAIATNSLNQSSGVQKTLEELRQVEDQLVVQRTRLQEDHPAIVNLELKKNAFKAQLQGLVKDA
GVRRQVTSQQLQIGESQQKLNEALVKLEEERSGLTSQLAELSNAQATYKQRVSILPKLEQEQRELERRLAAAQSTYETLL
KKIQEVRVAANQRIGNAQIIEPAPIPKKPSLLKPAIILALGNMLGILLAAATIVILEVKDTSIKTLEEALELFGYTLLGV
IPALNKKAIPRGRDKEWAVPELPVRDIPNSPISEAYRMLQANLKFLGSDKALKVIVVTSAVSKEGKSTVSANLAAAIAQL
ERQVLLVDADMRRPVQHHVWELTNAVGLSDVIVGQAEFKASVTQVMPNLEVLTSGVIPPNPLALLDSKRMASLIESFSAR
YDFVIIDAPPLILAADALTLGKMADGVLLMARPGVGNSTSATTAKQLLERSCQNVLGLVVNGANLENEYYAKEYFTEEDS
TTRKKFMSQVVKHTNCS
>gnl|bykdb|A0A433VMS2 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Chroococcidiopsis cubana SAG 39.79] (length=747 residues).
MVRVNESNMPMTVEESDGGYGQLLAVLMRRRYWLLGVMGAVLTIATVFTLISKPTYQSEMQLLIEPNYQGKKDGTTPRQG
EQYADSGVTIDDYATQINVMRSSLLIQRAVDILRSEYPTLTVAEVKKNLVLKQVVEEKANTKIVEATYTANDPIKAQKVL
KAVHTVYQIYNREQQEQRLKKGLKFINEQIPAVTKTVDQAENKLEDFRKNNNLIDPEQQAATVNNSLNAIAQEREVIRAQ
YNDLQARYGQLQQQLARSPQQALVASRLSQSSRYQTLLNELQRTELALSQRRVVFTDEDPNVKKLLEQRQNLLSMMKQEG
GRVLGEGQASQAAAAGNAADGILQQGQLGALDLNLAGQLIEVQTNMNAMRARDNSLAQTQQKLRSDLKRFPVLLAEYNRL
VPFVQINRDKLQQLLRAQQELSLEIARGGFDWQALEEPRLGLKVGPNLKLNLLLGLVAGLMLGSLAAFLRDAVDDSVHSS
EDLERQFELPLLGMTPELPRGRVAQPEVSLPFGKPLHLSPWTVQVRNWPPSWESLDLIYRNLQLMNEMAAFKSLVVTSAV
AGEGKSTLALGLALSAARLHQRVLLIDTDLRRPSLHQILNLPNDYGLSTLLSSDATLPIHNAIQSSGSYIDILTAGPQPE
DPANLLSSQRMRELMAGFEQNYDLILLDAPPLLGMVDAMIAASCCTGVVLVSRVGMVKKTELVQANAMLRKLNVIGVVAN
GVSNVSYGYGAYSREQGVELKKVWGNG
>gnl|bykdb|A0A433VN22 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Calothrix desertica PCC 7102] (length=671 residues).
MTIAARHWKSLLVLNALVVSATIAAYSTSKPVWTTTAQLILPKTTSNLDASLGTLGTFKNGNLDFSPELNPLKVQTSILM
SDALLEKVLDSDPEKNKFKNLEQYKALFQVSPQEQSTVLSLTVSGSQPDLATLRTQNLIKAYQARLDELREGNSKERQKF
NVKELEQAKAKLSNAQTKIARFKQATGIVNNDAQTQGIVTTINALVGSRAQALSLAQASASRSKVLSERINMAPASAVRS
LSLSENQEFKAVRKELSEVEAKLVQKQAIFTINHPEVQTLLAQRSTLRRQIGAYITQVAGNIPVDPTIATDSQGRAVLIQ
QQLLSESEAEAQFQQARQLEKQITELQRYLNSLPAKQAQLLELQRQLDVAEGIYKGLVAQVQQKSVDAFDAYPNVQVLDP
PRVNSKPISPKLFLMAINALLASVIGSIALVLFLESRNPLLSAKDLQEQKFAIVERIPRIKHSGVISELAIETEVEFQRL
ASAISLQPLENRRLLVTSAIMGEGKTTVAIGLANALVDLGFKVLLVDADFRQAALSRRLGYTQTSTEDLSISIQPNLDLL
PTLPRQGKIVEIIRRGNFEKTLATCEANNKYDYIIVDSAPVSFTSETPLIANIIRNVLFVVRPDTSYRDSVNESFAQLTQ
HNAQILGLVVNGVATNSRPYSYTHGASTTKS
>gnl|bykdb|A0A433W447 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Chroococcidiopsis cubana SAG 39.79] (length=712 residues).
MEQKYALLPTIFYRRRLPALATFISVMLGALVYLIFAPRTYEAEARLMLDGKQLSLAGETGRDLTQESARLDSNPVATQA
ELALSQKVLRQAIYEAYTANNRNSNAEPPTVEELRKQLKVKTVPATSILEIKYSNKDPLIAAKLLNALTEAMINEDTAVI
RREAGSARQFLAVEVPKKRAQLAQVEATLSQYKQSQGIVSIADDQGRDNAQTTSIVESLAQIEEQERTTLAQLQEVKARN
SSLEQVTDSSTLKNTYATVRSGQNEQLQALRTQLVELEAKVASAQSKYKADSPPLLNLIEERDAARALYQQKIGSETGNP
AASTPNAATDKLSQDLATQLITGEVEASALEGRLAAIRRDRATLQERLNQLPIREQGLAALVRQRQEAVTSLEFLQRKLE
EARIAEAQKVSNLRPVDLAEPPRLPTWPNPAIVLVLATVAGGTLALGTVLLQEGLDGTLRNATEASSLVEVPIMGVLPVI
SPEVRGKEYADALMQEPAILESYRSLLRSSEFAANEDIKVIVVSSALSGEGKSLVSSYLAAVAATLSRRTLLIDADLRCP
TQHKLFKLAAKPGLAEVAQGKLALAEAVQTTGIDKLKVLCSGRPRSHPSELFESRQIQQVIAAAASQYDLIVIDTPPVTS
CVDAVSLCGNGEKLLLVARPSFTQRDIFTQAVAELRAKRVEILGVAVNGIDPQIDKYYRYAFQSYKTLTNVS
>gnl|bykdb|A0A433W4W4 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Chroococcidiopsis cubana SAG 39.79] (length=771 residues).
MADTSLDNERLSVEHRVENRANATDLRQLFTVLLRRRLLILSLFCIPLSASSFLALMAKPTYQSSMQLLVSSNLYQGQNS
NAQGGVEESDFTDSNLKVDYTAQLSVMTSPKLVERAVELLRPEYPNITVEEINGKPAKVKQSPLKVTQVESGTKTLQTLS
QVFEVTFVAGDPIKSQKVLQALQNVYQIYNLEQQKLRLTNGLAFVNEQLPKIRKDVSQAEANLENFRKQNKLLDPEVQAK
NLLDALAAVESERRTIRAQFQDQQARYNKLQQQISRSPQQALIASRLSQSPRYQSLLDEIQALDVTLEKLRVQYRDDYPK
VQDLLKQRQNLIGLLRTEAGRSADRLPAQLSTTEKSLPKQLQLGDSDRKLVDALVDAQVVWFGLSARDQSLAKSEQQLRS
TLLKYPQLLAEYNRLMPEIAINRKTLEQLLQTQQNLGIKIAQGGFNWQIIRDPEPGVYMGTGRIMLLVSGAVFGLVLGIG
AAFLLEALDDTIHSCDELQKLSSLPVLGITPKLPNFELKKPSIALPFFKQQSLTSQRIQALNWFPFRESMDLIYQNIQIL
GSPLSFKSLLLTSALTGEGKSTLAAGMALSVARLQRRVLLIDADLRRSNIHKLLNLSNDRGLSTLLTEEADVRERDCIQS
VQPSLDVLTAGPTPTDIVKLLSSQRMKHLIESFEQSYDLVLVDAPPILGLADASIVASLCSGTVVVERLNRVTRFDLNQS
LEALSKLNVIGAIINESKECNSRYTVYDGTSQDNLERGFTTNPNLAGRGIF
>gnl|bykdb|A0A433W533 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Chroococcidiopsis cubana SAG 39.79] (length=738 residues).
MQERLIETSENLDLDFSKLWIILKRRWLPGTGVFTAILGLAIIAVCLQKPVYEATGKLIVKKNDQTAALTGLGQGIGDLE
GLNLQSNPVNTEIEVVRSIPLLQKTIAALNLKDDRTSEPLKPADIIGKLKLKNIGGTDVMQVTYKSISPDEAAAVVNKLM
NVYLENNIQTNRVTATAAGDFIAKQIPDVEARVRRAESALRRFKEQNHLIALEVEAQGAVTVIQTLEGQIAQVRAELANA
NTKLAKLRQQVGMDTDTSLNLNALNQARGVQRVLTEYQKTEAELAQLRTRYAETYPGISNLKQKRTALKALLSQRISQAV
GKTRTLADGKLQIGESKQKLTEAYIQLEVERLGLASRLASLSGEYNLYKQRANILPKLEQQQRELERQLKAAQSTYEILL
QKLQEVRVAENQNMGNARIIESALAPEKALSLKPMIILAAGILLSVVLSSGTVAVLEIKDTSVKTLKEARELFGYTFLGA
IPSLTKKAAADGKNAEATTIALPVRDTPRAPIAEAFRMLQANLKFSSSDKLKVILVTSSVPGEGKSTVSANLGAAIAQLG
NRVLIVDADMRRPRQHHIWEKANTEGLSDAIVGQVDYQSAIKEVLPKLHILTAGATPPNPVALLDSVQITSLIDNFAKSF
DFVIIDAPPVLVAADALMLGKMTDGLLMVARPGVVSSNTATTAKDLLQSSGQKVLGLVVNGVILENESDSYYYYVKDYYM
EEDSTNRQRSTANRKAAS
>gnl|bykdb|A3ZA21 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Synechococcus sp. RS9917] (length=825 residues).
MSNLIPRAGHSPNLAVQGIQTVQVRDLGTSVAAGPAAADDEIDLRELWRALKRRKKLVGVTAAAVVALAGMVTAYQRIFR
PVYQGSFALLITDPISNEGGNGRNAAFAASGTMFEQLARNTTQNDIPTLIEVLQSPLLLAPIAKRFDLAENALASRIEIS
TGGAKRKEADGVLNVSLTGRDPEQDEVLLQAISTAYLQAALQQRQQRLADGIDFLNKQAPALQQKTEAIQNELAAFRRQH
SLLEPTAEGGALKDRETAVATEILGLEAERSRLQRVRAEIAAGTLSARGFQEAISTGSGGGGQSAQGLSVSDADQSLLQQ
LLKVETELAEARAKYNPNSSMVLSLEARLNQLQPLLRQNQLEAVDAALSLNAGRLATAQAQERQLNVQFLRQPALIKQYE
ALQTRLKIAQDNLAGLVSARENFQLEIAQRSVPWRVIDPPKINPDPIQPSVPRNLALGAVLGLVAGAGAGLLRDRLDHVF
HHPGEVKDDLGLPLLGHIPHVSFFQGVREDKRFLLQELDQSVSGGDADDRREQRYQRFFYQEAFRNLFTSIRFLNSDRPL
RAIALTSSLPAEGKSLVNVLLAKTLSEMGQRVLLIDADLRKPQMHTRLGLNNLSGLSNLLADDGFHWRDVVQTVPGYDQW
SLITAGRRPPDPTRLLSSQRMHSLVQELANGGEFDLVVFDTPPVLGLADAALVAEHCDGLMLLVSLDRVDRGLPKESVAR
IRSSGAPLLGIVTNAIKAGKQASAYGYGYGQYGYGKYGYGYGGYGYAAYDTSAAYAHYADPEGSEAPSANTSVAPGQPDQ
AEAGSQHWSAALRQRGRAVMRWLDS
>gnl|bykdb|B0CAX4 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Acaryochloris marina] (length=744 residues).
MPMSNEYSHESIDVRNYFRILRRRWIPATAVFGSVFVLTALATFLQKPVYEAEGKLLLKKQGGATIADLEIGGLGGLEAL
SSKSSPVQTEAEIIRSEPILRQTITALKLVDDEDQPLETKDFIEALTVFNVRDTDVLKVTYKSIDPKESADVVNRLMDDY
LKNNIETNRAEAASARVFIEKQVPEVAAKLKNLDLSLRRFKETNGIIALEEEAKVSVEVEGNFYQEAAKMQSLLINARAK
SRALRNKLGLTPQQGEDINALSQSTVVQQALADYQENERELAEALKVFQPTHPTVLDLKEKRIALKGVLGEQTSQIIETK
QPQPLRNLQAGESRQSLTDALVEAEVERLGLEKQVLSLAQTQAENKRRQGIIPKLEQQLIALERDRIVAQTTYEELLKAL
QQITISENQNIGNVRVIAAALEPKEPVSPRKAFNLAVGFFLGGLLGLGTALLLEALDTSVKTVQEATGLFDYTVLGNIPL
LKDAEKMTRKGLDRPTPDLVVRDSPRSSVSESYRMLQANLKFLSSDHHVQVFVVTSSIPKEGKSTVVANLALALGELGHR
VLVIDADMRRPSQHQVWELPNALGLSNVLVEQKDWHEAIRPEDDQLDILTAGVTPPNPVPLIDSHHMAVLLEEFHQAYDY
VLIDSPPLAVAADALLLGKMTDGVLLVTRPGLVDTGSAQSAKDALERAGQKVLGLVINGVIPENEPDSYYYYYAQDYYGE
NSGGKQSKAKKKKKKADVNAVERS
>gnl|bykdb|B2J6N5 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nostoc punctiforme] (length=748 residues).
MSAKSTESRESIDLDLSRYLLILKRWWLPATVIFTATVILSAIATQFMKPSYEAEGKLLFRIPSFKVVGSNLLPTNTEGG
DAGDLKSLLATQNPINTQIEVISSPTLLQRTIDKLQLKDQEGKPLEVEKLRKSLTLKIVSATDVLRISYTSPDPEQSAAV
VNTIMSLYLDNDILTNRSEAAATRQFIAKQLPKTQEVVNNTEVALRIFKQKYQIADLSEETKSAVATIGNLDNEMNTVKA
QLDEVNAQTNELRQKVELNSQEAIAVSALSQSPAVQGVLTQLQETERQLAIERSRFLDDNPVIINLEAKKASLKSLLQQQ
IGQTVGNKTEVSQNLLQIGGLKQNLIQNFLQSEIQRIGLAKRLSSLYNSRSIYEKRVKLIPQLAQNQRELERKAEVAEST
YQTLLKKVQELQLVENTNTASSRIIAQAIVPDKPVESKKIIVLVLGVMFGLFLATTTVLVLGMRDRSLKTLQEIRDIFRY
TLLGIVPLSVKKIHSRYSNTESINQTIAVRDTPYTLTSEMYRMIQANLKFLSSDKVLKTIVVTSAVPKEGKSTVSANLAT
AIAQLGRQVLLIDADMRVPSQHHLWEVSNADGLSEVLVGQTEFDVALSKVMDNLDVLTAGSRPPNPLALLDSKRMASLIE
SFSSQYKYDFVIIDAPPLLLAADALTISQMTDGILLVARPGVIDSNSASAAQEILERSSHNVLGLVVNGIIDKNESSSYF
NHVKQYFTYQDLTKEAKLQKRIPNKTSV
>gnl|bykdb|B4VS56 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Coleofasciculus chthonoplastes PCC 7420] (length=765 residues).
MGSNGEYQPLPPNRNGHLPSELSSLSLYELVETEDDKLDLRQILAVARRRALVVAGMAIAVTSGIVTKVLQQTPNYEGKF
QLLVGSVSGEDQLEQISESLNQSAGVQTNSIDYETQIQVLWSPQVMTPIVEQIQSRYPEIDYNTLRSQLAINQLQETKIL
EVRYQDSDPEKIQFILEQIATGYVNYSLSEQQTSTRQGIQFVEEQLPKLQGRVDSLQQKLQRFRQQYNLVNPDSQGQLLT
SRVSTIVQERQNTQTQLDEARTLAVQLQSQLGELGLSPKQAIAASALSEAPRYQQLLNQLTEIESKIASESARFTEQSPT
IQALREKQQNLLPLLSQEAGTVLGANASAVPENPESLASPSSLRLALTQQLVETTNQINMLEVRSGAIAKAERLMSQQLK
NLAVVARQYTDLQRELKVATESLNRFLAVRETLQIEAAQKTLPWQLIAEPQQPQAPISPNIPHGIALGAVAGLLAGAGAG
FLAEKLDKVFHSAEEVKEKTGLAVLGTIPFHKPLKKPSKSAKTAGKLETPLLASPISQSTYRYHASPFLEAFRSLQTNLQ
FISPDQPIRSVVISSAVPADGKSTIATFMAQAAAAMGQRVLLVDADLRRPQLHVRTDLPNVWGLSHVISSDINVKDVIQP
SPLEENLFVLTAGQIPPDPTRLLCSQKMQHLVESFEEMFDLVIFDTPPMLGLADARLLAAHTDGIVMVVGLGRTDRTVLM
QVLSGLKTSHARVLGVVANGVKNYTTSSYDYYHRYYAKMPQETTV
>gnl|bykdb|B4WP72 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Synechococcus sp.] (length=748 residues).
MRDKEYTEEIDLQKYWCVLRRRWRLATFVFSSSICLTVLALASQEAEYEATGKLLIKGGRTSSLTGLNVDIGELEALDSL
QKDPLRTQAEIIQSLPTLEKAIATAEAAVIEEALTPTSLKEGLEVKAIPGTDILEISYQSPDDQTAPVIVNALMEAYIEN
NVETNREEAIAARRFIAGQLPQTESAVSAAEANLRQFKEENGVVDLEQEAAQAVDSIGNLDTQIDQAKTELANVNARLLE
LRRQLGMELETAIELNTLSQSPGVQEVLTELQAVQSQLAIEQARYQSTHPAVLNLQRQVNSLESLLRQRIRTVTTNGRQQ
FENSNMQLGELQQSLIELYLQLEVDRVGLSQRVSELSDLQGVYRRRASTLPALEKTQRELERRLQASQTTYEALLTKLQE
VQVAENQNVGNARVVEAAIAPESPVDSRRELILIAGILAGSLVGISAAFAQDLLDRSIKTLNDCREQFGYALLGAIPLFN
ETSNLHRSKSHSKQLASSVFSNVRTRSRNVHASVVTEAYQMLWSNLKSVTSRQELKTIVITSAAAGEGKSEVSVNLATTI
AQSGQRVLLIDADMRHPSLHKTWNISNRVGLSSFLVGQSSAQDTIQSVMPRLHVLPSGWISSNPVDLLDASSMERLIAEL
SEYYDFIILDSSPFVGCADPSILGKVADGVVLVVRPGVLNAKAANAAREHLMSTEQRVVGMVVNALDVKNDPDSYFYSTY
YTRVDEINSRDRSVVPDTVVSNQGIFRL
>gnl|bykdb|B4WQE3 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Synechococcus sp.] (length=734 residues).
