BYKdb

Dataset for cluster tadcd of phylum deinococcus-thermus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bykdb|A0A399FAX6 [Bacteria] Bacterial tyrosine kinase [Deinococcus-Thermus][Meiothermus granaticius NBRC 107808] (length=522 residues).
MRELPSYIKIDLAELWRTVVRYWWMLLAIFVLAAGLGYFLSKRQTPVYQSTARLLSAQTVAFGGGQFQSLPNSSPLDSQA
YIQAALSTQVLKDTFNLGNQPVTTQRLDELRKKLRVRAIDGRQSSVIVMSALDTNPANAAKIANAWANALRNWDDQRVRS
TFSRNRQTLEAQLKSLNSDLNRGGVSPQDLEARRTLLASVQRDLDLVRALEQGATGQLTLLDAADLPSKPVAPRPLFTAL
LAGFLTLAVGFFILLLRESSTRTVRNSEEASGITGLPVLGEFPRTPGAHGRELPRESASYLRTYVNRSLMDEHPKVVAIT
SAESGEGKSSISLALAKAYARAGKRTLLIDLDLRKPVLHKEFGIAAGADIVSVLRDPMFTLTAHQVEPGLHVLPCLQTLP
DSAELLAEHFRPFLRRLLELQEWDVVILDTAPILEVTDTLIVAPQVSGLLLVVSAGSTNRRRLSAALDSLKRIGARVIGV
AVNNLRSGEGLTTSARGYGSYGPKYRPGSTTEERDIRQTSEW
>gnl|bykdb|E4U5D0 [Bacteria] Bacterial tyrosine kinase [Deinococcus-Thermus][Oceanithermus profundus] (length=508 residues).
MNETVSREFEDEISLSDLFELLRKYALLVLLAAVFATALAFVVSAREPKVYRATAKVIVSFESTARAASEVVIEPPPLDL
STYQEVARSPEVLEQALGRPLDPETLARVTQRYRIDTMEGRRSGVLLLRVEAEAPDRAAAAANRWAEALLAWEQERALGT
IQRQKKALSAQLAALEGELANLDPKSERYLSLALLKAQIQQKYDQLEVLEAGTQPRLHLLEPARPPAESVRPRPLLNAAL
AGTLTAFLAVFLAFFKEAVSPYLRDPEEAARLSGLPVLAEFPRMPPRPGVELPHETALFLKTGLKPSLLADDPSIVLVTS
TVEGEGKTSVALALAHALAQEGKPTLLVDADLRVPALQERLRLPQGPGLLQALSTLEDTARQIAPNLYAITCSAPPHDPA
EILGQHFKGWIRFHSERRAYRYIVIDSAPLLPVVDTLALAPHATALLLVASEGKTSKKNLTTAVGILQNIGVRPTGLVMN
RVRNPSTVFVGGYGYGYGNGKRKRRVRA
© 1998-2019