BYKdb

Dataset for cluster orphancd of phylum deinococcus-thermus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bykdb|A0A399EFN2 [Bacteria] Bacterial tyrosine kinase [Deinococcus-Thermus][Meiothermus terrae] (length=532 residues).
MTPHTADSTEEISLERLIPLLLRAIRWALPAALLSATVTYFALKQQPLVYESASSLVAVQPGPLGSAGSFTTPLVSVAPL
DPQAYKEAALSTQVLGQALAMAGEPEGPQALMRLRQAAKVRTVDGRQSSIITLRVRDRDPARAARLANAWAAALRGWEDQ
RAREHFTRYRRSVEAQLEAILTEIRQARQLKDPDRLRSLDALRGNLARDRDLAHALEESAVGLLALLEHAQVPLAPSAPR
PLLGGAAAAVIASLLFFGFVLLREALVRAVRDSEEAARVTGLPVLGEFPRMPPNGKRELPAEAAAFLRTGVHHALADRHP
KVVLVTSPEKAEGKSSVAIALARAYARADLPTLLVDADLRRPVVHREFGIAKGWDLVESLRDFTYSVHAHPVAPNLEVLP
CLEAPENPAELLAEHWRDFLNNLVHTGRYKVVVVDSPPALAVSDALILAPHASGVLVAVSEGATDRKRLEATLEVLSRVG
ARVVGLAMTNLRRGPAASGQFTYGYGYGYGPVAVADRKEHKGLPKAGGPKSS
>gnl|bykdb|D7CW95 [Bacteria] Bacterial tyrosine kinase [Deinococcus-Thermus][Truepera radiovictrix] (length=539 residues).
MQQEISVSLGDVFRFLRRGFLLALLLAALGAGLAYVLSGLREPLYRAETTLLITRGDLNLGAFSAPVIVAPPLDASAYAT
AAESSEVIEEALVALGAETVTPQQVQGVRNRTAALPRESAAARDSSQLILQVEEGSAEGSAALANALARSLIEWDLLRAE
NALAQSIAQLDRSIANTQAEIARLQAEGAPPDQIGRLQNRLNNQLANRDEAEANIGTATSRLSVIQAAVPPLRPVSPRPP
LDAVIAGFLGFVLGYGILLLRNLLDTRLRSVEDLEAVSGLPILAEFAKSPKKTRRLPREASGYLRTNLLLATPKVHPKVI
LVTSPHHGEGKSSVAISLAESFTRANYRTLLVDADLRKPVIAREYNLDDKRHMPLRTHLENPHGSYEAAHVGVNLAQTLD
IIPTFRAAPSPTELLSLGFPSCLESWQQDYDVIVIDSAPLLDVADTLTIAPLCTGTVLVASLQETDPQALTDAVELLQRS
GVRIFGIAATFVPRGTGARARAASYRYAYEGELQDDPLVVAPLPPPTAAQPVKARSRPS
© 1998-2019