MSSANPPVLRDIIQEPDQEGGLRLGRVVDVLKRHVFLITGITALATSAVVARALTETPLYRADFELLTPLVTLETQIIST
ISPDALSNQSESVGVGLLDDTKLKILTSPRVLVSAVEELEKTYPDISYDSLKNNLTITPNDNGKTLTVQYRSDDPYKVTT
VLEVVLQTYLNYSLEDRQNDIYRGVDFVNDQLPAVRARVNELEAELEALRQNSNLIDPLAQGDQLSQQMAQFTSDHLNLQ
VEIAQTTELYNDLQQELSRIDNEYASTSALAQSARYQSLLDQLLVVDSELADNLTVYVEDSPEVEVIEERRANLEPLLER
EGVRVQEQLASRIRELNARDQALRESIATLDEQIRNLSTVTRSYNSIQRDLEIAATNLNEFLTKRETLRIEAAQQQTPWE
ILTPPSAPQAFSQTGKSSLLVGPILGLLLGSGIALLVDRVKGKICTVRELKDLTNVPLLATIPYNHLLEGSKASILPRYE
ATRQPIYFNEGVQHLDRTTGPFLEAFKLLATNVCQGGSQDIAKSFSVSSAVPNEGKSTISFYLAHASASLGKRTLLVDAD
LRHPTLHRLCNLPNEKGLSDYIAGDALLDESFVNLAVDENLFFMSSGSIAVDPAKVLASKKIEEFFQQIYKTFDVIIFDT
PPLLGFADSLMVAQITQGLLLTVRLGEIKSSQLQQALDRLYTARVPVMGIVANGSREDDDSLYAYQQYYKEALEEDSSAI
LTPAINLSNGAAGK
>gnl|bykdb|B5W297 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Arthrospira maxima CS-328] (length=739 residues).
MDFSNIEHRESIDLDLGRYLQTLKRRWFWLLGVFVLSVSGAVYATQFLTPTYENSGKILFKVDRTSSLAGIGEGLGELKA
LLADQTPLSTQIELMYSNPLLETVIERLNLTNEDGEPVAPEDIRRNLDMRIIGGTDIVLLTYQSRNPQEVADVINTVMEV
YIEANVSSIRQDASGAKEFIQEQLPRVQKELFLAEKSIQDFKERNEIVDLGTEFAISVQEMAQLNRNITTLEAELNAVQS
LVNSLGNQVGLNLEEAIAVNTLSQSPVVRAALQELENVEGELAQEQRRFRDENPRIISLKGKRDNLENLLQREIQVYLGS
SRPFSRGLLRVMDVKNNKIEEFVNAEIRRLDLTKQLDSLYEARDGLERRARILPQLEQQQQELERKAEVARLTYRTLLQN
LEEAQVAANKITNNARIIETANVPDEGKTAKVPLLALGVMGGLVASTTLLLLMEMGDKSLRTVAETRDLFGYTLLGIIPS
FAAPPFYRYLTGGDRSSVQVPVVDTPGSLISEIYRMIQANLKFLGSDRKVRVIVVSSSVPQEGKSTVSANLAAAIAQLGH
RVILIDGDMRQPIQHHIWGLTNAVGLSDVLVEEATLSEAVKPGIDQLDILTAGVTPPNPLALLDSRRMTSLIRNFSEEYD
FVIIDTPPLLLAADALTLANMASGVLMVARPRILDRDSAKAAKEILGRSGQRILGTVINGISKNESTKYFYHAQRYFPLQ
KSHRRDRSAPPKISSRSSS
>gnl|bykdb|B8HNB0 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanothece sp.] (length=750 residues).
MVQFNAERWLQNQQLLNELYFSASDKVELLRTLKKRWIPALATAVTVFAGCYIYSALQTPLYRSEALILTGKEQSTPLGE
EINSTSSYSNWSNPLINEIQVLQSSSLVTKAQQQLKPPHNKTSVGSIAGGLSITQVGDSDVLKVTYTGTDPKTVQAILDA
LNKTYIDYSLEKRRSQVSSGVRFIEEQLPAAQAKLAQSAQAVRNFRKQYGLVTPDAYAEAVVSTRMELEKQGKDAEIAVK
TTQRQLEEVNQQLADLKVNPSQAVPISVLLQDSNYQKLTTRLQEVELSLAQQSLTLQNNHPTIENLRAERADLLKLMRQR
ANGLLRTQLNRDLTTLPSSASSGSSDGSVVQGLTDKALEAQISLATQTAQLNGIRQAQQQVAERFQALPQLQQQYAELQR
QLKVNEDVVGRFMERLQELRIAEAQRTTSWRVLEPAYLPTAPISPNMSRAILLGLFAGVLAGIGLALLIERLDSRIHSVE
EVKRASGLPLLGTVPRSRSSEPHKDTDSPFVEAVRSLGLNLRYLSPDTELRTIAFTSTIPSEGKSTIVYNLGRMLAELGQ
KVLIVDADTRNPTIHQIIEQPNLRGLTTAIASDKSWQEMLIPGGVTNLDILTAGFRPPNPIALLDSYKMVGLIDEWRQHY
DYILVDTPPVLGVPDIQSIGCRFDGVVMLVAMNGPTTAALTRAVEILRGSRSNLLGVVANMLDREHTGGYYYYSYYYQYY
SKDGEQDGPAAKGKPASDEVEVLSDANPLK
>gnl|bykdb|B8HTN4 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cyanothece sp.] (length=741 residues).
MQALEDDRIDLGKYLTILKRRWLGGAIAFGSILSLVIAYTLLQKPVYQAQGLLLLKDSENPLASMGATSVGNLVALGGKS
SPIDTEAQIIRSTPIIQELITTLQLKDPQGQLLKPEAFLESLSVNNIRGTDLLQVSYRSTDPKQAVAIVDLLIKIYKRNN
ILANRLETTNSREFIERKLPDVTEQLRGLDRQIRSFKETHGIVDLPTEQIESVKFKSLLARDLAQAKSLLATAQARATGL
SQQVGMSIDLARFSNAVSQSKGVQVVLDQYQQVEAELAVARTELQPDHPKIKTLEEQLTELNTILRERVRDVAQASRKGG
SLPTSNLQTGASEQQLVDNFINAEVERLALSSQVTSLSRTEQTYQQRMNALPKLEQWLGELERRRVVAQTIYEGLLKTLQ
SLQISEQQNAGNVRLIQAATLSDEPVSPKLLLNLILGTILGSLGAIVVIFILESKDKTLKSLEEIQQYFDYVTLAMIPFD
KAAATANKAFKPTQGLERATPQLYLRDQPNSHLSEAYRTLQANLKFLSSPDHPIRTIVITSTRPQEGKSTVSANLALAIA
ELGHKVLLIDADLRLPLQHQIWELPNATGLTHLLADNHSSTKFIHQESDNLDVLTAGPRAPNPLLLLDSQHMASLIDKFR
TVYDYVLIDTPPIGVAVDALVVSKVADGILVVVRPDVTDSNTANAAREALVKSNQRVLGLAVNGVTRSDGSYHYYDGYYS
SDNDTTANGKTRSEKLGMERL
>gnl|bykdb|D4TGN7 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Cylindrospermopsis raciborskii CS-505] (length=746 residues).
MLIFCVMVEPVIATGVYMPINKKETDVIDLQIYWLILKRRWLVILLVIASVLGAAISYTYSQKPVYQAKGKLLFEKKDGV
SSLTSLATSVGELGGLGNNSNPIDTEAEVIRSHPLITKTINQLGIKNTKGEPIEIDRFLKQLKLQTIRGTDVMELSYSST
NPQEAADTVNTLMKYYLDNNILINRSEATAARKFLSQELPRIEKQVIKAELELRRFKEINRVVALDAEAKVGIETLGRIN
EVITQAQGQLAAASTRSLALQNELQLTTQQAVALSNISQIPGVQQVLTEYQKTQQELAIAETTYTSDNPKVVNLQLKEQA
LKKQLQERVSQTLGNAEVLQQSNLQIGELKQGLTQDLVRSEVERLALANQVKALQSVFIINKRRLDSLPRLEQQQLQLQR
QLQVAQGTYQQLLKQLQEVQVLENQNVGNARVISSALVPEIPISPRTALNIGIGALVGVVLGVGTALLLETLDKSVKNIE
ELNRILDLPMLGTIPQYENTKRQKNAGGEESQRELPILDNPYSPVSTSIEMLQTNLGFATDKELRVILLTSSSPGEGKSF
ISANLALAASHLGKRVLIVDGDLRRPRQHKVWGLPNFVGLSNVLVAQTQLENCLQDVSSVHVLTAGKVPPNPVKLLDSQS
MASLIAAARRDYDFVIIDTPPLTAVADALIVGKLVDGVLLVVRPGQVESSAVKASNSLLAQSKVPVLGMVVNGVSEDSGY
GGYYYYRGYYGDLKDKREGDSLAIKR
>gnl|bykdb|D4TNI2 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Raphidiopsis brookii D9] (length=736 residues).
MPINQVNQEESDVIDLQLYWMILRRRWLVVLLVMASVLGGAISYTLFQKPVYQAKGKLLFEGDRVSSLTRLGGLAELAQL
TGATSSGGSGLENEAEVIRSRPMLEQLVETLELQDDEGKPLDPDVILGNLKLQTVRGTNVMEFTYDSKIPDEAAKVVNGL
MNEYLLSNIVINNSASAKARQVLAKKLPRVERELAKAETDLRQFKESNEIISLEAEAESGMKNVSTVDAAINQAQAELAV
VYTRSSALQNELQLNKQQAVLVSTLSQIPGVQEVLKEYQKNEQELAVAQTTYTNDNPKVVSLTAKGQVLKKQLQERIYQS
VGNVGALGERSLYMPDLKQGLTEELVKSEIEKLTLSSNINALQNVLSIYKRRLTSLPRLGQQEARLRLRLEIVVTTYKQL
QKQLQELEILQGETTGTARVLSSALVPKRPVSPRIPLNIGIGAILGVILGVGTALVLESLDKSVKNIEEINRLLDLPLLG
SIPNFETKKRKNKGEWEGEGDLPLFDQPYSPISRSFQILQTNLGFARDRELQVMLVTSSSQGEGKSFVSANLAAALSYLG
KRVLIVDGDLRRPCQHRVWKLPNFVGLSEILAGRTQLGASIQEVSSISVLTAGNTPPNALQLLDSESMVNFVQKVRNEYD
FIIIDTPPLTAVADALVVSKLVDGVLLVVRPGRVESSAVSAANTLLTQAKVPVLGMVVNGVSEESGYGGYQYSGYYTGDY
EDLKDSHQGNSVGLKR
>gnl|bykdb|D5A466 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Arthrospira platensis] (length=740 residues).
MDFSNIEHRESIDLDLGRYLQTLKRRWFWLLGVFVLTVSGAVYATQFLSPTYQNSGKILFKVDRTSSLAGIGEGLGELKA
LLADQTPLSTQIELMHSNPLLETVIERLNLTNEDGDPIYPEDIRRNLDIRIIGGTDIVLLTYQSKNPQEVADVINTIMEV
YIEANVSGIRQEASGAKEFIQEQLPRVQQELFLAEKSIQNFKERNEIVDLGTEFAISVQEMAQLNRNITTLEAELNAVQS
LVNSLGNQVGLNLEEAIAVNTLSQSPVVRSALQELENVEGELAQEQRRFRDENPRIISLKGKRDNLESLLQREIQVYLGS
GRAFSRGLLRVMDVKNNKIEEFVNAEIRRMDLTKQLDSLYEARDGLERRASILPQLEQQQQELERKAEVARLTYRTLLQN
LEEAQVAANKITNNARIIETANVPDEGRTAKIQLLALGVMGGLVASTTLLLLMEMGDKSLRTVAETRDLLGYTLLGIIPS
FADPPFYRYFTGGDRSSVQVPVVDTPGSLISEIYRMIQANLKFLGSDRKVRVIVVTSSVPQEGKSTVSANLAAAIAQLGH
RVILIDGDMRQPIQHHIWGLTNAVGLSDVLVEEATLSEAVKPGIDQLDILTAGVTPPNPLALLDSRRMTSLIRNFSEEYD
FVIIDTPPLVLAADALTLANMASGVLMVARPRILDRDSAKSAKEILGRSGQRILGTVINGISKNESTKYFYHAQRYFPLQ
KSHRRDRSGSPQKISSKNSS
>gnl|bykdb|F4XKF3 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Moorea producens 3L] (length=771 residues).
MAGLVANSHQYQKLFYCAIYLGGAPEELMESRSSIDLDLSQYKLLLKRRWLPAVAIFLFTVISAAWSTLFLKPSYEAEGK
LLFKIDRTAFLTGLGEEIDQLRPLVDAQNPLSTEVEVIYSHPLLQQIIDQLNLTDNEGLPLQPEALKRKLTVKIVGGTDV
VRLSYKGKNSEKGAAVINQLMRLYIENQILSKKSEAAKAREFITNQLPQSEANVRQAEAALRQFKERNQVVSLTEEARSL
VAVMADLDSQITTVQAQLEEANAQAAGLRNQVGLNPQQAIAISALSQSTSVQGVLQELQEVERQLAVSKNRYGKNHPIMI
RLTKQQRSLRGHLQQQINQILGSQSLAGTQIQITQGLLEVDQLKQKLINDFIESEVKRQSLAEGLSTLAKARIAYEQRVN
VLPRLEQTQQQLEQRVQAARLTYETLLKNLNELKVAENQDTANARIIEPAIVPKKPLGDKKIKVLALGVMLGVTLATTAV
LLLEMRDRSIKTLKEVKQLLRYPVLGVIPVFKHKKLSRRRDDLFFGGELPVTEQPHSMVSEVYRMIQANLKFLRSDHPLK
VIVVTSSVSKEGKSTVSANLAAAMAQLGRRVLLIDSDMRHPCQHYIWQVMNVAGLSQVLIGEVPLELAICKAMENLDVLT
AGVMPPNPLALLDSKQMASLIQECSTQYDFVIIDAPPLLLTADALCLSPMTDGMLLVARPGVLDFANANVAKQMLDSSGQ
TVLGLVANGVIQKDESIGYFYQSQEYFHYGSVRRLVQRQAQTKKTSNVSRR
>gnl|bykdb|F4XP71 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Moorea producens 3L] (length=753 residues).
MKELDLNAAGETDAGYGQLLAVLWRRRLWIISVLLTSLPIAFYITLKKEPNYISSLQLLVEPNYIDKTRGIESQFTESTV
DIDYATQLQLMRSSELIQRAVDLLRDDYPDITVGDIRGSLRLAQVLQGKTETKVFQAVYTSNDRIKTQKVLQAIQKVYQD
YNLEQQEMRLNKGLAFINQQLPTARNNLEQAEQRLEQFRKSKNLIDPSQQALAVSQTLNGIEQERRAIRAQYMETQTRYQ
AVQQKLARSPQNALTSSRLSQSGRYQNLLNEIQRIELALVEQSRIYTEAHPRIQKLIEQRQSVFALLQEETRRVLGQVPT
KLVTTGNNLLTEGQLGGVDLNLVNELITSQINLVSLQTRDQALAKTEQEIRIQLREFPALIAQYNRLQPQVAIQQNTLQQ
LLQARQELSIELARGGFNWQVVEAPLPGSKTGPNMTQDLLLGAVVGLFLGGVAAFVREAMDDGIHTSDDLKNQVALPLLG
MIPQLPEGKISKPVLNLGLSQSERTLPMMELLGWRPFQEALDMIYVNIQLLNSGSELKSLMVTSALSGEGKSTLALGLAL
SAARLHRRVLLIDVDMRRPRLHQQLGLSHQEGLSTLLEDDTATPSPVSISPLGSTIDVLTAGPTPIDPVKLLGSKRMKNL
MAEFQQTYDLVLLDTPPVLGMVDALQAASLCQGVVMVGRLERVTQSQLSQATAILRNLNLMGIIANGVKSSNQNYAYYGS
RNNHAAIEPQQPVSDLQESPQLERQFSNHVKSR
>gnl|bykdb|F4XTX2 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Moorea producens 3L] (length=675 residues).
MKKVVAILNRHWILLLVFNSLVLAASFGAFSLLKPFWIAKAQLILPETGKLQASLGTLGSLTKGDSELSAKSHPLNMQAS
ILKSDALMRRLLESDPEKTDFQRLVQYKQLFAVSPHQESTTIWLNATGASPELARDRVRALISAYQERLNELRQADGTTR
VEFNKKALDRAKQKLDQSQEALAKFQESSGLVNSEAQTEGLVRAITDLSISQAQAQAEAQASQHQLQILSTRLGLTPKQA
IRSLGLAENRDYQFVRQQLTELEATLVKAQATYTYAHPEIQNLLLQREQLQQQIQQYIFLAAGDTLVDPTLTDSAQGRAM
LIQQLILAESAASGQQQQAEQLQQQIDQMKNTLTVIPVHQSRLLELTRQYDVAAGVYNGLVAQMEQVNLDAFSAYPNVQV
LDPPTVDEKPAGPKKLLIIANGFLASAVGSIALVLLLERRNPLLSPKDLQAIKFPMVVNIPHLRHAGMGLELGTETDVEF
QRLASVISLRSGEDRRILITSAMVSEGKTTVTLGLATALVDLGFRVLVVDGDFRQATLSQRLGHHHDPLKPGQPVKIQPS
LDLLPTSHKKGKIVELVTQGKFEQSLATAEESGDYDYVLIDSAPVSMTSETALMAAVIGNLLFVVRPEISKRDFVSDSLE
QLAQHNAQLLGLVVNGVETKSKPYLYRSSDSLVKS
>gnl|bykdb|F4XV38 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Moorea producens 3L] (length=731 residues).
MDTSLSSLPLALKRRLLPALVTFTSVIGGAIAYLVVTPPVYQVKARLMLDNKKVSVSELGDNLSQVPANTPGGADPIATQ
AELVGSERLLQGALDEIALLGSSQEGLTIDTLREDLKVKIVPATNILELSYQGQNPELVTTVLNAVANAMVTESAEGIRS
EARAVREFLEKEVPLRRLEVAAAEAALNKFKQTTGLVSPEEQTQLLVRSLATLEDQERAVSIQLQDAKTRSQELQTITSL
NNTQNAYIAGRIGQDQELQALRAQLVELDRELAKMRSRLTDQNPAMISLVQERYELLTLYNQKLSRLLPTNQSNNQIIAP
GDVASDQLSQDFTSRFILAQTERSALEQKLYLVQTERIKLQNRLGQIPVLRQPFASLVRRQEEAIASLKLLQNKLEEARI
AEAQLVSNIQIIERAKLPSSPQEPNPKVVLVIATAAGIALAVGMVLLLEVMDNTLHDASEAEALLKLPRLGVLPKIPAQA
LSLEQPNRFLEDMRLMEPYRLLLTTMELRAQKRLQLIVVSSAVSGEGKSVVASHLGAVSVRFSRRTLIIDADWRHPMQHN
LFGLPPKPKVTDVIDSNQTWRSAVQPTAIANLSILTCSDQPSGSATFLQSQMIKSILAAAADHYDLVIVDTPPVSSFADA
HILSRYSDGLVIVTRPNFTQKDILLQTVSELKDSSTPILGFVANGISDRTQQYYFDSFDSYQPQAEFRQTHGKEASNNCA
VVSKGVDHADS
>gnl|bykdb|G4FMX5 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Synechococcus sp. WH 8016] (length=818 residues).
