BYKdb

Dataset for cluster orphancd of phylum elusimicrobia

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bykdb|A0A1F9UED4 [Bacteria] Bacterial tyrosine kinase [Elusimicrobia][Elusimicrobia bacterium RIFCSPLOWO2_01_FULL_59_12] (length=378 residues).
MEIKYADLAHRYKPKHPSLQRVMAQRQSLQAQIQTETQHILQSLKTQVSGQFKGNNIRVVDPAEVPLKPVRPILWMNLLM
ASFLGLFGGWGLALLVNYWDTTIKTQEDVEKFLEVPFFGYIPSIKLGKKDSLKGYLYSREAPESPVTEAFRGVRTRLLQM
AKTRSPKTLLVTSAGVKEGKTLFSSNLAIILAAGGLRILLVDADLRRPQLGAVWGKPDHNLGFQDLLAGEAPLGAVVQET
SVKNVSLVPAGFNCPHPAEILGSKRMGGVLAEMTSQFDLVIFDTPPLSYVTDAMILAPQMDGVLMVVRYGKTHPPIAKRH
VERFQETNTPLLGVVINDFQATPGTYSPYGYGCGYYSPYSHRGNGGKSDVRRPSPLSV
>gnl|bykdb|A0A1F9VII2 [Bacteria] Bacterial tyrosine kinase [Elusimicrobia][Elusimicrobia bacterium RIFOXYA12_FULL_49_49] (length=707 residues).
MTKETQQQLNLSDMLELLIRKRNVFLVLFSVVFFSSVLAGLFMPRVYEASSLIKVRGKKIIDPLVSEIAVAPQIAEEINT
LSKQIMAWPKLEQLVLQLNLVSVDASQKQMEDYITNLRKRVNVRFVNREIIQVVYQDGNPRRAQMVANTLTQNFIEESSQ
GKREEAKNAIDFINEQLKIYRAKLENSEQNFTVSKIDSDLRVAQNRRTLLKDRLANLQKIIPSQVTTEQNPVVSQLQARA
GQIESELARLLIDAKEGNPKVQELQTELTGLKARISSELEKTTVKESISTFNPMYLQTEQELKQMDMEISYLEKRRESLL
TRSVRGAKKLGEEGLANLERNKRVDEDIYQMLLRQLESAYVSERLQDSEKGNQFTVLEYARLPLKPVKPNFMKILLFGFF
GGLMLGGGGVFLLENIFKTFHTPEQAQAVLGFTGLGSVGTIAMETQNKDKKEFRAAVRDFLRNNKLFSKIRIAVPHIALK
RLDPSVAAELVVYHDPRSRIADDYRMLKTNIFHGLNDSGKIKKLLITSAIHGEGKSTTSANLAAAIAAGGSKVLLVDCDL
RKGLLHAFFSAPVNPGVSDILLNSIDPQKACRQTPVNNLWFLPCGAAKGNPTELMGSPSFKELINSLSSQFEIIVMDSPP
VLNMPDAMMLSKFSDAVVVAIESGKTHQKDVINIKSSLRQVGAKVLGFVMTRQDHYMPRYMHDYYYS
>gnl|bykdb|A0A1F9XD88 [Bacteria] Bacterial tyrosine kinase [Elusimicrobia][Elusimicrobia bacterium RIFOXYB2_FULL_50_12] (length=509 residues).
KESNVSSYREGVAVDISGMDYYQTQYKIIKSRSIAKRVIEELGPALNAGNRTANGDSVNSFLGSIIIEPIRGSRLVNISA
ESFSPELAVRMANTLSDVYVKQNLENRLFASREILKKLPADISLASLSNKDVMESLPSVVSNSLIQDLKAELIKYESEYA
NLSQRYKEKHPSMQTLQAKINLLKERIGTEMRNTVESIKTELSGEYKSNNVRIVDYAEVPKNPVRPQRKRNIIIAFVLGL
SLGAGLAFLVEYLDNTFKSGSDIEQYLDVPFLGIVPIVKEKGENNMFVLDGVKSPQGEAVKTIRTNLIFSAAEGKLKTIL
VTSCVPGEGKTFSSMNIAASFSQAGKKTLLVDTDLRRSSLTKCMKMDIGNGLSNYLIGEADCDNITRETEVKNLYFISSG
LHSPDPAELLGSQRMKEFVAQVSAKFDRVIFDSAPVLPVSDTLNIANLMDGVVMVVYSGKLSRAMVNMGKQKLQGVKAKV
VGALLNYVNVKARGYHGYSYYSYSYNEYY
>gnl|bykdb|A0A1F9Y6N7 [Bacteria] Bacterial tyrosine kinase [Elusimicrobia][Elusimicrobia bacterium RIFOXYB2_FULL_49_7] (length=184 residues).
MITSSVHSEGKSTTSMNLAIALADSGMNTLLIDADLRRGILHEHLSVPQSPGLSTLLHGSMLMEAAFARTQIKNLTLIPC
GTRPVRPAELLGSRAMEQLLNKGSTSFDAVIVDAPPVLNLPDASILSRLCDGVVLIVQAERTQREEALRAHGMLAQARAN
IIGFVLTNVQYYIPKYLYDYYYGR
>gnl|bykdb|A0A1F9YBZ2 [Bacteria] Bacterial tyrosine kinase [Elusimicrobia][Elusimicrobia bacterium RIFOXYB2_FULL_49_7] (length=720 residues).
MDKGAKELNFKDYLDILFRSKYTVLLIFFAIIGPLVFYVRTMPDAYTTRSQLVIEDLKYSSALDFTGLQGLRSSRSFNFY
QGIFKSRSFLQAIHDSLGTVSFRNELRDTAQEVIRAFIGSALSLQQTGYESFISLSAMARTPQLAYDLSRVATQIFKSMC
REVVAEEAENMVKETEKQLNLIRDKLETVEKDFNEFRERTGASTLGMADELKHLQTRYYELRSDQASKEALYEANRRLLS
VLEKRIEPKNTDNQQSGLYLKAKETLRQKEKEKKRLESLGLTLSTASQINEEITKLEQDVIRYSSKEERVDPKVVNQWQK
MRNVVVDNEMELDILKNNLAVYEKKINEYKRSHPDELSQSLELARLERARKVYEDTYNVLLEKVELAKIRRASETGGLTI
IDPVYYPTKPIPRKEAAYYIVGLFVSLLLAVGFVFFREFLDTTVKSNTDLENAFEIPIIGTIPHIDFAKKSEMEIKRRSS
TGGDKETTTIYPKELINFYKDESVVAESYRALRTNLFFASPDNPIRTLGVTSSGPHEGKSLTVSNICLACAQMGKRTLLI
DSDLRRPVIHHLFHLPRENGFTDLFIGKELEAVVKKTAMENLDIMTAGRFTPNPSELLASKKMEKILETMKAQYDIILFD
TPPVMAVTDAPIISTKVDGMLMVVKSYSTDKNVLERALINLENINARIVGFVLNDIDLTHRYASYGYYKYYYHYYRSQKD
© 1998-2019