MSNLSAQPNPQAVDGLLQVDGSDEIDLRDLWRALKRRKKLVGVTAAGVISLTCVSTAYQRIFRPVYQGSFALLITDPISN
DSGNNSASAGGLNGSMFEELARNTTSNDLPTLIELLQSPLLLSPIAERFDLSENGLASRITITTGGEKRTEAEGILRVSL
VGRDKDEDQQLLTALSDTYLKVALQERQQRLADGLNFLNKQAPALEAKTEQIQSEVAAFRIKHSLLEPTAEGGALRQQEA
GLSSQVLALQAGRNRLSKVREEIANGTLTARGFQEAIGGMGNGLTAGGGVQGLTISDVDQSLLQQLLKVETELAEARSTY
KPNSSMVTGLEERINQLKPLLLRNQLEAVDAALNLNNGRLQTAQQQVAQLNAQFLKQPALIKQYEALQTRLTIANQNLAG
LVSARENFQLEIAQRSVPWRVIDPPEINPNPIKPSIPRNLALGTLLGLVAGAGAGLLRDRKDHVFHSPGEVKAEIGDLPL
LGHIPYVDFFKGVREDKRFPLKELDSETQADVGETERKAARYQRFFYQEAFRNLFTSLRFLNSDRPLRSIALTSSLPAEG
KSLVNTLLAKTLAEMGQRVLLIDADLRKPQLHTRLGLNNLRGLSNVLTDDSSHWRQALQPINGYEGWSVMTAGRRPPDPT
RLLSSKRMHQLVEDLGKSEEFDLILFDTPPVLGLADAALVAEHCDGLMLLVSLDRVDRSLPKEAINRIRSSGAPLLGIVT
NAIKQEQQGSSAYGYGQYGYGKYGYGYGYGYGYGGYGYAAYDTTSAYAHYADVDDAEDSTDSAGPQSSQRDQDKKNKSLT
LSERLKARRAQFMRWVDN
>gnl|bykdb|G6FP91 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Fischerella thermalis] (length=728 residues).
MENNSYTQATEIQQYLLILKRRWRLITTIILASIGLSGSALFMQKPEYQADGILLFKSDRTSSLTKVGEKIGDLEALMRE
GNPLETQAVIVNSHPMLQEVITALQLKDDQGKLIDPELLKVNVKPIVGTDVLRVSYASNDRELAAAVVNQLMKSYVENNI
QTNRAQVSAAGEFIKEQLPASRQELERAAEALRQFKIQNKVIQLAEESTAAIDIISKLDQEINQVKAALADVSAQEQQIA
SQLNVSENQAVTVTSLSQIPGVQEVLTELQKVQTKLANARAIYTEVHPTITDLKNQQATLNSLLQQRTQEYSGIPIVSPG
KLQIGKIREELTDKYVEFKAERQGLEKKIRTLSNIRANYQQQLAMMPSLEKKQQALERRLEAAKTGYENLVTRLQEIQVA
EKQTIGNARIVQPAQIPKKPVISKTKILLAGGSIFAGVLLSIAAAFFVDLIDRSLKTVKETETFFGYTLLGLIPKYKLNN
SVSGVQEIETGVYPQVITTTSPRTVVHEAYQMLQANLKFISHRKVRKIVVTSSVTAEGKSEVSANLAAVIAQSGKRVLLV
DADMRKPTQHHLWGLINSVGLSHLLVDQGVFPQAVQKVTEFLAVLTAGVIPPNPLALIDSEGMTSLVDIFAENYDYVIFD
TPPLAGIADAAVLGKMADGILLVTRPGVLDAPSAAAAKSLLERSEANVLGIVANAVNAKQEPSSYFYYSNLRDRNSTADL
ERVPQQLK
>gnl|bykdb|G6FQZ6 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Fischerella thermalis] (length=732 residues).
MKESEFHVEEIDFQKYLLVLQRRWMTAVGVFGVVFTLALLYALSIKPTYTAQASLLIKTSRTSSLTGLGEDLGRLESLVQ
NNSPVDTQAKIVTSVPVLQATITSLSLKNDEGEPLKVEDLQKKLKVEGVKGTDVLEVSYTHQDPQLAAKVINKIVEEYTK
QNIQANREEAISAGKFMLQQLPKTEEAVQKAELALRRFKERNKIIVLQEEATAAVNTISRLEDEIAQAQAQLVDVNARLE
KLQTQARVNSQEAVSAVDLSQVPGTQKVLTELQEAQSELTVARTRYQPGHPTVANLEEKVSALRSLLQQRIQQVGGNNQQ
ISTANLQMGEVRQKLIEDLANTDKERVGLERRIAELTNTWSVYKQRANILPKLEQTQRELERKLKAAQTTYETLLTRIQE
INVAENQNVSNARIISPALVPDEPSGTRKALIAAGGGVLGIMLGIIAALAVDLIDRSIKTVKEARELFQYTLLGVIPNVS
RNNKNSYSVQGLDRPIPRVVGRDIPHFPVGDAYQMLQANLKFLSYKQLKAITVTSSIPKEGKSEVSANLAVAMAQVERRV
LLVDADMRHPIQHHIWQLSNNQGLSNIIVDQVPLETIVHEVMPNLHVLTSGVIPPNPVALLDSDRMATLVASFTQKYDCV
IFDAPPLAGTADAAVLGKLADGMLLVVRPEVVDYASANAAKEFLTQSGQTVLGMVMNGVSVKREPDSYFYYAKDSVESTG
VSRKSILVRNHR
>gnl|bykdb|G6FSN3 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Fischerella thermalis] (length=714 residues).
MEKGLSSLPSILKRRALPALVTFAAVISGAIAYLQITPRQYQTSTRLMLDQKRVSVSELGRDLTQLNSGTPGGSNPLADQ
AELIKSQRVLQRALTEVTAESGFRSPENELTVDQLSQGLKIKIVPATNILEVSYLNEDPILATKVVNAVSRAMVEDNTQV
IRQEAANVRKFLEKKVPEARKQLQEAEQKENRYRQSSGIVSFDEQTKSLVESLANLEQQENTLSAQLQELRSKEASLQQV
TDAKALNQAYAAVRGGQDEELKALRNKLAEIETQLVQARLSLTDNHPTVINLLGQRNGLGALYQQGLARVSPRNQSISSG
SVAGDQISQDLTSQLIINDVERLALENKLKVVQTNRANLQTRLAQLPIQQQQLTPLTRQREESAESLKLLQSKLEEARIA
EAQLVGNIQIIEAAQPPTQPSLPNKRTVLAIAIVFGTALATGIVLLLELMDHTLKDASEAEELLKLPLLGVLPRLPGHAI
ALEPSAQFLDHVGLVEPYRTLFKNLEFRSSEPLRSIVVSSTITGEGKSVVASHLAAISAMLSRRTLLIDADLRRPILHTL
FNLAPRPGITDVIDSERSLEETVQRTNIPNLSVLTCGELHGRPSHLLESEAMKSLLIEAVRQYDFVVIDTPPLSACADAH
TLGRQSDGILLVTRPGFTIKEVLQRAVSELTHNQIPIMGVVVNGITDQTERYYRYAVNGYEPLSSRRLSGGGSA
>gnl|bykdb|H1W7M8 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Arthrospira sp. PCC 8005] (length=741 residues).
MVMDFSNIEHRESIDLDLGRYLQTLKRRWFWLLGVFVLSVSGAVYATQFLTPTYENSGKILFKVDRTSSLAGIGEGLGEL
KALLADQTPLSTQIELMYSNPLLETVIERLNLTNEDGEPVAPEDIRRNLDMRIIGGTDIVLLTYQSRNPQEVADVINTVM
EVYIEANVSSIRQDASGAKEFIQEQLPRVQKELFLAEKSIQDFKERNEIVDLGTEFAISVQEMAQLNRNITTLEAELNAV
QSLVNSLGNQVGLNLEEAIAVNTLSQSPVVRAALQELENVEGELAQEQRRFRDENPRIISLKGKRDNLENLLQREIQVYL
GSSRPFSRGLLRVMDVKNNKIEEFVNAEIRRLDLTKQLDSLYEARDGLERRARILPQLEQQQQELERKAEVARLTYRTLL
QNLEEAQVAANKITNNARIIETANVPDEGKTAKVPLLALGVMGGLVASTTLLLLMEMGDKSLRTVAETRDLFGYTLLGII
PSFAAPPFYRYLTGGDRSSVQVPVVDTPGSLISEIYRMIQANLKFLGSDRKVRVIVVSSSVPQEGKSTVSANLAAAIAQL
GHRVILIDGDMRQPIQHHIWGLTNAVGLSDVLVEEATLSEAVKPGIDQLDILTAGVTPPNPLALLDSRRMTSLIRNFSEE
YDFVIIDTPPLLLAADALTLANMASGVLMVARPRILDRDSAKAAKEILGRSGQRILGTVINGISKNESTKYFYHAQRYFP
LQKSHRRDRSAPPKISSRSSS
>gnl|bykdb|K1XF69 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Arthrospira platensis C1] (length=741 residues).
MVMDFSNIEHRESIDLDLGRYLQTLKRRWFWLLGVFVLSVSGAVYATQFLTPTYENSGKILFKVDRTSSLAGIGEGLGEL
KALLADQTPLSTQIELMYSNPLLETVIERLNLTNEDGEPVAPEDIRRNLDMRIIGGTDIVLLTYQSRNPQEVADVINTVM
EVYIEANVSSIRQDASGAKEFIQEQLPRVQQELFLAEKSIQDFKERNEIVDLGTEFAISVQEMAQLNRNITTLEAELNAV
QSLVNSLGNQVGLNLEEAIAVNTLSQSPVVRAALQELENVEGELAQEQRRFRDENPRIISLKGKRDNLENLLQREIQVYL
GSSRPFSRGLLRVMDVKNNKIEEFVNAEIRRLDLTKQLDSLYEARDGLERRARILPQLEQQQQELERKAEVARLTYRTLL
QNLEEAQVAANKITNNARIIETANVPDEGKTAKVPLLALGVMGGLVASTTLLLLMEMGDKSLRTVAETRDLFGYTLLGII
PSFAAPPFYRYLTGGDRSSVQVPVVDTPGSLISEIYRMIQANLKFLGSDRKVRVIVVSSSVPQEGKSTVSANLAAAIAQL
GHRVILIDGDMRQPIQHHIWGLTNAVGLSDVLVEEATLSEAVKPGIDQLDILTAGVTPPNPLALLDSRRMTSLIRNFSEE
YDFVIIDTPPLLLAADALTLANMASGVLMVARPRILDRDSAKAAKEILGRSGQRILGTVINGISKNESTKYFYHAQRYFP
LQKSHRRDRSAPPKISSRSSS
>gnl|bykdb|K7W0A4 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Anabaena sp. 90] (length=729 residues).
MSINQEDQDSSFDIQQYWLTFKRHWLVTSIVFASVLGVTALLTYSAKPIYESEGKLVFTKKSGASSLAGLSQSLGELGGL
TNLSNPVDTESEIIRSYPIVIKTITTLNLTNDQGKQISLENFLKKLKLKTIRGTDVIQLSYRSTNPQEAADVVNSLMKYY
LESNIRTNRTEARSAREFLDKQLPEVEKRVTKAEMTLRRFKENNRVVALDVEAKTGLESLGKLDEAITRSQGELAAAYTR
SVALQYEMKSTTQEAVDLSALSQSRGVQQVLTEYQKTQYDLATARTLYTSDNPKVVNLVLKEASLKKLLEERVTQTIGSS
KSLPQQNLQVGELKQALTQDLVKSEVERLALTNQIGELRKVFIINRRRLDSLPRLEQQQLQLQRQLSVAQITYQEFLKQS
QLVQVLENQNVGNSRIISEALVPERPVSPKIPLNLALGGFLGILLGAGTALLLESMNQSLKNVEEANRLLGFPLLGAIPQ
YGEKNPKHRQEGRQELPLLDNPYSPVSTSFEMLQTNLGFTLSDKELRVILLTSSTPGEGKSFVAANLALAAAHVGRRVLL
VDADMRRPRQHRVWEIPNLLGLSNILAGQMQLKNAVQEVSPQVNMLPAGKIPPNPVALLDSQRMADLIAEARNDYDFVII
DTPPLTAVTDPLIVGKYVDGLLLVVRPGKVEYSAVKSSKLLLNHGKVPILGMVVNGISEESSYGGYYYQRGYYGQKVDSK
GKFSQANLR
>gnl|bykdb|K9F4D9 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Leptolyngbya sp. PCC 7375] (length=741 residues).
MASQDNSVKEIEIDLQKYWRVLKRRWLIALTVFGLTTTAAVGVGITQKPEYQAESKLLFELSNQASALVGLEGGNRELRA
LTNLDNPLDTQIEVFRSIPLVQKVIETLKLQDDEGELLQPEDLLKGLTVTGVPGTDVLKVTYTSEEPEIAATVVNTLADI
YIENDIQTNRAAALAAQEFITAQLPESEEAVEEAEASLRRFKEGNNIVDLEEESRNLVESLFTLDNALIQLKSQLADSSA
QASQLQQKLKLSSDEAYAVGLVSESPGIQTVLEQLQTVQSDLTLARTRYRDEHPEIITLRNQEAGLQALLQERLDVTLGA
NELNLPSDDLQSGQLEQDLIAEYLRLDGATSGLQQQVEELTTARLGQQSRARVIPVLEKQERALDRQLAAAQTTYETLLQ
NLQQAQVLENQNIGNARIVSPALIPNEPLGPSLKLFLMTGGFAGLLLGLITAFMADLLDQSVKTVQEGQELYEYPLLGII
PAWKRGNAKGSDVPSILVKNSEYSSILDAYQALQANLKFSCVDTHVKTVTVTSAVGGEGKSEVAANLALTLAHLGHTVLL
VDADLRKPTQHHIWDLPNVQGLSNFASGQVPLKDVIVSQEPNLHILTAGVIPFNPLAVLESQLITSLLQASEKAYDYIII
DSPPILGLVDAITIGRATDGVLLVMRPGMANAENIRATKTMLAQSKQNVLGLVANGINVKGNTDRYFYNNQDYTPIERQA
NFANVPNSQSVSDPANVNGRL
>gnl|bykdb|K9PGI8 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Calothrix sp. PCC 7507] (length=743 residues).
MESIPKFEEIDFQKYLLILQRRWIPAAGVFGVVVTLAFLYAVSLKPAYKAEGSLLIKTNRSASLTGLGEGIGQVDSLVNT
NSPSDTQAKIVVSVPVIQETIRVLKLKNERGKFIQTQDLSHKLKVESSKGTDILQISYTDKDPTLAAKVVNKVMDAYIRN
NIEANRAEAVSARKFISQQLPATEISVRGAELALRKFKEENKIIALQEEASTAVQVISRLEEQINQTQAKLVEVGARTKK
LQKQANVNSQQAVTLASLSQIPGVQQVLTQRQEAQSQLAIELIRLRPNHPTIINLKEKIAVLNLLLKGRIEEGVGSTKTV
IKGNLQIGELRQGLIADFARSEVERAGLEGEITTLSNKLSVYKKRANGLPKFEQTQRQLERKLKAAQTTYEALLTKLQEV
QVAENQNIGNARIISPALIPDAPAASQKNLIVLGGGIFGAMLGLIAALTLDMIDRSVKTVKEARELLQYTLLGVIPLVGR
NTKNSSLLPGGEQPFAIPRLIGRDIPHYPIGNAYQMLQANLKFLGSDEELKAIAVTSSVAKEGKSEVAANLAVAIAQLGR
RVLLVDADMRHPVQHHIWGMTNAVGLSNVIVDQVPLNKAVQEFIPNLYVLTSGVIPPNSIALLGSKRMDSLVKIFAKEYD
FVIFDTPPLTGIPDAAVLGKMTDGILLVVRPGIVDSASASAAKEFLDQSGQQVLGMVINGVNVKLEPDSYFYYSKESIEQ
DAPSPKSVLIKEAAAKVMDDRYF
>gnl|bykdb|K9PIA4 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Calothrix sp. PCC 7507] (length=731 residues).
MPTKQEDRDTIDLQHYWTVLKRRWLVTSIVISTVFGLTALVTFLKTPVYESKAKLLFNKQNGVSSLTGFSSKMGELGGLT
NLSNPVDTEAEVIRSYPIINKTITTLNLKDETGEYLPIETFLKILQLKTIRGTDVMQLSYRSPNPKEAADVINTLMKYYL
ESNVRTNRSTAKSAREFLNKELPQVEKRVMKAEMSLREFKEKNKVIALEIEAKAGVEGLKDLAAIITKVEAELVGANTRS
LALQNQIELNTNQAVALNTLNESPGIQQVLTEYQKVQDELAVARTRYTNNNPNILNLVEKEAALRNQVEGRVAQSLGNSK
YVPEQKLQMGKLKQTLTTDLVKSEVERLALARQLADLQQTFILSQKRLNSLPRLEQQQLQLQRQLQVARVTYEQFLRQLQ
EIQVLENQNIGNARVISQALVPNRPVSPVIHLNLALGGFLGILLGLGTALVLESMDNSLKNVEEVKRLLGYPVLGTIPLA
EKVKGSDGEGGAELPVLNNPYSPESAAFEMLQTNLGFSISDKKLKVIVVSSSIPGEGKSFVTANLAVAIAQLGRRVLLID
ADMRRPRQHKIWEQSNLIGLSNILVGQAELQSSTKEALMAMDLLTAGTIPPNPAALLDSQRLATLIKQATGEYDFVIIDA
PPLTAVADAQILGKLVDGLLLVVRPGVVDSAAASETKTLLEQSEQRVLGMVVNGVTATSSYGGYYTKGYYGGKAFEQNGK
GEMNLPKIGIS
>gnl|bykdb|K9QF04 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nostoc sp. PCC 7107] (length=739 residues).
MTQNVENLTLFKPQALPKPQSDPWELHQLGAIARRRLVVFIAVSGVIIAGVICKQWLQKPIYKQQFQLMLDSATSDSDSN
PLADSPRRSAVVPLQFRDFKTEIEVLASYKVISPLLPTIQSRYPDIDYRQLVKQLKIKHKENTAIVEVSYQDTDPEKIEF
VLDKLAEGYTAYYLEKLQTSSKQALKLVEALSPQQRQRVDQLQVQLQRFRRQNNLVDPEKQSQVLTERLSNIIQQRQETQ
ALLGETQSTIKDLQQQLGIDFKQAVALSVLGEDPNYLALLEKLQRVDAKIASESVKLSDEHPSLIALREERQHLLSLIQQ
QVINLLGIQLFKEIQQLPGVASPSKIRTEIIEKLIAASNQFQALLARQKALAIAENQARRNLQQFAGIARQYADLSRDLE
IANQSLNRFLVAKENLQIETARKVPPWQVISRIEAPNKPISPNPVRDLLLGGFAGLLAGIGTAIAVEKFDNKYHSPEEIQ
DNTGLTLLGTIPFQKELKAATNQLTHYGNYTLSHYWEAYISLQTNLDFLDPDKPLKSLVISSALPGEGKSTIAVYLAQVA
ASMGKRVLLIDADLRRPTIHTRVHSLTNVWGLSNLISGSFPIENIIQISPENENLHILTAGKTPPNPAQLLSSSKMRDLL
VQFQKSYDLVIVDTPPLHGFADAKFLASQTNGLIMVIGLDKTEKTAAKQVLNDLQISHIPLLGMVANGIKGYQQNYTEYY
NHYYSQGTKDKFLPLKASR
>gnl|bykdb|K9QM62 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nostoc sp.] (length=749 residues).
MKAKTLEVDSTIKSREAIDLDFHRYLLMLKRRWILTVGIFFATAGFGVFATTLMKPSYEAAGKLLFRIPAFNIVGSNLLP
NSSEGEFRGLRALVSTQNPISTEVEVITSYPLLQRTIDALKLKNNQGKPLTVKALAKNLDLKIVGGTDVLQITYKSRNPE
EAAAVVNSVMNVYLENDILTNRTEVEATRRFMARQLPQTQAAVSTAEVALRKFKQQNNIVDLTEEARSAVTIIGGLDTEI
NTVKASLNEITAQSNELRKKVGLDSPQAIAMSTLSQSPAVQGALTQYQDIERQLATERSRFSEAHPTIVNLEARKSNLKT
LLQQQINQTLGKRTTVSPKLLQIGELQQGLITDFLRSEVQRLGLAQRLTSLSNSRATYEQRMQKMPQLEQTLRELQRTLE
VAQSTYQNLLRKTQELQVAEHKNTANARIISQALVPEEPVLKKKIIVVVLSVMFGAFLSTTTVLLLEMRDRSLKTLQEIR
QVFEYTLLGIIPTSPVSHKTMSFYLQDTESITPSIAVRDRPYSLTSEMYRMLQANLKFLSSDKELKTIVVTSSVPKEGKS
SVSANLALAISQMGRKVLLIDADMRVPSQHKIWELSHTSGLSDVLVGQSQFNETVSQVTHYLDVLTAGVRPPNPLALLDS
KRMALLIQDFSDQYDVVIIDSPPLLLAADALTLSQMSDGILLVARPGVIDNSSADTVQEMLERCGHNVLGLVVNGLIEQN
EFGSYFYHAQEYFSSENLPKEASADLQIR
>gnl|bykdb|K9REP9 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Rivularia sp. PCC 7116] (length=733 residues).
MKNKNNAQEIDIQQYWLIVKRRWLFLVAAMLGSIGLSWLLILRQKPEYQATGLLLFKSDRISSLTKAGEKIGDLESLMRE
GNPLETQAVIVQSEPILQKVIDTLNLKDDDGKPLEPEALDLEIEPLVGTDVINVSYTSDKPRLAASIVNQVMESYVDNNI
ESNRAQVVAAGEFLKKQVPLSKIELEQATQALLQFKNKNQVIQLPEEATAAIQNISTLDGEINQARASLAELTAQESQLA
SKLDFSANQAVEITSLNQISGVQEVLGELQKVQTQLASERANYTSAHPLIRKLENQATLLQSLLQQRKQEASGRQQNIPN
NRLQIGEIKQSLVNQLVQVQTQKDGLQTKLQTLTNIRDNYQQKLAILPNLEKQQTELERRLSVAQTDYENLITRLQEIEL
AEKQTIGNSSIIQKARVPKKPSLSKMTLLLAGGGVFVGLLFGIAAAFTVDLIDRSLKTVKEIEGFFNYTLVGLIPKFEPD
SKSTDSNPIVDTISPRIIVASSPRTMIHEAYQMLQANLKFISHKEVRTIAVTSSVVGEGKSEVTANLGAILAQGGQRVLI
VDADMRQPMQHHLWGLINSGGLSNVIVGQDELYRCHHQVTENLSVLTAGVQPPNPSALIDSAGMDSLIQQLLPSYDYIIF
DTPPLAGTPDAAVLGKMVDGVLLVARPRVVDSASATAAKSLLERSEAKVLGIVANAVNVKQEPESYFYYSEPRGSKSTNE
TQTEVESKEWVKK
>gnl|bykdb|K9RI76 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Rivularia sp. PCC 7116] (length=672 residues).
MSRIATIAIRHWKLLLAWNILLIGITAINIKLTPRVWEGKAQLILPNVTNQSDADLGKLGNVRDEGIVFSQQLNPLNILS
SIATSDHVVEEVWQNDPEKSEYSRLSQFKKLFEVTPEKESTVISLEVQGSSPELAKNRAAALIAAFSNRLQELRLDEAKQ
RSQFMQGEVKLANTKLLKAQKALSEFKQKTNLVSSEEQTQQIVSAINTLNTQQAQAIAEAESAAARVRMLSNRIALSPAA
AVNSVRLKEYKEFQLIRDKLSQIEVALIEAQGKLTSNHPEVQNLLYQRSVLRQQLNQFIAASRANAGGVNPAIGENTASL
AEQVILAESQVIGMQKKAEKLQPQIDKLSASLNSLPQKQAKLLELQRQYDIAEGVYNGVVAQIEQAKLGAFSAYPSVQVL
DKPMVDNKPSGPKLKLMLLGALLASGFGSAAIILFMENRNPLLSPKDIQQANIPVLASIPYVRHINAKADRKLGGEIEFQ
RLASAVSLMQLNSGRLMIASANTEEGKTTTTIGLANALLVLGFKVLLVDGDFRRGELSESLGYQPQAKSRFVHNQVRFNL
DLLSVNIAEDKISEFVARGEFEQYLNLIQAQGNYDYVLVDSSPVALTPEAALLARIISKVVFVVRSTSSHRNYFYDSVEQ
LTRHQAEICGLVVNGVENRAQGYIYGQNTAKV
>gnl|bykdb|K9RKN2 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Rivularia sp. PCC 7116] (length=717 residues).
MEKGISSLLTIVMRRSLPALATFVAVMGGAFAYLSITPRVYETSARLMLDEKQISVSELGRDLTQVANSTPGGPSPLADQ
AELVKSQRVLEKAIKIFSSQYKIKNDQNFGKDGLTSEYLRKNLSVKIVPATNILQISYENQDPLLAARLLNAVSSAMVEY
DIKAISSEATKVKDFLENKQLPIARKKLREAEATESQYRQASGIVSFAEQTESLVENLSSLEEQERTLSALLEQVRSQEN
SLRQITNADSLNSAYSSVRSGSDEELVKMRANLAELEREFVEARLRFTFNHPKLIELSQKRNAFRQMYEQQLANVSNTNN
SVRDNQIASDEISQELTSKLITNEIERLAVERKLAVVRAQTADLKARVAQLPIKQQPLTALVRQREESASTLKFLQGKLE
EARLAQAQKVSNIRIIESATVPESPSSPKKPVVLALATIFGGILATGVILLLELMDNTLRDARDAEQLLNLPLLGVLPRL
PGKTLVLEPSDRFLDQVGLVEPYRMLFKTLEFRSDDELQKIVVSSTISGEGKSVVVSHLAAVSAMLSRKTLVIDADLRRP
VQHTLFNLPPKPGITEIIEGRRNFANAIQKTDVDNLDVLTCGELHGRPSQLLESVEMKLILEEAAKEYDLVIIDTPPVSA
CADAATLGKQGDGVVLVTRPSFTNKEMLQKAVSELTSNHIPILGVVVNGMSNLTEKYYRYPVKSYQPTKHLTAGRRR
>gnl|bykdb|K9S8M8 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Geitlerinema sp. PCC 7407] (length=733 residues).
MEFQHYPEEIDFQKYWLILKRHWLPATGAFLLAVCGAAAMAFTAEPIYEAQGKLLLKKKNTTSALVTDASAKVGELDTLS
DKDTPLDTEAEVIRSTPIAEEVITSMGLRSSSGKPMKPESFLRGLEVKTIRGTDVLLITYTSDDPQEAANVVNVLMEIYI
KENIRANRAEATAARKFITELLPKTEASLRQAEAQLRDFKERNGVISLNEEARTAVESIATLSTMIAQSEAMLQDATARS
GQLQRSLGMDARQAIAMNAVGESPAVQQALSELQQIEDELAVARTRYQEQHPTIAGLRRKQAALQSLVQERVGQVLNGTP
ASDINPSYQSGELHRTLTNNLVETENQRRGLREQVTALRESQVQYQQRANVLPQLEQRQRDLERQLATYQSTYDILSRNL
QQVQIIENQNVGNARIVSSASFPSKPVGPNKKVVLMGGMVVGGMLYLIVAFVFELIDPTVKTAKEIRNLYQYTLLGMIPR
SKKKRWWFGSGSNTSVPKVVVQEAPHSIISENYRMLQANLRFLSPDRELKVIVVTSPVPQEGKSTVSANLAAAMAQLGRR
VLLVDADMRHPMQHHVWHLTNLAGLSNVIMKQTDLSEAVNPVMDNLDVLTCGAIPPNPLALLDSQRMQSLVQEFGQQYDF
VIIDTPPMVLMADALSLAKMTDGILLVSRPGVIDTVTARAAKELLNQSGQPVLGLVINGVMLDNEPDNYLHHAQFYSGYD
ESAATPTSTMVPR
>gnl|bykdb|K9SA61 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Geitlerinema sp. PCC 7407] (length=751 residues).
MALVPHTPGNFAPHRSPVTDPRWTDSGDSDGGYGQIFAVLARRRLWLLGVFGSVVAAAAGLTFLTTPVYQSSLQLLVESN
YQGRDQNGDRASEGQFTDSNVKLDYSTQLQLMKSSQLLQRAVDQLKPTYPDITVGHLKEALIVTQVEDDKTKTKIFEAIY
TGDDPEKTQAVLQAVQKVYQDYNREQQELRLSRGLAFINDQLPKVQAEVREAEAALEAFRKNQNLIDPEAQSQTILEALS
RTRQEQQTNQAELQATQAQFASLQRQLGRSPQAALLASRLSESTRYQALLNEIQKTEIELAQQRLRFKDASPYVQQVIDK
RQRQLALLQQEAQRVLSSTSTGTSSQGDRLLTEGQMGELDLNLAGQLVETQTRLQALQARGRSLSQTEQQLTGELQRFPQ
LLAEYGRLEPQLQLRRETLQELLKARQELGLEIARGGFDWQVVEEPRTGNQIAPNLQRNLLLGAVAGLMLGAVAAFVREG
VDDAVHTSDDLQKQVPLPLLGMIPELPRSVSVAEPTIKLPLRRSETFTTASLEVIHWPPFRESMDLIYQNIQLLNAASPL
KSIVVTSALAGEGKSTLAMGLAMSAARLHQRVLLIDADLRRPSLHKQLNLPNDRGLSSLLSGDALFQHGDIQPSGHDSDI
SVLTAGPTPTDPAKLLSSRRMAELMAMFEQTYDLVVLDAPPVLGMVDAMLAGSFCQGVMLVGRIGQVTRTELGQAAHTLH
QLNVIGMIANGATSTAYTPYVGYSAPERLPM
>gnl|bykdb|K9SGJ5 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Pseudanabaena sp. PCC 7367] (length=752 residues).
MPEYSLNPGQPEESIDLSRFLRTLRKRWLVVASISATLFATVAAYTYIKEPVYQSETSLLIDDATISVSNLPVNDGLDKY
SKEPSLDTEIAILKSRSLIEPAVAQLDNIDPTMTQDQMVSYVLENLYIRQEKGASVLWLIYRDPDPQRAKDVLDSLASAY
SQYSLKDRRSRSSTAIQFIEDKLPQVKKDLDESALTVTKFREKYKIVDPDTYAASVYTMKQDLDTQAQQLQIQMAQTQRQ
FKELQRQVGGSTDLVLGKAILAEDITYQNLVKQFQEAETHYYLERTRFQDDHPEVQVAKDRRDQLYKLMQVQAETVLGGR
AAQVGISTAVPASADGSIQQNLAGALFETQTTMAVQAAQMGSVKLAQERVSAIFAQIPQLQQRYTELQRQLELDSAVFTS
LSEKLEELRIAEAQEISSWRVLDAALLPLQPIEPNVLRNLVFGGFAGILFGVAIAMYLERSDERIREVEEVRELTHVPLL
GSIPRTDMLELSPVVEKETALAPSMMHSAFREALRSLALNLRYLGGDLSIKSIAFTSAVPSEGKSTLVFNLASILAELGH
KVLVVDADMRKPNVHHLAKLRNNYGLSTVIATNRSWRQVVQSANVKGCLNVITSGPLPPNPMVLLESTKMTKLLQLWRQT
YDYVLIDTPPIVGITDAQCLAGKVDSVVLVAAIERSTRSAIARAVEILGHSRANMAGILINMIERNDSSYYYNYYSSYYK
SNNKPLLPVYADDPKSESSDDPLAEDQMTVKH
>gnl|bykdb|K9SLA9 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Pseudanabaena sp. PCC 7367] (length=1088 residues).
MNKLNRGWVALRQHKFPALVAFGIIFGGAALVTVRIQPIYEAKGQVLIESTIESTTGSVAAPTTTASIPNPNQDNIASSE
GLPPLPTDTAISTIPPGDRLANEAAVIKSNAIAKEVVGVLNQTATENELEAEQSIESFLANLQVTNLPDSEILEISYHDP
DPKRAASIVNTVSKIYIASDLETKSLEAKSLLQFVERQLPTSKSALESAEIKLRQFKENYRLVDLEIEKVTTVKAIKEIE
AQMLGLQAELAEVGARSKQLQQSLGMDAGLSVAWSSPSAQQLLEELQAIEQQIALESTRYGAEHPSIIDLRAQREALQVV
LQGRVGEDLLENLTTQNLRISDTQAQLISNLANLETSKYGLRSRLEALSKLHQDYQKRIDSLPKIEQQQSQLERDLTLAR
VNYDHLLQQQTSLRSQLRQISAGARIVSPATIPTNAIAPNIPLNLSLGAILGLAFAGLVTFILAAIDKSIKTSEQASDIS
GYSLLGIVPDFGYVAKHDQMMRKSAKLAKGSVLITRDMPQSTLAETFRILHTNLKFLEPGKAPKVIAITSSIAKEGKSTF
TANLAIAAAQMGAKVLLIDADLRKPTQHQLWQVPNSQGLSNVLAGSANFYTTTQQVEPRLELLTAGTLPTNPAALLDSRP
MNSLLSVAARNYDLVLLDTPPVTVAADTTVLGKKTDGVVLLVRPGLTEIDSFAAAKDTLTRSRQHVLGLVANGVMPRQPG
ENYSLNQEYYQAVDAAQTKEALGDRRHNPNGIAVIKPANLTTGKITNSDNNPNSSNSSNRLNNRTPIARIKQNPNQPNNF
KPLINDQATGNDLETGNYLTYLNDQNLDDQNLDDQNLDDQNLDDRNPEADQDLHNEHDFTESNLKSDPPKQVDCDGELEI
DQVADLNLDISDEFDAELDALESFLEQRSPHLSPEPDQQEQPNHSLKLATSAQSLEDLENDPAIDNVPIQQTIVVESSVV
SPILPREIKPVKPISNPYGLDNFTDLEDLEIDQAVEITYVPELSNDLDELELETQPQESLEPHRDRRSDQSESRRQALDN
ESELGQNLQIQNQNSQKNTEADRGDSASKSISKSISNKWFLDRTRKLN
>gnl|bykdb|K9SSQ0 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Synechococcus sp. PCC 7502] (length=718 residues).
MKVYSSKVFSPLLSTFLVRRLVRKHLVTVISTTALTLGGAAIYTFNQPFLYESKGSLLIENAPTDGNSLSTQAAILASRP
LIETALPKIPANLSTNLSKQDLITQISDHLTITPDAKVLNISYSDRNPKTAATILQGLLETYKAYGANKANQATQLIQAQ
IPDAKKQLDQNSTALTRFRQQYNITDPDTYAASIFSTKQGLATQIQDLQIKMAQTQRQLQELQRQVGRPADVAISSAILS
QDANYQALVKQFQEAQTNYFLERARFQDAYPKVQALRDRRDQIYNLMQAQAQAILGTKPADVTPEGQSSIKQNLATQLFD
TQTRLATQTAELGSLKIAQTQVEQVFAQIPQLQQTYIELQRQLKQASTRLSTLSQKLEEAKSQEVQEATAWQILQSPSLP
SYPSSPNVILNLLLAGLAGILVAAIIITVLENSDDRLQQVSQLQTLSDLPLLGAVPYLATNAKLLSPSLELISERAFLPH
SYNHSAFTEAVNSLALNIQNLAAQRTFKTIAFTSSIPSEGKSTIIYNLSLTLAELGYKVLLVDADMRKPTIHSLAGVSNK
LGLSQAIATKLPWQQIIHTGDHSQFSAGYLHIITAGATPPNPMILLESNKFQKLLGEWDQTYDYVLIDTPPIVGITDAQS
LAPRMDGVVLVTAIEKATKQAIFRAIEILKINNCKVAGILVNLVDRYDSIYCYDYSTSEYYSNQTPQRLLSAASDSDE
>gnl|bykdb|K9SX01 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Synechococcus sp. PCC 7502] (length=762 residues).
MNQSPAEDKNPLFELLSIVRRYWFLEISIFSLVFGVSAFLTFQEKPIYQATGSLLFKSQRQSNTLTGVNSVAQISDTVAG
DPRYTQLQVIRSTPVVAQTIKALALPLDNDVFLKPLSLDVIKYTDVIQVSYLSSSPQDAAKIVNGLMKSYIDNDLLTNRE
DTASARKFIDEQLPKLQISLRQAEAALRRFKEVNKAYLPEAEAQSAVAAVTSLDTQITASKSDLAKVNSEINDIRTRLGF
TSEQAIILTKLSASKPVQETLSDLQKIDSQLVTLRATYTDNYPTITVLMEQRAPIQKLLQQRIKETLGTNELISDQDLQI
GGAQLELITQLVTKEIERVGLEKQIATINDSFIEYQKRLVNIPKLEQQLLVLQRAVEISRTAYEGLLVKQQDIQLTEEQN
IGNARILSPAVPSGVPISPKISNNLTTGAVLGIVAAISVALLLNSRDNLLRSGEDIKRLFGYPLLGILPNFATRKLENLP
AFVLRNPESVLSKLYLKIRKSKAYRSFASSLESFKISILNAVSEPENTTALTVFVRDNPRAPASEAYRMLQTSLRFLNSD
RQIKAIVITSSVPGEGKSTVSANLAVAIAQLGKRVLLVDVDMRRPSQHKIWGLGNASGLSNILVGETQLETVLESVVPNL
DILSSGVLPPDPLTLIDSQHMTNLIGDWSRAYDYVILDTPPVLAVADAIVLGRIADGVLIVARPEVLDSGAAIRTRAILD
QSELNILGLVINDVNSQDSAYYYQYHYYNTDKLLSASSEISV
>gnl|bykdb|K9TLQ0 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Oscillatoria acuminata PCC 6304] (length=755 residues).
MDIDGNSPPFFQQLNGPFPSGQTPLPSTILPPLNDDADALNLRHLLSVARRRIFVFAGVSIAVACGVLVKVLTQTPIYEG
NFRLLVEPIKGQDNLEQLNQALTRNSGKGEILDYETQMEVLLSSPIINPIFTNIQQNYPELKFEELIKNLSVRRLKSTKI
LDIRYQDTDPQKIQIILKELATGYIHYSEMEQQTTLRQGLEFVETQLPRLQQRVDTLQEYLEKFRQHYNLIDPGQSGQIL
SQQIGSLVNERQETESQLVQAQALYGKLRGQLGLELEQAMLATSLSDSPRYQDLLNRFHEIETKLAQESTRFTVQSPAMQ
VLIDERNSLLPLLQEEALLVLGPNVSQFRGDIRGLSTPNSLRSDLTGKLIETVNLMEMTRARQWAIAQAETIVQQQMQEQ
ATLMRQYTDLQRELELGTESLNRFLAVRENLQIESAQKAMPWQLISQPEVGTVPISPNLSRSLLLGGIAGLMAGIGAALL
AEKLDTKFHSVEDIKDYMGFPILGTIPFEKDLKESLTVSDGENLVQASGGYLFSRFFEAFRSLHADLYFMSPDRPLKSIV
ISSTLPAEGKTTISMKLAEAASAMGNRVLLVDADLRRPQIDQRMDLPNVWGLSNLISTDSLNAQDSIQQSALNQNLYVLT
AGQMPPDPARLLSSQRMKQLIEEFKTSFDLVIFDTPPLGAISDAKFLAPHTDGLVMVIGMGKSDRAILREVFDGLKMSRT
PVLGLVANGVKQYLPTSYNYYERYYAPNETQTSSR
>gnl|bykdb|K9TYA7 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Chroococcidiopsis thermalis] (length=747 residues).
MVRVNESNMPMTVEESDGGYGQLLAVLMRRRYWLLGVMGAVLTIATVFTLISKPTYQSEMQLLIEPNYQGKKDGTTPRQG
EQYADSGVTIDDYATQINVMRSSLLIQRAVDILRSEYPTLTVAEVKKNLVLKQVVEEKANTKIVEATYTANDPIKAQKVL
KAVHTVYQIYNREQQEQRLKKGLKFINEQIPAVTKTVDQAENKLEEFRKNNNLIDPEQQAATVNNSLNAIAQEREVIRAQ
YNDLQARYGQLQQQLARSPQQALVASRLSQSSRYQTLLNELQRTELALSQRRVVFTDEDPNVKKLLEQRQNLLSMMKQEG
GRVLGEGQASQAAAAGNAADGILQQGQLGALDLNLAGQLIEVQTNMNAMRARDNSLAQTQQKLRSDLKRFPVLLAEYNRL
VPFVQINRDKLQQLLRAQQELSLEIARGGFDWQALEEPRLGLKVGPNLKLNLLLGLVAGLMLGSLAAFLRDAVDDSVHSS
EDLERQFELPLLGMTPELPRGRVAQPEVSLPFGKPLHLSPWTVQVRNWPPSWESLDLIYRNLQLMNEMAAFKSLVVTSAV
AGEGKSTLALGLALSAARLHQRVLLIDTDLRRPSLHQILNLPNDYGLSTLLSSDATLPIHNAIQSSGSYIDILTAGPQPE
DPANLLSSQRMRELMAGFEQNYDLILLDAPPLLGMVDAMIAASCCTGVVLVSRVGMVKKTELVQANAMLRKLNVIGVVAN
GVSNVSYGYGAYSREQGVELKKVWGNG
>gnl|bykdb|K9TYI2 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Chroococcidiopsis thermalis] (length=727 residues).
MESRESIDLNLSQYLLSLKRRWLPAVSIFATTVTLSVVAAAFMKPSYEGEGKLLFKTPSFNVVGSNLLPSISEGQETGDL
RALVSTQNPVSSQIEVISSPTLLQQAIDELQLKNNRGEPQEIEAFKKAVKLKIVGGTDVLQITYKHHDPEKAAAVVNKIM
ELYLENDILTSRSEAEATRLFMAKQLPKSQAAVHQAEVKLRIFKQKNNIVDLSEEAKTAVANIGSLDNQIDNLKAELDQA
NTQTNELRQKVGLNPQQASTVSALSQSPAVQGVLTQLQDTERQLASQRSRYLNDNPIIVDLEAKKYNLEALLQKQIKQTV
GSQTKVAAGLLQIGELRQDLIENLLQSDVQRRSLAQKLASLSNSRSTYEQRKNIIPQLVQNQQELERRLVVAQSTYQTLL
KKVQELQVAENKTTAHARIIAQALVPEKPVLEQKLIILALGIMIGALLSTSTVLFLELRDRSLKTLEEIRQRFRYTLLGV
IPLVANKVRSNDGYVESTIPEISVRDKPHSLTSEIYRMIQANLKFLSPDRALRTIVITSAVPKEGKSTVSANLAAAIAQL
GRKVLLVDADMRDSSQHHLWQLTNAAGLSEVLVGQAQLSVATSKVMNNLDVLTAGVTPPNPLALLDSQQMAALVEGFSSR
YDFVIIDAPPLLLTADALTLSQMTDGILLVARPGVINANSANAAQEMLERSGHNVLGLVVNGIVDKNEYSSYFSHANEGD
VNEIVVW
>gnl|bykdb|K9TZQ7 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Chroococcidiopsis thermalis] (length=727 residues).
MESRVESREAVDINLQNLQLAIKRRWLAAAGVFGFVLGLSTIVTLLQAPLYQAEGKLLLKKPSETSSLNPEKYEPRLEPL
SAESNPVSTESEIVSSIPLAQKTIAALTLKDEEGKPLKPTALISQLTLKNIPATDVLQVAYESKDPQEAAAVVNKLMSAY
VDYNIQSNRAEASAAEDFIVKQLPQTESTVRAAEASLRRFKERHQIVSLEHEAISAVEVLKELQDQITLAEAALVQTQGR
ATKLQKEIALTSQDVVPINSLKESPGIQKTLAELQRVEGDLVVLQTRFEDTYPEVQKLQQKRNALKQLLEGRIGQMLGNS
KQVSNRNLEAGELQQKLAEDLVRAEVERLSLSNRLKFLAQARTNYRQRATVLPQLEQQQRELERQVRAAQATYELMLKKL
QELRVEQNRNIGNASIIETALVPETPLLGKRVMTLGLGGIAAILLAIATITLLELSDASIKTLREIKQLFGYTLIGSIPQ
LGKFIKLKPERQQDCPVPELAVRNSPRSLTAEAYRMLQANLRFLNLDRPLKAVVVTSSVPKEGKSTVCANLAVAIAQLGR
RVLLIDADLRSPIQHHIWQQTNVEGLSHVLVGGTDFQAAVEQVMPNLHVLTAGVVPPNPMALIDSQRMAALVSSLSDRYD
FVIIDAPPLVVAADALTLGKITDGILLVARLGVVDYTNAAAAREALKCSCQTVLGVVANSVPSENRPYSSFHYQSQDNLD
TTVVSSR
>gnl|bykdb|K9U1K8 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Chroococcidiopsis thermalis] (length=712 residues).
MEQKYALLPTIFYRRRLPALATFISVMLGALVYLIFAPRTYEAEARLMLDGKQLSLAGETGRDLTQESARLDSNPVATQA
ELALSQKVLRQAIYEAYTANNRNSNAEPPTVEELRKQLKVKTVPATSILEIKYSNKDPLIAAKLLNALTEAMINEDTAVI
RREAGSARQFLAVEVPKKRAQLAQVEATLSQYKQSQGIVSIADDQGRDNAQTTSIVESLAQIEEQERTTLAQLQEVKARN
SSLEQVTDSSTLKNTYATVRSGQNEQLQALRTQLVELEAKVASAQSKYKADSPPLLNLIEERDAARALYQQKIGSETGNP
AASTPNAATDKLSQDLATQLITGEVEASALEGRLAAIRRDRATLQERLNQLPIREQGLAALVRQRQEAVTSLEFLQRKLE
EARIAEAQKVSNLRPVDLAEPPRLPTWPNPAIVLVLATVAGGTLALGTVLLQEGLDGTLRNATEASSLVEVPIMGVLPVI
SPEVRGKEYADALMQEPAILESYRSLLRSSEFAANEDIKVIVVSSALSGEGKSLVSSYLAAVAATLSRRTLLIDADLRCP
TQHKLFKLAAKPGLAEVAQGKLALAEAVQTTGIDKLKVLCSGRPRSHPSELFESRQIQQVIAAAASQYDLIVIDTPPVTS
CVDAVSLCGNGEKLLLVARPSFTQRDIFTQAVAELRAKRVEILGVAVNGIDPQIDKYYRYAFQSYKTLTNVS
>gnl|bykdb|K9U5W1 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Chroococcidiopsis thermalis] (length=771 residues).
MADTSLDNERLSVEHRVENRANATDLRQLFTVLLRRRLLILSLFCIPLSASSFLALMAKPTYQSSMQLLVSSNLYQGQNS
NAQGGVEESDFTDSNLKVDYTAQLSVMTSPKLVERAVELLRPEYPNITVEEINGKPAKVKQSPLKVTQVESGTKTLQTLS
QVFEVTFVAGDPIKSQKVLQALQNVYQIYNLEQQKLRLTNGLAFVNEQLPKIRKDVSQAEANLENFRKQNKLLDPEVQAK
NLLDALAAVESERRTIRAQFQDQQARYNKLQQQISRSPQQALIASRLSQSPRYQSLLDEIQALDVTLEKLRVQYRDDYPK
VQDLLKQRQNLIGLLRTEAGRSADRLPAQLSTTEKSLPKQLQLGDSDRKLVDALVDAQVVWFGLSARDQSLAKSEQQLRS
TLLKYPQLLAEYNRLMPEIAINRKTLEQLLQTQQNLGIKIAQGGFNWQIIRDPEPGVYMGTGRIMLLVSGAVFGLVLGIG
AAFLLEALDDTIHSCDELQKLSSLPVLGITPKLPNFELKKPSIALPFFKQQSLTSQRIQALNWFPFRESMDLIYQNIQIL
GSPLSFKSLLLTSALTGEGKSTLAAGMALSVARLQRRVLLIDADLRRSNIHKLLNLSNDRGLSTLLTEEADVRERDCIQS
VQPSLDVLTAGPTPTDIVKLLSSHRMKHLIESFEQSYDLVLVDAPPILGLADASIVASLCSGTVVVERLNRVTRFDLNQS
LEALSKLNVIGAIINESKECNSRYTVYDGTSQDNLERGFTTNPNLAGRGIF
>gnl|bykdb|K9U6L7 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Chroococcidiopsis thermalis] (length=738 residues).
MQEQLIETSENLDLDFSKLWIILKRRWLPGTGVFTAILGLAIIAVCLQKPVYEATGKLIVKKNDQTAALTGLGQGIGDLE
GLNLQSNPVNTEIEVVRSIPLLQKTIAALNLKDDRTSEPLKPADIIGKLKLKNIGGTDVMQVTYKSISPDEAAAVVNKLM
NVYLENNIQTNRVTATAAGDFIAKQIPDVEARVRRAESALRRFKEQNHLIALEVEAQGAVTVIQTLEGQIAQVRAELANA
NTKLAKLRQQVGMDTDTSLNLNALNQARGVQRVLTEYQKTEAELAQLRTRYAETYPGISNLKQKRTALKALLSQRISQAV
GKTRTLADGKLQIGESKQKLTEAYIQLEVERLGLASRLASLSGEYNLYKQRANILPKLEQQQRELERQLKAAQSTYEILL
QKLQEVRVAENQNMGNARIIESALAPEKALLFKPMIILAAGILLSVVLSSGTVAVLEIKDTSVKTLKEARELFGYTFLGA
IPSLTKKAAADGKNAEATTIALPVRDTPRAPIAEAFRMLQANLKFSSSDKLKVILVTSSVPGEGKSTVSANLGAAIAQLG
NRVLIVDADMRRPRQHHIWEKANTEGLSDAIVGQVDYQSAIKEVLPKLHILTAGATPPNPVALLDSVQITSLIDNFAKSF
DFVIIDAPPVLVAADALMLGKITDGLLMVARPGVVSSNTATTAKDLLQSSGQKVLGLVVNGVILENESDSYYYYVKDYYM
EEDSTNRQRSTANRKAAS
>gnl|bykdb|K9UA41 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Chamaesiphon minutus] (length=751 residues).
MDEIAQYWLVLKRRWMPAALVFALTTAVATVWTFKQQEIFQAKGQVILKKTNKTSALLSSATNAASGGAIGELEGLTGST
PVNTQAEILKSLTTIKGALVELRDGKYANRPERKRLDKFINKNESFVQQLKVSSIKNTDLLEVTFQDPSRELARDVVEKI
MEIYIRDDRTNQRREAEAARKFVAQELPKIETEVKQAENDLRLFKEQYNVVDLPTESVKAVETITSLNKEITSASAQLAA
ETSRLEGLKNLFGGRDAQATIQSGLVSESPGLQKSLKELQEVEAKIATERTRFSDNDPSILNLKEKRQALVEILQKRFKQ
SLIGEQQFQGKLVELQPSGIQGNLIADYAKSEAQRTSLQKQIAALVYVVDAYKQRMNALPKLEQQQNALGRKLETTRTNY
KTLLSKLQEIEIAENQTLGNSRILTHAELPQEALSPKKGQNIAIGGFLGLFLGAATAFLLDGADKRIKTSEEAKNLLPGY
PILGQIPVFEKSRQLPKLSKGAARAPGQLVLTGMTTGIEGESFRMLQTNLQFLNADDSLKVVVVSSSQSGEGKSTVAANL
ALAVAELGKRVLLVDADMRKPAQHLIWRQGNYEGLSNVLSGQCDRKTATTEIQPNLFLVTAGVVPPNPVVLLDSVQMSTS
IAQWSQEYDLVIIDAPPLTVAADAAILGTQAGGLVFVLRPGVADKESVEYAQEILNQSKLKVLGMVLNGVDLDKQNRYNH
YYYSSQTTRGSEEGNIGSKLLTGTTTNRTRS
>gnl|bykdb|K9UI51 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Chamaesiphon minutus] (length=770 residues).
MESQESIDLNLSHYLFAVKRHWIPAVSIFAATVALSIAAASLLKPSYQAEGRLLFKNSTFRVIGPNLIPSNMEGSESGDL
KSLVSNQNPITTQMEVIASRPLLQRTADRLKLKNDRGKLLTASDIHTGLTTKIIGGSDILQIGFKGRNSKDAANIVNTLM
NVYLENDIQASRLEAENARQFIEQQMPKTLAAVNSAESAVRNFKQQNNIVDLSEEAKSAVGVIGNLENNINAVRSELEQA
NAQSQELYKKVNLNSQDALAVSAISQSPAIQGILTQLQDVDRQLATESSRFSDDNPIIVGLKEKQSKLKALLEQQIRSTI
GSQAQIPQGLLKIGDLKQNLITELLRSQVQQTGLVNKLNSLQSSRAAYEKRVSVIPKLVQTQRQLERQLEVSQATYQSLL
KKVQELQVARNKSTSNARIISSAAIPEKPEPGPKLILGILGGLVGALLGTSAIAYLELRDSSLKTVKEIDKIFGYTLLGM
IPATQKKKIRSRATTPEQTTLEIAVRDTPQSITSEMSRTIQSNLRFLSADKPLKIIAITSSVANEGKSKVAANLAAAIAG
MGQKVLLIDADMRVPYQHRFWKLPLRKGLSELIERKSKLQQISWTVMENLDVLTAGARPSNPLSALESKQMKLLIQEVSK
SYDFVIIDVPPILVASDALTVGQIADGVLLVSRPGVINAKDAKAVQEKFKMSQCNVLGLIVNGVIQKYETEDYFSASQEY
FSVEEETEAPWTDYMTKLGETIADRSQSDTIFIDTEGVTTMLGKSTNFHN
>gnl|bykdb|K9UYB2 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Calothrix sp. PCC 6303] (length=712 residues).
MEKSISSVFTILKRRSFPALLMFAAVLGGAYAYISTAPKMYESAIRLMVDEKRGTSVSELGRNLTQVSNSPGNSPLANQA
EVVKSERVLQKALEIASAKTSPETLNSITTKQLRRGLRVKVVPATNIIDLSYQSEDSQLAANLVNSVAMAMIRDHVQAIS
SEATKIREFLETKELPKARQALMVAEMEESAYRERTGIISFDEQTKSLVQSLAALEDQQRTLGTQLQEARSRGESIRRIT
DTSTLNNAYTTVRGGQDDELKKLRAKLAESETKLIEARLKFTESNPIVIQLSEERDALRNLYSQGLNRVSPDNQSIPDNN
IADDQISQQLVSSLITSNIERAAIENKLTLVNASVSELRSRLNQLPAQQRPLTALTRKREETATSLKFLQDKLEEARIAE
AQKVSNILIIDPAKPATIPASPKIAVVLALAIAIGIVSAIALIILLEMLDNKLHDQDETEELLQLPLLGVLPRLPAKATI
LQPANFFFNEISLVEPYRMLFKNLEFSTAENLHLFVVSSTISGEGKSIVTSHLGAISAMLSRRTLIIDADLRKPVQHKLF
NLNPQPGIAEVFDGTKTLTQAIQPTEIENLWVLTCGDFYGSASQMLESAAMRHIITEASEHFDLVIIDTPPLTICADAIT
LGRITEGLLLVTRPKVTVKEMLQRTITELSRIQIPVLGVVMNEITSQNQKYYPYSNQASQSKRVDKRTVLRR
>gnl|bykdb|K9V3C7 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Calothrix sp. PCC 6303] (length=740 residues).
MLINQEKPDMKPQHYTEEIDLKNYWLVLKRRWLIAAGIFLTSVAMSGFVISLQKATYEASGKLLFQTNRTSSLTGVGEKI
GSLESFRNEANPLSTQAAILESRPIVQEVIQALDLKDNKGRSLVPEAFKIKVEAVPGTDILNVSFTWDNPEIASAVVNKL
MDVYVANNLANSRSEAVSAGKFIELQIPQAKIELDKTSEALRNFKARNQIISLKEESDSTVKIIEELSNKLNEARGQLAD
VASQQAEVRLSANIPRDRTVTQTVNVSSLSVNPGVQGTLAELQKVENNLAVARARYTENSPIVMDLREQQATLKQLLQER
VADSSGSSQQITPGNLQIGDIKQDLANQYVSLQSQRAGLEEKVQTLSSLHEAYKRRANIFPNLEKQQGELERSLTIAQKT
YEELLTRQQAIRLAENQAMGNARVIQNAIAPNSPISSKLTLLLAVGGVFVGVFLGIAAAFLVDSIDKSIKTIKEAQTLFG
YTPLGLIPKFDANSTSLIEEMSGDGVSPRIIVATSPRTVIHEAYQMLRANLKFISHKQVRTIVVTSSVAGEGKSEVSANL
AAAIAQTGKRVLLVDADMRQPSQHHLWGLMNVKGLSNLLVDRVKLNRVVQKVSTNLSLLTAGVIPPNPVALIDSESMMNL
IQTMAGEYEYIIFDTPPLAGTADAAVLGKMADGVLMVVRPGIANSDSAIAAKSLLARSEANILGLVANGVSVKNEPGSYF
YYDYARTEMSSERAKTVSLS
>gnl|bykdb|K9W1T3 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Crinalium epipsammum PCC 9333] (length=717 residues).
MDEFTQYWFIFKRRWLPASLVFTLVLGVTALVTFQQKPIYQAQGQILIKKNNSTSLLLNLDKIDGSAGAGNQINTQAELI
NSIPVAQETIATLNLSQKPESFLKPLKVTNIRSTDILQVSYTDTDPAKAAKIINTVMSIYIKSDVNAQRSEAKAAREFVE
KQLPIIEVTVRQAEQDLRKFKEQNKVLDLAGEATSTTEVLNNLTQQISEAQSKYAAETSRVQGLQQLFGNDLNATVVAAS
VGESPTTQKLLSNLQDIQEKLATERTRFQEGHPVIEDLKSKEANLKALLQQQLQQTFLGQQPLPNRIVPLADGVQQSLIT
DFARASAERASLEKQIYALANVEAAYRERINTLPKLEQQQRELERRLKTAQSTYEILSPKLQEIRVQENQTVGNARIVTP
ASIPERAIAPKKAQNLAVGGLLGILLGIAVALALETTDKSIKDPEDAKRILGYPLLGTIPIIEHMDSSTTIRFGNQQRIV
PSIVVTNTAGSPISEAYRMIHTSLRFMSLDNQLKVMVISSSVPKEGKSTTAANLAVAISQLGQRVLLIDADMRKPSQHKI
WQLPNETGLSTVLTGQSDFNDAVVEVMENLEVLTAGTPPPNPLILIDSSQMAVLVGQSAQTYDFVIIDSPPVSVAADTTI
LGRMANGLMFVVRPGVANSGNLTYCKEILDQSSQNVLGVVVNGVSRSSGSYYNNYYYYNSYATQEVEQDESATKRSS
>gnl|bykdb|K9W742 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Microcoleus sp. PCC 7113] (length=782 residues).
MTQSNLNTVPDTDPGYGQLFAILIRRRLWLLGILCLALGIATFKAFTTKSTYVSSLQLLVEPNYQSKRQDGQEGAEKQIV
DPNIQVDSATQLNLMQGSQLLQKALDLLRPDYPDLTLKELRKSLSVFQVEGSQDDSKTKIFAANYTANDPVKTQKVLQAV
QRVYLNYNREQQRLRLAKGLAFIDEQLPKARLSVTQSEAALEKFRKTQNLIEPDAQTTALTTALNAIQDERRRNQAQYRE
LQASYNTLQQQVARSPQDALVSSRLSQSTRYQSLLDEIQKTDLALAEQRKRFTDDNPTIQKLLFQRQQQLALLEKEGERA
VGKNSSQLKGENLLTEGQLGETDVNLTNKLLELESSIRGLMAREQTLAEKEQQLRVELERFPSVLADYNRLQPEIKLKRE
TLDQLEKARQELSLEIARGGFDWQVVEQPLLGEKTGPKKAQIILLGAVAGVMLGGIAAFIRETMDDAVRSSDELKQQVAL
PVLGMTPVLPKAKKSEPRMLLPFGKSQALEPVGNQPIIKLPFGKPKVLAPWTVEVLHWSPSWQSLDLIYKNIQLLSSVST
LRSLMVTSAVAGEGKSTLALGLAISAARLHQRVLLIDADLRNPTLHEKLNLPNDYGLSTLLSSDAPLPIQTSLHASSAYI
DVITSGPISPDPANLLSSPRMGELMAEFEQSYDLVLVDAPPVLGLVDSILTASYCGGVLLVARMGQITKTELTQATAMLS
KLNLIGVVANGDNSSYNSYAPQSTRGANKEDWGTERTAQLVSGVPIHYEGNPKNAEPVNSEK
>gnl|bykdb|K9W9J7 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Microcoleus sp. PCC 7113] (length=685 residues).
MGKVAAIATRHWKSLFILNLLVIAATAGKLATSPKVWTATAQLILPQKSGNLDANLGTLGSLRNGDPGFSSEVNPLKVQA
SILTSDALLEQVLVSDPQKTKFSRLAKYKRLFQVKPQEQSTIISLAVSGSTPELAKGRANNLLQVYQQRLNQLRQADSAS
RKQFSQKELNQAKARLDQAQRAVAQWKQSTGLVNSEAQTQGIVTTINNLTSVQAQALAQAQASENRIQVLSSRLSLTPNQ
AIRSLGLGENQNYQFVRNKLAEVDANLVKLRATFTDNHPAVRKLISERDELQRQLQGYVAQAAAGTQVDTTVSTNSDGRA
TLIQQLVLAESEASGQRRQAEQLQNEIQKLSTTLRTFPANQSRLLELQRQVDVAEGIYKGLVAQVQQNNIDAFDTYPNVQ
VLDPAKVDSKPSGPKRSIIVLSGLMASIIGSIALVLLLESRNPLLSPKDLQATKFPIVVRIPRLRHSNLSWQVGTETEVE
FQRLASAISLQPLKDHRLLITSAIMGEGKTTVTLGLARALADLGFRVLLVDGDFRKAELSRRLGYGREVELADAPRFANE
VQQPVSLEGGLDLLPTSPKKGKIVELVRRGRFEQSLAVAESANKYDYVLIDSAPVSLTSETALMANVVPNVLFVVRPGTS
YSNSVNESLDQLAQHQAQVLGLVINGVEANSKPYAYRSNDSLVKS
>gnl|bykdb|K9XBH8 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Gloeocapsa sp. PCC 7428] (length=689 residues).
MNHIVNIIRRHWMPLLLLNGVVLAATLYAVIYSKTSVPPVWKANAELNLPQSTNSINASLGTLGQLQNSGLGFSRELNPL
QTQLSILTSDTVMQRVLSVDPEKSSYLRLSDYKSLFTVSPQEQTTIIALEVKASSPEIAQQRLNNLINIYQLRLNELRYQ
DTSVREEFSRGDIEKARQQLEQAQAALASFQEATGISEAVEQTRSLIAQLRDLKTNYTTILAQAQGSQAQAIEASGRLGM
NAQQAMNSLRLAENKEYQATRQQLSEVETALAEARSRYTDESPQVQSLLARRQQLMQTMNQQLAVALPNAASNQVDPTLS
GSGTRDSRIDMIAELIRAQNTASGLQQQANQISSEINRVSTELNNITKNRAQLLDLQRRYEIAEGVYKSIIAQVEQAKTN
PFNVYPNVQTLDAPTIDPKPEEPSRRVIALGGILAALFGSVSLILFLESRNPMLSPRDLRQVEFPVLGRISRLKRPDMER
ALSAEVPIDLQRLASAVLMLEHQRILITSPTAGEGKTTMTLGLALALVNCGFRVLMVDGDLRQAELSRRLGHSKTETTMN
AKQSPVSVSLGLDLIPAPAVRREKIAEFFARGSFERNLNQIQSSGGYDFVLVDSPPVGLASETNLMSSVIQNVLFVVRAG
KSDRFSVMDSFEQLVRHNAQIMGLVVNCVESQATGYRYGRQRELMETEA
>gnl|bykdb|K9XH68 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Gloeocapsa sp. PCC 7428] (length=733 residues).
MESNETIDIDPKRVWLILKRRWLPAAGVFGVVVAAATAFASMQRPVYEAQGKLLFRKADRTTAISGLKDINVGELEALAT
KANPLNTEIEIIRSVPFLEKTITALNLRNDGGSLIKPQALAGKMSAKNIPLTDVLQISYQSEDPEEAAAVVNKVMNLYIE
NNIITNRAEASAAGEFIAKQLPQMETTVRQAELALRQFKEQNQVVALDEEAKTAVAAIKQLENQITETQAQLADTTTRSA
TLQQQVGMNPQEGITLTALNQSPGIQKVLAEYQQVEAELAVQQTRFVGDHPTLLSLTERRDALRALLEERVQGAIGNAAA
TEVSPGNLQMGEIRQELTQNYVNSEIQRLGLTSRLNSLNNTYNAYRQRVNVLPRLEQTQRELERRLEAAQSTYETLLRRL
QEVRVAENQNMGNARIIEFATVPENASVRKKAMILALGNILALILAILTICILELSDRSVKTLREARERLDYTLLGTIPY
FGKRYANRRNQEWSIPELPVINLPRSPISEAYRMLQANLKFLSSDKPLKVIVVTSAVPKEGKSTVSANLAAAMAQLGRKV
LLVDADMRHPLQHHIWELTNAAGLSDVIVSQAEFESVVTEVIPKLDVLSAGVIPPNPMALLDSKRMASLVQYFSDRYDFV
IIDAPPLVLAADAVTLGKMTDGVLLVARPGVLDSSSAAAAKESLERSGQNVLGLVVNGVIPENESDSYFYYAKEYANEKN
FPIEESPTITTPR
>gnl|bykdb|K9XJD3 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Gloeocapsa sp. PCC 7428] (length=731 residues).
MEVTELDLHKYWCILKRRWLPAVAAFGTVMGITYLHTLSRVPIYQAQGELLFRQDRSSSLIGLQSATQANPTTQNDTSLA
TEAKVIRSVPILQQALEQINEASQNTALSLESLRQGLDIVDVEGTEILQVVYRGEDPAQAALVVNQLMNIYVNKNLLNNR
AAAISAGNFITAQLPKVKANLQRADLAVRNFKEKNQLTNIEQSQTALAANIERVGSQIDTVEAQLVDLNSRAQSLQRQLG
MTPQQAMTIAKISQSSAIQGILTELQTVQRQITDARSRYRDDHPILDSLQEREARFKQLLQTQINQVLQGQALNNSQLQV
GEIQQELISDLIAAEVERQGLISQQATLTQQQEAYLQKATHLPKLEQQQRELERELSAAQSTYEALLRSLQEIKVIENRT
VGNVRIIEYAQVPSGAINASNTSALAAGSLAGLMIAGAIVYLLELTDKRIKTAKEAREIFEYKLLGTIPLFHNDSQTERE
EWQVPVLAEPRSFVTESYRMLLANLKFPPSLERSSRVILVTSSAPKEGKSTTCANLAAVMALLNYKVLIIDADLRHPSQH
QIWEIANHIGLMNTIAKRIGVNKKAIQPVAKNIDVLTTGTSESDLSILIDSRSMSALITQYAKQYDYLIIDTPPLSIAAD
ASILSKVVDGVILVTRPGIADISSSRFAKEYLDQSGQNILGIVVNGIPLDNTLHSYYRHVENNTDAGSDFKPSDFIKIKD
WRNTLRFFRRP
>gnl|bykdb|K9XPB0 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Stanieria cyanosphaera] (length=744 residues).
MKQIEWEENSSDLGYGQLLGILWRRRFWIGGVFLGVLAVAIPLALMKQPLYMSQMQLLIESNYQTKDSTRGNDNNQYLEE
EFADSSIEIDYPTQLKLMRSSYLLKKVVKKLGVEGSDAEIAEIVEQLKSSLSVYQVIDESEDNKGTETKIIEVAYVSQDY
NDSKKILEAIEQVYIEYNVEQQEKRLRDGLAFIAKQIPAAQQEVAAIEAKLTQLRSENNLVSPQGESESIKAVLNNIQQE
RATLKAEQKQTQGNYRQLQQELGLSAENSVAMTRLNQSSQYQSLLNKLQQIEIELADKQARFTDDNPVVKDLLAQKNTQT
TLLLQEVKKILGAVPPNFAVQLQSLLRQGELVNSKTNFIETITQSQADLKGLEERDRSLAQTESELREKLTQFPALIARY
DSLTQEANLKKNALQRLLAAKQELEIALSRGAYNWQVIESPQLGVQIAPNTTKDILLSLVVASFLGGTTAFIKESLDEQL
YNSRQIQEKIALPLLGSTPGLPLAKHDQFVVKLPFLSPKESSVQEIINWQPFRESLDLIYENLQRLGSGFAFKSLLLTSA
VAGEGKSTLVLGLAFSIARHQKRVLVIDADLRCPSLHEKLGVENNSGLSDLLQGTTASLNIQQVTLAGENIDLVTCGSRI
TDPVKFLSSPKFKQSIDQLQANYDLILIDTPPVLGMVDAIKISGYCGGTMIVSRLNQVKATELIEATNLLCNSNSKVLGI
VVNNSQDVTMRYQKQPQYLLSQPI
>gnl|bykdb|K9XSG1 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Stanieria cyanosphaera] (length=739 residues).
MESNLYTDEYLNFQKYWLVVKRRIVPASVTCLGVITLSLVTALSLEQIYEAEGQVMIKTNKSAKLTGLENDIGKIEVLTN
ESDPLTTEVEVVSSRPIIDRVIKELDLRNKQDELYRYKDLINNLEIKALTGSNVIKIAYEDSDPERAALVVNKIIELYQE
KDTENNRSEAIAAREFISQELPEVEAKVAQAEADLRNFKNENQIANLSEETTTLIETSKLVDTQIDQVAAQLQDVNARYA
SLSSQLGMGVSEAAAISSLNQSVAVQKALTQLQDVKVQLATKRNLFGENAPQIISLKEQEAELTALLEQQIQQTLGSQSA
SSVAQLNILGLGKLKQEQISEFANLGLQKTGLEQKLANLKQTKTNYQQRLAVLPNLEKRQKELERKTKAAQATYQTLLGK
LQETQVAEKQNIGTVRVLANAIPPDEPSGPSKKLIVAAGGLLGGLLGIAVAFLLDLKDNSLKNSKEIEEIFGYPLQGVIP
DLEKEGSPHLLVGDVVDTLPQLPASQNAHSNNRHVFLPIREAYQILQANLKLLSLSQERKVIAVTSCVPQEGKSHVSANL
AIAQNQVGKRILLIDADMRRPTQHKIWSIPNYLGLSNVLKGEVEWQEAIKTIKPGLDILTAGEPPDNAVPLIDSERMKHL
IGTTALNYDHVIFDTPPITGMADTRILGRMVDGLLMVVRPGVANYGSVSVAKKLIETTGQSIIGVVANGVNLRNEAYGYD
YYYYPNYEYDDSYSLNQGK
>gnl|bykdb|K9XUB8 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Stanieria cyanosphaera] (length=802 residues).
MNNQLVNSNTLYLPTPETESTFSLTELKQTLSRQWKPALLVASTVCIGMFLSTVLQTPKYRSQTLLLLENNKTQQSALVS
PGQQSLNTGYSNLKDLSTEILVLRSYPLIAKAVEKVQQEYSDLTVGNVIGNLSIIQANVNEIPTDVLVVSYIDSNPERAK
AVLEALGSTYVEYSLNRQRSQAANAINFIDQQLPKAQAELDDVAKKIRNFRQSYHIVDPNEYASRVIQFRDGLEQQEKQA
EISLAAAQRRYEEINRQLRELGQNPETIVAYTLLSQDQVYQNLTSRLKELESQYGLGSVNFHDSYHVMEEFKLKQVELRK
LMKERAQQILGDAVSQVNLEAIIVNQGSTSQIMGINTANTQVSAANTNQAVESQGGSTQVSGTISTIQNLASMRLQVETE
QASLQTQIAGIQRAKTQVENTFNSIPQLQQYYAELTRQFEVKSGAVNYLMQRRQELDINKAQENAPWQILEAPRLPNVPI
SPNLQRGIFLALMAGGFMGVATAFLLQKLDQRVKQVEQVKQIARLPLLGTIPKVEEPVIQINGETHSRAHYYNYSSFTEG
LRALAMNLRYTITETGKINSLALTSSTSAEGKTTVTYNLGLVLAELGLRVLIVDADMRKPKIHKLAKLANDEGLSEAIAN
ERPWTDYVRLGVLENLHLITAGSTSPNPIALLNSDKMKQLMQQWQEAYDYVLIDTPPIGVMADAKSLANQVDSVLFVVGM
ERATRRAINNSLEVLRSSQCNISGFVANLVDREFDYYSYSYYDSYYNQSANGNGNGNGNGNGNGHHHEGRMQQLLQQFRR
RE
>gnl|bykdb|K9XWX4 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Stanieria cyanosphaera] (length=743 residues).
MTNNYPANNSNNYNYPSEVSSASREAIDVNISGYLIKLRRRWKLALAVFLLTAGVTTALSLLLQKTYQAQGKLLFKQNST
ASLTGVGENVGELKPLLVNQSPLSTQIEVITSTPVIQQTIDKLKLQDDQGKPIKPKDFEKKLNIELVGGSDVVEITYAHP
NPKVAADVVNTLMNTYINEQIRANQSEPASAREFINKQLPQIESQVSQAESELRNFKESNQVVNLTREAESTVVQMANLN
SEIANVAAQLQGTMAQSEALQSQLNLNLNQAIAANQLGASPVVDGLLKEMATVESELAKERQRFLDNHPSIKSLEEKKAS
LNQELKNLISQNVGQGVEISEGLFNNDGLKENQLEKFITLEIDKINQQRQLSSLYQTQQSYLERAQKLPSLEQKEKDLIR
KVKAAQTTYETLLTSLQEVQLAENQQNGNAQIIELAKLPEKGSSGRIAFMLVGILLGLLLSNLSVILVEMQDRSLKTVAE
IKNKFGYNVLGLVPKHEAEDNQGIIVHKQPDSFASEVYRMIQANLKFMSLEHPPQVILVTSSVPEEGKSTVSANLATAIA
QLGKRVLLIDGDLRKPSQHHLWNLDNFVGLKDVISAQKPLSLAVSRPLEQLDLLTAGEVQSNPLALLDSEAMSELINQSR
HKYDLILIDAPPLPVTADVLTLSKLVDGIVFISRPGVVEHESAELAQETLANSNKKVLGMVINGINSKEFDRYSYYAKYA
KGYFPSQSKQNNAVNNNHSQARV
>gnl|bykdb|K9XX88 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Stanieria cyanosphaera] (length=743 residues).
MSNFTGMSNGQTPENLSLNNSYTASRENIDVNLYNYLQKLRRRWKPALAVFLLTVGSVAALSTLLKKSYQAEGKLLFKQN
NTASLTKVGQGIGELKPLLNDQSPLKTEIERMKTEPILVQTIEKLKLKDEEGKALKPEALNKKLKIEIVSGTDVISLRYQ
DQDPYTAADVINTLMKLYLDEQVKSTQAETANADGFISNQLPQIEQKLSQAESDLRRFKEANRVVNLAKEKETLVVELAN
LNQQIANVAAQFQGTQAQTATLNQQLGLNLNQALAANQLGGTPVVESIFKDLADVETELAQQRQRFRDNHPMVQSLLEKR
QDLNQKLEGLITETVGSNTKISEGLLRSDGNKENPLEKYISLEIDRISQQRQLASLSQSQQAYLQRAKQLPQIEQQQQDL
LRQVEAAEKVYQNLLDSQQELKLLQNQTTGNAQIIELAQLPEKGSSGRLALMVLGLILGLLLSNLSVLLLEMQDRSLKTI
PEIKQRFPYKVLGLIPQYTDDEPNGIVVQREPDSFNSEIYRMIQANLKILNQDNPPQVVLVTSSVPGEGKSTIAANLATA
IAQLGRRVLLIDGDLRRANQHHLWNMSNHLGLKDVLTHKTSLHEVVARPIERLDLLTVGVVPPNPLALLDSIEMNELIAQ
AKKDYDFVLIDAPPLPITADVLTLSKLVDGLLFVSRPGVVEQESAAFAQEILVTINKRVLGMVINGVKPSEFERYSYHAK
YAKGYFSSKKLPSNSDRTEVAPV
>gnl|bykdb|K9YXY1 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Dactylococcopsis salina PCC 8305] (length=746 residues).
MDHQEQLPASSVNPIPTTTDQEDYIDLQQYWMALKRRSLSAIIVFASTIGITAAYSFQQEPIYQAKAKLLFQGESQALAL
PTLEQQGNAGPLTNQSQIMQSAPMLQEVVDRLGLKNDEGEPLTPGGVRKNLNVTRLSDTEILEIAYEHPDPEKAATIVNE
LMNVYRENNVLNNRSEATAAREFIEEQLPKTEQSVQAAEEKFREFKEENDIIALSQEASSTVSILASLDQQLIQAQASLD
DAQTRLEKLTEQLGLPPEQALAAGALSQSEAVQKVLTEYQAVEQELTLNRSRYQPEHPIIKRLEEQEATLANLLQERVNA
VLQEELPSNALADDNFSLQLSSLKIGLVGDLVKAQINYLAQKSRIKGLKAEKADYQARAKILPKLEQRQRELERQLNASQ
STYQALLKRLQEVRVAENQNLGNARIIESASMPTSPISPRIKLNLALGGILGAMLGVATALALDARDRTVKTVQEVKDRL
SYTVLGSIPLVKTKMDDTSSFLPLRDLPQSSASEAFRMLQANLKFSSVDQKMKVIVLTSSIPSEGKSTISANLGMALAEL
GNKVLIIDGDLRRPSQHQVWEEPNAVGLSNVLVEDKEINSVVRELMPNLDVLTAGAPPPNSTALLDSQRMKDVLNQCSLD
YDYVLVDTPPLAVAADAVILGRLGQGVLLVVRPSVVAGGNLDSTREILQNSGQPLLGMVVNGVIPDNEPDSYYYYYAQDY
SYSLASEKDQSSQKSIFSFGRGKSKK
>gnl|bykdb|L8LZE9 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Xenococcus sp. PCC 7305] (length=738 residues).
MYPVNNSSSNGSYTQGNYPESKEKFEVEILSYLQKIQRRWKPALAVFLLTAGSIGLASVFLTTKYQAGGKILFEPQDNLT
DLGNPSNDLQSLTVGATPLVSQKEILTSSPILQKTIDQLSLTDAEGEPLTPEKMTKKLKADLVGASDVIEITYEDKDPQI
ASNVVNTLMNIFLENKIANNQKDTESADFFVESQLPQVEKRLEEYESILQNIRERNNIVDLTQEKRVLVQEIGTLNRQIS
AIGAQLQGAKAQTGALSQELGLSLEQAISANQLGRTPIVQSIVTELGNTESQLSQERQRFNDNHPEIVSLLDTKASLRRE
LQQQIAQKVGSNVQISDGLLQSDLGQKENPLERFISLKIDELSLQQQFASMNDYQQAYLQRAKELPRLEKEEQEAIRKVE
NIRTTYENLLNTQVELDILQNKQTANARIIEPAIAPEKGSSGQLALMALGILSGLLLSNLTAIILDKQDRSLKNISEVKK
KLPYKVLGIIPENKFAKREDGIMVQQDPDSYTSEIYRMIQANLKFMTSQRPPKVILVTSSIPGEGKSTVTANLAAAISQL
GRKVLLIDGDLRKASQHQLWGVSNQKGVKELLTEKIALNQITQQPMPNMDLLTSGEIISNPLSLLDSLEMSELVAKARRE
YDLILIDAPPLPVTADVLTLSKLVDGIMFVSRPGVVEHESAELAQETLISTGQKVLGMVINGVDPKEFDRYSYCARYGKS
YFSRSTNNNVERSKALTV
>gnl|bykdb|L8M4F7 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Xenococcus sp. PCC 7305] (length=736 residues).
MFKIPNNNSAYSSQTEGEANASINSRDSIDLDIGEYLLKLKRRWKIASALFLLTVGAAGLLSTKLSTKYEAEGKLLFKSS
SLASLTGVAKNSSALETLNYSLGQQSPLHNQREQIFTSAVLQQTVENLDLKNENGEFIDPNGLRPQLKVKLLPGTDLIQI
LYKDPNPKFAADIVNSLMNVYVEAQIRGNQSDPAVAKKFINQQIPTLKAKVESAESALAKFRADNKIVDLQQEKQTVIEE
TANLNRQIAFIGSQYRGTKAQTDALQAKIGLSLEQAIAADQLGSTPVVKSIIDEMTRTENQLIQERRRFKEDHPNIVSLQ
GKKAALNRQLQSLMSQTIGQQVSPGLIKNNQYAPGQLEKFIELKIQELSLRRQNLALAQAQQIASKRAQAIPKLDSKEQE
LLLELKIADANYKNLLDSLEQVELELLQETSNVEIVEPALVPIKGTSSKMKLLALGVMGGLFFSNAAVLLLETRDRSLKT
IGEIRKKLPHTILGIIPIDDDARSKRRVVVEQSPDSYTSEIYRMIRTNLTARSSQVLPKVILVTSSVPGEGKSTVTANLA
AAISQLGSRVLLVDGDLRRPSQHLLWNRNSHQGIKEVIQGEAELADAVTQPMLNLKLLASGEVVSNPLAILDSSAMNELI
AESRKGYDLVLIDAPPLPVTADILTLNKLVDGILFVSRPGVIEHESAELAQEVLDSIQDKILGMVVNGVNATEFNRYAYY
STNTKKQPQKAFAFTQ
>gnl|bykdb|L8MYT6 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Pseudanabaena biceps PCC 7429] (length=757 residues).
MTAYPKATYVGKYVDDSFKLAKFLRVLRKRWIVIVAVSVTVFAGNTYYTITRIPQYRSSASLLINNSTIPVSDIQVPNAP
SSGLPASPVINLGTEIGILKSRPLIESAIAKMRQSSDGSSKPIDASSVINGLDIRPEKDALILRLTYTDSDPKRAREVLG
ALSQTYVEYSLKDRRTKSSNAIKFIQDKLPQVKQKLEKSALAVTQFRKTYNIVDPDTYAAAVFKMREALETQAQELQIKI
AQSQQQYEALSRQVGKSAESAIGGAILQQDPTYQSLVKQFQDVETNYFLERTRFREDYPSVLALKDRRDELYRLLEARAQ
SVVGVKGNTVNIANEPSSLIQQNLASQLFDAQTNLAVSQAQLESIRNAQSEVAAVFSKIPQIQQRYVEIQRQLDLDTSTY
NKLTEKLEELRISEAQEISSWKILEPPLLPVRPSSPDIERSLFISAIAGLGLGVLIALLLDRLDQRIREVEEVREIIDVP
LLASIPMTEVASLAPLLSQGILPTSSYYAFKEALSSLALNLRYLGTDNMMKVIAFTSSVPSEGKSTLTYNLAMILSSLGY
RILLVDADLRKPTVHKLARLSNKFGLSTALATPSPWQELTQVVDEKGNLHILTSGSIPPNPMLLLESVKMTALVQEWRQE
YDYVLVDTPPVIGITDAQCLTSKVDTFILVAAINRSTRSGISRALEVLASARANVSGLLINMIGSSDSEYHYGYYDQYYL
HPSEQESDEDSEEDDEEEVEEDTSSTITTIEGSKGNH
>gnl|bykdb|Q0IDT5 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Synechococcus sp.] (length=825 residues).
MSNLIARPGQSPDLVPQTIQDVQVRDLGLNLSNLKAEASDEIDLRELWRALKRRKKIVGFTAAAVLVLSGVVTTYQRLFM
PVYEGSFALLITDPISNEGGNNSAASSAASGTVFEQLARNTTQNDIPTLIEVLESPLLLAPIAKRFDVSENELAERINIT
TGGAKRKEAEGVLKVSLTGRNPKEDGQLLEAISAAYLQTALQQRQKRLTDGIAFLDLQAPALQAKADAIQGELAEFRRRH
SLLEPAIEGTALKQREATLATQIFGFEAERSRLKRVRQDIASGSLSARGFQEAISTGSGGVVTGNQQSQGLAVSDADQSL
LQQLLKVETELAEARSKFVNNSSMVLSLEARLEQLQPLLRENQLEAVDAALGLNANRLATARAQERTLQDNFLKQPALIK
QYETLQTKLTLAQENLSGLVSARETFRLESAQSSVPWRVIDPPEIDPNPIKPSIPRNLALGAMLGLVAGVAAGLIRDRFD
HVFHLPAEVKDDLNLPLLGHIPHVAFFKGVREDKRFLLNELDQSSNNNATNAPESRKQDRYQRFFYQEAFRNLFTSLRFL
NTERPLKAVALTSSLPAEGKSLVNVLLAKTLAEMGQRVLLVDADLRKPQLHIRLGINNLQGLSNLITEDALHWRDLCKQV
PGYENWSVMTAGLRPPDPTRLLSSQRMHDLVQEITQSNDFDLVLFDTPPVLGLADASLVAEHCDGLMLLVSLNRVDRGLP
QEAVNRIVSSGVPLLGLITNAVSTEEQSNQFGYGKYGYGKYGYGRYGYGYGGYNSYSAALYANYADPEDSIDSSSEGAGK
SLKASPTWREQLRERSRRFMQWLDN
>gnl|bykdb|Q3MDC6 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Anabaena variabilis] (length=734 residues).
MTMDSLQGFEEVDIHKYVEVLQRRWLAVVGIFGLSLTLGCVYAFSQKPSYKAEGSVMIKTNRTSSLTGLPQDIGRLEPLN
VNDNPLETQVRIIGSNPVLEQTIKALNLKDKNGKPLSIRIFAKQLKIEGIKGTDVVQLSYKSNDPALAAKVVNKVIDNYI
ALNIKANQDEALTAKQVLIAEIPKAETSVKKAESELRIFKEINKIIALEQEATVAVDTVSKLSNRISEAQAQLNDVTGRL
EQLRAQAQVDSQQGVIASELSQAPGVQKVLAELQETESKLAVERTRFESEHPAITSLEEKIVVLKNLLKDRTGQVAGTAQ
VTQGSLQVGQLKQSIIADITRAESQRVGLERQISTLLQQREAYIKRANYLPKLEQNQRELERRLQAAQGTYETLLKKRQE
IDIAQNQKIPNARVISYALIPDFPEGPRKILFIIGGGVAGIFLGIIAAFSIDLIDRSVKTVKEAKEVLRYTVLGVIPTLG
RNTKDDIPIPGLDRAVPKIIGRDIPYFPLGDAYQILQVNLKFLCSDKPLKSIVVTSSVPKEGKSEVSANLAVTMAQAGRR
VLLVDADMRHPIQHHIWDLSNAIGLTNVLIGQVTLDEAVQEVMPNLEVLPCGILPPNPVAMLDSQRMATLMSNFARDYDF
IIFDTPPLTGIADAAVLSTLTDGILLVVRPGVVDFNSANAAKEFLTQSGQKVLGIVINGVNIKNEPNGYIYSSKYRQLEP
NSISSSLSKLSRKS
>gnl|bykdb|Q3MEB7 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Anabaena variabilis] (length=736 residues).
MPSHQDDQDLINFQQYWLIAKRRWLLIATIMGSVFGVTGLLTFSQKPIYEAEGKLLFNKQSGVSSLTGVSEQLGQLSGVT
NLSNPLETEAEIIRSNPIIQKTIAESQLKDEQGQPLEIDDFLRSLKIKSVRGTDILQLTYRSANPEEATAIINRLMNTYL
ENNVRNNRSEATAAREFLSKQLPLVEAKVTEAEAALRRFKEKYEVVSLQEEAIQGVKRLNDLSGQVTQLRAQLVDARTRS
GALQNQLALNTKQAMALSSLSQSNAVQQVLSEYQKVQDQLAVERSRFTEEHPVIANLLNKEQALKEQLEGRVSKTLGSWQ
PIPEQDLQIGELKQTLTANLVQVEVERLGLENQVGVLMKAFVLYQARLRVLPKLEQQQLQLQRQLQIAQTTYEQMLKRLQ
DVEVVENQNVGNARIVSEALLPKTPVSPRIVLNLALGGFLGFFLAIGAALLLEAGDKSVRTQEEAQQLLDYPLLGTIPAF
DQKARLARGESITELPVLNNPYSSVNAAFEMLQINLGFSFSDKKLKVIVVSSCVMNEGKSFIAANLAVATAQMGRRVLLI
DADMRRPRQHEMWQQPNLMGLSNVLVGQATLAEAAKEVVINLELLTSGTIPPNPAALLDSQRMNGLLQQAAEDYDYVIID
TPPLSVLADASIIGKMADGMLLVARPGVLNSAAAKTTKTLIEHSRVSVLGMVVNCVATDSNDYGYYYSHKNTGDNNSGKK
DRIKSNLSKITGLRLL
>gnl|bykdb|Q3MEW0 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Anabaena variabilis] (length=727 residues).
MGKGISTLLGVLGRRGFPAVTVFASVIGASFAYLAVTPRLYETSARLMLDDKKASVSELGRDLTQINSTAIGRNPLADQA
ELLKSQTVLQLAISKLNPPIKDSSTQKPLTASDIRSNLKVIIVPATNILDLRYQSPNPNQAAQILNAVSQAMVEENIKTI
SSEATKVREFLAEKVPIARQRLLQAELAETKYRQQSGVVATDDQTRSLVNSLAELENQERILAVQLQETRSRDASLRQVT
DAKNINTAYASVREGQDEQLKVLRTKLTDIETKLIEARTKYQEAHPTVLDLVQQRDEIRALYGQQMARVSSSNQTANFNN
LSNDQISQTLISDLITNDITRLAVENKLNAIQKMRANIQSRLALIPIQQQPLTVLTRQREEAAESLKFLQSKLEEAQIAE
AQKVSNIRIIETAVAPELPTSPKRTVVLVIAGFFGSILAVGLVLLLELMDNTLRDATEAEELLQLPLLGVLPRLPATKLS
LEPAEQFLDDLGLVEPYRMLLKNLEFRNVDNLQVIVVSSPLAGEGKSVIVSHLAAVSAMLSRRTLIIDADLRKPSQHTLF
NLPPRPGITDVIDGTRPLLSAVQSTTIENLSVLTCGELRGRPSQILESAAMKALVAEAAQRYDLVIIDTPPLSACADAST
LSQMSDGVILTTRPGFTLKEVLQRAVSELNQNRIPVLGVVVNGMTSGTEKYYRYPSEEYPSILSRPLRRLTSLGSSARNS
ANDSRSN
>gnl|bykdb|Q7NDC5 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Gloeobacter violaceus] (length=758 residues).
MGLREYLRILNRHWPYAAGTALAVVTVVTVWTFALPPVWEAQGRLLFKQKDTAIDNPTAVGLRGALGQMGSVAYGNPLDT
QAEILQSRPVAAGVIRDLQLGDPRRPGELLATTDFLRALKVEALRRTDLLVIKYRDRDPAVATRVVNTLARHYIDLNMQQ
NRAEAASTRGFVEAQLPAMEQRLRASERKLRSFKEQYGSVALAEEQQAAVRLLSEFRSQQAQADVALSEAGARVRAIDAR
MGGLSEPEALVAGALSGSDGMRDLRKTLLEIESKLAVARAQYQDSYPEVEQLIKRRGALRALLASEADRLLGRRGLPDSL
LDANLGTGRTEPAAVPDDLPRLDAVRQQLLKDLIAARVEELAARTRTEALARVSAEYDARVAALPRLEESQRRLARQVEA
DQEAYRLLQKKFYEYRILEAQNIGNATLIEPAEVPEIPAWPKPLLNLAAGGVLALILAALAAYTREFFDDSLRSVEEARG
LLGTSLLGSVPRWNAQSVRGPLMALRDPLSPVSEAYRSIRTHLKFLSSERGLRAFVLTSASPQEGKSTTAANLAAVSAQA
GARVLLVDGDLRKPRQHALWDLDNRQGLSTLLVGEADWQTAVRPTPQPGLVVLTAGPPPPNPVVLLESRRLGELLGLWSE
QFDLVIFDAPPLTAASDALVLGALGGGLVLVVRPGVTNKRVLAKVRDSLKRPGIELLGHIVNGTIAANEGHDEYYYYNRY
GADPVPGQPEAAAHTNGNGTARRWFQSLSTRRSSKPRS
>gnl|bykdb|Q7NEU3 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Gloeobacter violaceus] (length=770 residues).
MTKQPFADPVDKPAQVVEESSFDWQTYARTIWRRRYAFIGVFVATFSLAAAYTFLSNPVYEGEMLLLLEDRNSQPKVLAD
EASPMSYFASNSADINTQIEVLLRRPLIEKALRVLRPKFPELLDQDAEDITKRLEIIREERTQVAVVSFEDTDPQVVKAI
LDELSRTYIDYSLEIQKSKLDGAIAFIENELPPVRKEVERAEEQLRTFRRQYSILDPQVQGTELAATLNTLNRDYEQSKA
ELEASKEHYWALSERLGISPGQALASATLSKDGPYQENLTQLQKVETQLALEQARFRDDYPAVQSLKSKRDRLRQVLASQ
AQQILGDRTVPAIVSGGASLQDSIADSVNNTGSPKGITDRLGDLQVNLAAELIKAENAYRVQTARVAGLENVKNRMIGQF
KVVPSLAKRYQELVRDSNLASNSLNRLLERLQELRIQAAQELSPWRVIEPAAIPEKPIWPKPLLTLGGGALLGLVFGLGI
ASLLESVDDRVKSISQAKELLNLPLLGAIPFTEEEDLQASSQPQFSKERQKPDLPKSSLEKSMLREAFRSLLTNLRFLSS
DRKLKVFVVSSSMPGEGKSTVATNLAKVVGGLNRKALLVDADLRRPTVSNKLELSNGPGLSTVLAGEMHWSNCVNQIDEN
VHVLTSGPLPPDPVALLDSLRMKELVKQWGERYDLVIIDSPPMIGLADATILTKCADGLVFVIGLEVARRGGVLSALERL
RSASLVPVGFVANGVRKEAEGRSYYTQHYYHYYGQPTPDKNQTGTRQRKK
>gnl|bykdb|Q7NF11 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Gloeobacter violaceus] (length=683 residues).
MHVIQVLKRHWRPLLVLNGLVLAATIGVACYYPRTWTATTRIILPSTNKNAEISLGALGEVRETGTSFSSEVNALKVQSA
ILTSSEVLSKAWQADPQREKYPQLGSYEKLFKAVPQSQTTILAVEAKGNAPEVAEARADLVVRSYVARLEELRNAYAASR
DTLSQKELDRARRELTRAEAALARFKRSTGLVNTDQQTGGLVGVISSLTTSQAQAVAEGTADKARAQMLTARLGMDAPQA
MRALRLGESKEYQAMRLKLSSLDTALAEARGLYTEKHARVQSLLVQREELQRSLRELLAKVVPASRTERALDDSLAGGGN
RDSRIDLILSLLEAERAAEARSRQSAQLGRTIEQATERLSAISTRQATLLDLQRRYELAEAAYKAIVAQMQQARLSAFNA
FPDIEVLDKAYSNPKEANPRTLLIALGGLVAAVFGSLGLILRKEAINPLLGPKDLQSVELPVLARLPRTKGLLPSGDPPR
LESRQLASTVSLMDLPNRRLMITSSTAGEGKTTLTLGLANALAEMGFRVLLVDADFRQASLSRLLGHGPQVEGTQAEPVS
VIADLDLVPALAIEDTSTAFFVQGGFERYLDDVQTDGYDYVLVDSPPISLTSEAALMIPAVRNVLFVVRPGVSGRDAVSE
SLDRLVRHNARLVGLVVNDVTTRQEGYRYSYGRYGRQSLEVAP
>gnl|bykdb|Q7NJN6 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Gloeobacter violaceus] (length=676 residues).
MSSIVAIGRRHWRPLLALNTVLLAATVGIAVFYPRTWTASAQLILPNASSNLSANLGPLGNIQQQGLPFSNELNPTSIQS
NILLSSDVLRPVWQKDPERTEKFTRLDTYGKLFKGKPGDQSTIVQLEAKGSSPELAQQRAEWVLQSYQTRLNALRLDDAR
RRDEFSRVETAKAQNNLQTAQVELYGYQRRTGLVNADDQTRGIVETLNSLRSTQTLTLAQAEAAARRATALEQAVGMDLR
RATAALNLGEDKGLQALRQRLADIESQLAQARGLYTGKNLRVKSLELQREELLGKIKQQVGSIVPDASKVNVSLGGNSYR
DSRIDLILQLVQSQAENGALTNQAARIGEKAASLEERLRTLAPQQSRLKELQRRYEIAEGIYRGLVAQVQQAKVNAFDAY
PNVQILDAPSVDSKPSPSGLLVAVGGLVAMLSGSIALALWLERRNPMLGVRELDSTGLPVLGRIPKLKDAALSAAEAEEF
RQLASVVSLLPLPARRLMITSANTGEGKTTVTLGLAKALRELGFRVLVVDADFRQAGLGRKLQVGPGSEPVALAPSLSFL
PAGRPDERTSVGEYIARGHFSRYLSELESAGGYDYVLIDTAPEDLVAETKLIAAAIGNVLFVVRPGVSNRDEVNASLAAL
QRFGSSVHLVINGGESAKGSYRYRYERPALASSSES
>gnl|bykdb|Q8YNX7 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nostoc sp.] (length=734 residues).
MTMDSLQGFEEVDIHKYVEVLQRRWLAVVGIFGLSLTLGCVYAFSQKPSYKAEGSVMIKTNRTSSLTGLPQDIGRLEPLN
VNDNPLETQVRIIGSNPVLQQTIKALNLKDQNGKPLSIRIFAKQLKIEGIKGTDVVQLSYKSNDPALAAKVVNKVIDNYI
ALNIKANQDEALTAKQVLIAEIPKAETSVKKAESELRIFKEINKIIALEQEATVAVDTVSKLSNRISEAQAQLNDVKGRL
EQLRTQAQVDSQQGVIASELSQAPGVQKVLAELQEAESKLAVERTRFEAEHPAITSLEEKIVVLKNLLKDRTGQVAGTAQ
VTQGSLQVGQLKQSLIADITRAESQRVGLERQISTLLQQREAYIKRANYLPKLEQNQRELERKLQAAQGTYETLLKKRQE
IDIAQNQKIPNARVISYALIPDFPEGPRKILFIIGGGVAGIFLGIIAAFSIDLIDRSVKTVKEAKEVLRYTVLGVIPTLG
RNGKDDTPIPGLDRAVPKIIGRDIPYFPLGDAYQILQVNLKFLCSDKPLKSIVVTSSVPKEGKSEVSANLAVTMAQAGRR
VLLVDADMRHPIQHHIWDLSNAIGLTNVLIGQVTLDEAVQEVMPNLEVLPCGILPPNPVAMLDSQRMATLMSNFARDYDF
IIFDTPPLTGIADAAVLSTLTDGILLVVRPGVVDFNSANAAKEFLTQSGQKVLGIVINGVNIKNEPNGYIYSSKYRQLEP
DSLSSSLSKLSRKS
>gnl|bykdb|Q8YSM5 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nostoc sp.] (length=727 residues).
MGKGISTLLGVLGRRGFPAVTVFAAVIGASFAYLAVTPRLYETSARLMLDDKKASVSELGRDLTQITPTGVGRNPLADQA
ELLKSQTVLQLAISKLNPPIKDSSTQKPLTPSDIRSNLKVIIVPATNILDLRYQSPEPNQAAQVLNAVSQAMVEENIKTI
SSEATKVREFLAEKVPIARQRLLQAELAETKYRQQSGVVATDDQTRSLVGSLAELENQERTLAVQLQETRSRDASLRQVT
DAKNINTAYASVREGQDEQLKVLRTKLTDIETKLIEARTKYQEAHPTVLDLVEQRNEIRALYGQQMARVSSSGQTDNFQD
LANDQISQTLISDLITNDITRLAVENKLNAIQKMRANIQSRLALIPIQQQPLTVLTRQREEAAESLKFLQSKLEEAQIAE
AQKVSNIRIIETAVAPELPTSPKRTVVLVIAGFFGSILAVGLVLLLELMDNTLRDATEAEELLQLPLLGVLPRLPATKLS
LEPAEQFLDDLGLVEPYRMLLKNLEFRNVDNLQVIVVSSPLSGEGKSVIVSHLAAVAAMLSRRTLIIDADLRKPSQHTLF
NLPPRPGITDVIDGTRPLLSAVQSTTIENLSVLTCGELRGRPSQILESAAMKSLVAEAAQRYDLVIIDTPPLSACADAST
LSQMSDGVILTTRPGFTLKEVLQRAVSELNQNRIPVLGVVVNGMATDIEKYYRYPSEEYPSILSRPLRRLTSLGSSARNS
SNDSRSN
>gnl|bykdb|Q8YT70 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nostoc sp.] (length=736 residues).
MPSQQDDQDLINFQQYWLIVKRRWLLIAAIIGSVFGVTGLVTFSQKPIYEADGKLLFNKQSGVSSLTGVSEQLGQLSGVT
NLSNPLETEAEIIRSNPIIQKTIAESQLKDEQGQPLEIDDFLRNLKIKSVRGTDILQLSYRSADPKEATAIVNKLMSAYL
ENNVRNNRSEATAAREFLSKQLPLVEAKVTEAEAALRRFKEKYEVVSLQEEAIQGVKRLNELSGQVTLLRAQLVDARTRS
GALQNQLELNTKQAMALSSLSQSNAVQQVLSEYQKVQDQLAVERSRFTEEHPVIANLLNKEQALKAQLEGRVSKTLGSSQ
PIPEQDLQIGELKQALTANLVQVEVERLGLENQVGVLMKAFVLYQARLRVLPKLEQQQLQLQRQLQIAQTTYEQMLKRLQ
DVEVVENQNVGNARIVSEALLPKTPVSPRILLNLALGGFLGFFLAIGAALLLEAGDKSVRTLEEAQQLLDYPLLGTIPVF
DQKVRLARGESITELPVLNNPYSSVNAAFEMLQINLGFTFSDKKLKVIVVSSCVMNEGKSFIAANLAVATAQMGRRVLLI
DADMRRPRQHEMWQQPNLMGLSNVLVGQATLAEAAKEVVINLELLTSGTIPPNPAALLDSQRMNALLQQAAKDYDCVIID
TPPLSVLADASIVSKMADGMLLVVRPGVVNSAAAKTTKTLIEHSRVPVLGMVVNCVATDSNDYSYYYSHKNTGESNSSKK
DRIKSNLSKITGLRLL
>gnl|bykdb|U5DPF5 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Rubidibacter lacunae KORDI 51-2] (length=744 residues).
MEAIDRNLRQDDDFLDLQKYWSILKRRWLPASLVTISTIGLTGIYSARQTPIYEARARLLLQTADGAIPFAGFSGGSSTS
NTLLANEAAIIRSLPIGQQVIERLDIRNADGTPMAPQNIVGNLKVYEVPNTHILELTYQSTDPEEAARVVDSFMEVYRDN
DVRINRSEAAAAREFIEEQLPLTERSVREAEEALRRFKERNRIIVLNEEAQTTVRLLGSIDEELVKSQTSLNDTQARIQE
LSAQLGLSSAEALAASALTQSRAVRDALESYQSIESELAVAESRYQPQHPAIVSLVESRDALRQVLNERIQTVLSESPAA
GGAIPVDVAIASGTLQLSEVEIQLTGDLVRAEVDRLGTSSRLSSLQREREAYQSRASVLPRLEQGQRELERQLNAAQSTY
EALLQRLQEVRVTENQNLGNARVVENALVPINPIWPRMQLILMAGGIVGALIGTATAITLDVRDQSLKTVQEAKNRLGYV
MLGSIPLFGRFNRPVDGTRPVTLPVRDYPRSSMSEAFRMLQANLKFSTTDRKLKVVAVTSSIPREGKSTVSANLGVALAE
LGNRVLVIDADMRRPSQHQVWELANTTGLSNVLVEQLSVAEIAHAEGQDGNKLDVLTAGVIPPNPVALLDSQRMTTLLDE
AKHHYDYIIIDTPPLAVAADALILGKVADGVLLVVRPGIVNVTNVDASREALERARQPVVGMVVNGVIPANEPDSYYYYY
AQGYYTEGENQASKKRNGFLQRLR
>gnl|bykdb|U5QCC3 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Gloeobacter kilaueensis JS1] (length=670 residues).
MSTLAIARRHLRPLLILNGAILTTAIGIALFFPKSWTATTQLILPDTSSNLSASLGPLGNLQQQGLTFSTELSPTTIQSN
ILLSDSVLRRVWLKDPEKQEKFPRLEDYTKLFKSKIEDQSTIVQVQVKGSSPEIAKNRANALLQSYQRRLNELRLDDARR
RDQFSHEELERAKRTLQQTQSELASYQQTTGLVNVDEQTRGLVETLNTLRSSATLAQAQAKAAEDRSRSLEQAVGMDLRR
ATSALRVGEDKEYQSLRQKLTDIETQLAQARGIYTEKNQRIQSLLLQREELLSKIKLQLSKLVPDSEKVDTTLGGNTYRD
SRIDLILQLIQARSEGLAQNSQANQITEKIDSIDSQLRTMAPQQSKLLELNRRYGIAEGVYKAMLAQVQQAKINAFDTYP
NVQVLDPPAVDPKPSPRLFLIVLGALLAMIAGSVALALLLERRNPLLAKRDIEVTGLPVLARLPKFKDNELIATAEEFLQ
LASIVSLMPLEGQRLMITSSTFGEGKTTVTLGLARALRSLGFRVLVVDADFRQAGLGRLLQVNQGNEPVALAPSLNFLPA
GQPDGDASIGEHIVKGNFTRHLDRLKQENGHDYILIDTAPEQLVAETKLIAAEIRNVLFVVRPGTSDRDMVNSSLETLKR
CGANINIVINSSESPKDAYAYRYGRSSQSV
>gnl|bykdb|U5QGK3 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Gloeobacter kilaueensis JS1] (length=769 residues).
MGLRDYLRVLNRHRLYAGGVFVLVVAGVAVWTFTSPSVWEAKGRLLFKQKDTAVGSENPARSLRGSLGQLDSVAFGNPLD
TQAEIIQSRPLVEKVIRTLQLKDPQRRGQLLRPEKFLKALKVETLRRTDLLVIRYREFNPELAAKVVNTLAQAYIVENVQ
QNRAEASSTRTFVESQLPKMEQRLRDSERRLREFKERYGSVALPEEQQAVVKQLAEFKSEQAQAAVKLAEAQTRAGAIAS
RMGGLSEKEALVAGALSSSDGMSELRKDLVEVESKLALARAQYQDNYPDVDRLIKQRNALRALLKTEAGRLLGQPGLPDS
LVDASVAAEAQAPATKDNLPRLDLVRQKLLKDLVDARVEELAARTRTDALNSVSERYSSQVAAMPRLEETQRQLERQVEA
DSAAYKLLQTKFHEYRILEAQNIGNAELIEPAVAPELPAWPSPLLNLGAGALLGAILAMLVAYGREFFDDSLQTVEEATS
LLGTPLLGTIPRWTGAEGPGLVAQSDPLSPMSEAYRSVRTYLKFLSAESPLTAVVFTSASPQEGKSTTVANLAIVSAQSG
ARVLLIDADLRKPRQHKLWEVSNQQGLSTLLTGEGNWRDLLVQPPGLERLSLLTAGPMPPNPLALLESRQLPELLAQWRA
EFDLILFDTPPVTAAADALALTALSDGLVLVVRPTVANKRILVKVRESLKRPGIRLLGQIVNGTIAANEGHSEYYYYNRY
QTRSTDSLAVSTKNGSGNGRAYATNGNGKGSSRKWYQIFSARQDSKSRP
>gnl|bykdb|U5QJM6 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Gloeobacter kilaueensis JS1] (length=735 residues).
MMTMAATFTLAVAYTFLSQPVYKSEMLMLLEDKSSQTQVLEDAAQQIQLGGGADFTTQINTQLQVLLSRPLVNKAVVRLS
KKYPKLKDDDIDDVIKRLEIEQVTRTQVVSVAFKDTDRQLVQDMLKELAKIYIDYSQDVQKSQVSGAITFINAELPRVRM
NVEASEEALRDFRSKNNILDPEEQAKALSGVMSDLMEEAEKAKVELQTSRKQYLALASRLGSSPEQALAAATLSEDKIYQ
DVLKQYQDTETQLALEKTRFRDDYPTVQNLKDKRDSLQKRLNEQAGVLLGGDGKQAESLRDSLAGTLESNRTSSSTADRY
GELRVSLAGDLVKAENLYLVQSARVTGLEAAKERLLGKFQLVPGLAKRYQELNRNAVIASDSLNRLLQRLQELEIKAAQE
LSPWRVIEPAVLPDKEKPVWPKPLVTLGVGSILSVVFGLLVAVLLETFDDRVKTVERAKELMQLPLLGAIPYNDELNTTA
KSEKQSKEIAKISKKAKSNGRVQNPPYTRSAYEEAFRSLLTNIRFLNSDKKVNTFVISSSAPGEGKSTVSTNLARIAAEL
NRKVLIIDADLRRPTVAKRLELTNSRGLSSVLAGNLSWQEAVQKLGENLFVLTSGPIPPNPVSLLDSRKMAELTKQWREE
FDLVLIDSPPLIGLTDATLLARHADGILMVIGLETARRGGLKGARERLEAAGVVPMGMIANALKVESEGYYYYYQYYYHY
YGEPTPEEQKKPKER
>gnl|bykdb|U5QL42 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Gloeobacter kilaueensis JS1] (length=817 residues).
MVNPQASLGPPSDNFNLLSIWRTLRKRKLLSLSVAVAVFGGVAAFTYTRPYIYESETLILVDNRQQIPVVQTTESALPSA
ANLETEIQILKSRSLIGRAIHRLAPPFNILNSTTAADNISISQIGDAGVLRVAYRDTNPERAKAVLTALGATYVEYSLES
KRGQADNAIKFIEAKLPRAKKVLNQTAIAIREFRKRYDIPDPDGYATSVAEVQQSLQQRIQDLQINLAQTQRQYSELRAQ
VGEDPDIALSMTILSQDPTYTRLVSKYKDAEADYVSQRAKFKDAYKPVGDLKKQRDIYLRLLQEQATSVLGSAKVAKLGL
KSGAVPALGDSAITGSGGANPPVAPAASAPTPATVASKGEPAPPAAPTSKAPAALPEARSLAAAPVRQTIQQSLASQLLS
TQVTLSVQKAQLASLTKAQNDIVARFKKIPQLQQQYTELQRDYNVNSQIVNGLLTKLEELRITEAQETSPWRVLEPPDLP
DTPVSPKIDQNLLYGFIASVFLGLGAAFVPDLIDERIKGVEEAKELTGLPLLGAIPKTENLTETLVAPSRDGVVIGDRLV
TRQYTRSPFKEALRSLALSLRYLGSNNSVKTLLFTSSIPAEGKSIISYNLGLVLSEFGKRVLVVDADMRKPNLHRFLELP
NSRGLSTAIATETPWQQLVQSGGNPNLTLLTSGPIPPNPVALLNSEKMTELLAQWRENFDYVIVDTPPVVGLPDAQSIVS
RVDRVVLIVAIERSTRSVIARVLEILRSSQCELAGLVVNMLNDGNEGYYYQYYTSYYGESPPDAAAVAQMQAQNNGNGNG
RRRGMLSGLFGNRTGRR
>gnl|bykdb|U7QEH7 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Lyngbya aestuarii BL J] (length=729 residues).
MEDRESIDLDIGKYFKTVQRYWLVVIGVFALCVGLSVYGTKYLEPTYAASGKLLFKVDRTSSLAGIGEGLGELKALLADQ
TPLSTQIEIIYSNRLLNQVINQLNLVDSEGKLREAESIRKSLEVKIIGGTDIVSLSYESKDPKEAADIINTLMEVYMQTN
VDMNQEDAIEAREFISQQLPKVQEEVFRAEQALRSFKEKNQVLDLDAEFRTAVTELAELNRKITVLESELSGVNALAESL
QTQAGFDLEEAIAINTLSQSPVLIGILTELENVESELVNERKRFKDQNPRIIALNQKRDSLNAALQEQVEQTLGSQAVVP
EGLLQVPQGQKNNQLERFIANEIQRVELTRQLESLYTSRRNYEQRSQNLPQLEQEQQELQRKVQIAQVTYETLLKNLEEV
QVAENKSTNNTRIIEEAMVPEEGSTAKIQLLALGIMLGLVAATTSVLLLEMGDKYIRSVEETKKIFGYTLLGIIPMFKNK
RLSSYFQGEKATPDIPVIEASDSFISEIYRMLQANLKFLSSDKRIKTIVVTSSVPKEGKSTVSANLAATLAQLGYRVMLI
DADMRQPSQHHLWGLTNAVGLSDILVGQAELQSGICQGIERLDIIPSGVTPPNPLALLDSKRMTSLIRNFSENYDFVIID
TPPLILAADALTLSQIASGILLVARPRVLDRASAKSAKEMLERSGQRVLGLAVNAISKNESSQYFYHAKRYFPTKKVKAQ
IYPKSSTKI
>gnl|bykdb|U9VXM0 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Leptolyngbya sp. Heron Island J] (length=741 residues).
MASQENSVKEVEIDLQKYWRVLKRRWLIALTIFGLTTTAAVGVGITQKPEYEAEAKLLFELSNQTSSLVGFEGGTRELRA
LTNLDNPLDTQIEVFGSIPLVQQVIEQLKLQNDEGELLQPDELLRDLTITGIPGTDVLKVTYTSDDPELAANVVNTLTDI
YIENDIQTNRAAAVAAQEFISAQLPESEAAVNEAEEALRQFREGNSIVDLEEESRNLVESLFTLDNALIQLKSELADSTA
QASQLQQKLKLSSQEAYAVGLVSESPGIQNALEQLQTVQSDLALARTRYREEHPEIVTLRNQESSLQALLQQRLDITLGA
NQLDLPEDDLQSGDLEQELIAEYLRLDGEQSGLQQQVEQLANARLSQQSRARVIPVLEKQERGLERQLDAAQTTYETLLQ
NLQQAQVLENQNVGNARIVSPALSPTEPIGPSLKLFLLAGGFVGFLLGLIAAFFADIIDQSITTVQEGQELYEYPLLGII
PAWKRNNAKGTDVPSILVRNTEYSSVLDAYQSLQANLKFSCVESQVKTITITSAVGGEGKSEVAANLALTLAHLGHMVLV
VDADMRKPTQHLIWDLPNLQGLSNFATGQVSLKDVIISQEPNLHILPAGVIPSNPLAVLESNLITSLLEASEKAYDYIII
DSPPILGLVDAVTIGRATDGVLLVMRPGMANADNIRATKAMLAQSQQNILGLVANGINVKGNPDHYFYGNQGYTPSEKQI
KFAHASSNGAITKSAQANNHS
>gnl|bykdb|W6FSX4 [Bacteria] Bacterial tyrosine kinase [Cyanobacteria][Nodularia spumigena CCY9414] (length=730 residues).
MPSYQEDQDEIDLRQYWLAVKRRWFLIVIIIGSVFGITSFVTFNQKPIYEAEGKLIFDKQNSVSSLTGVSEGVGELSGLT
SSSNPLETQAEIIRSHPLIEKTIVDLQLKDQEGEPLKIDHVLGSLKVQAIRGTDLLQLSYRSVDPEVGKAVVNKLMNVYI
DDNVMTNRSQATAAREFLNKQLPLVEKQVAESELALRQFKEKYEVVLLEEEAKQGVERLYQISNQITLLRARLIDASSRS
DALQNQLALNTQKATALSTLSQSRAVQQVLSEYQKVQDQLAVERSRLTDEHPVVVNLLNKEQALKEQLEGRITQTLGSSQ
PIPEQDLQIGELKQALTANLVQVEVERLGLENQVGVLTNAFKQDRARLKILPKLEQQQLQLQRQLQVARTTYEQMLRRLQ
EVQVAENQNVGNARIVSQALLPEKSVSPRINLNLALGGFLGILLAVGSALLLDALDKSVQTAAEAEQLLDYPLLGKIPKM
IRDDNTSELPLLNNPYSSVNTAFEMLQINLGFTISDKELKVIVVSSCLPGEGKSFVAANLSVATAQMGRRVLLIDADMRR
PRQREVWQVRNLMGLSNVLAGQTNLTQSSQEALVNLDLLTAGTIPPNPAALLDSQRMHELVQQASQDYDCVIIDTPPLTF
IADASIIGKMADGILLVARPGIVNSDAIRTTKALLKNSRLSVLGMVVNAISGDSGYYYNNYNYYHSKNGAEKKHTIESQF
KEIAGKWLKK
© 1998-2019