BYKdb

Dataset for cluster tadcd of phylum elusimicrobia

[Download (right click)] [Alignment] [Repertoires]

17 sequence(s)

>gnl|bykdb|A0A1F9QNS6 [Bacteria] Bacterial tyrosine kinase [Elusimicrobia][Elusimicrobia bacterium GWA2_61_42] (length=585 residues).
MTEEKELEFDISYYLDLILRRRWVALSVFVSVVIIAAVVTFNTRPVFQAQSLLVIEKERGNNTIYQGGPTVERGNDDYYQ
TQYKLLKSEALLKTVYKRLNLETIPEFAGVYGYRKLIKPVAIAPVPRSRLVYVKVDSYDPRLAANIANTVAQVFIEQNLS
NQLFISKDVLNALQADRAGNQSRAIYESLPAVVNNALIMDLKRESAKLQAQVAEASGRYTAKHPQVLSLTANLQAVQGQI
KTETDKVIQSLKIDLSGQLMGNNIRLIDAAMPPLQPIKPRKMFNMLLALIGGLVLGLFGAALVEFIDQTVRTQEDVENKL
GLPFLGIVPLTRQTKEATAYNHLILQEHSLISESIRNLRTMVDFAEVGRKNKALIVSSTVQGEGKSYVAANLAVAIAQAG
EKVIVVDGDLRRSNLHKLFRVSNAKGLSDFLAGGRNIEDLRPLIQATDVPNLSILTCGPRPPNPAELLNTPRLSAFLAWA
GEDYDRVIIDCPPMFPISDALLWGKYISNCVFVAAFGKTRVPLIKTATKRLLNAGIKVLGTVVNMSKFGGLSYSYYGYYQ
YNYNYGPDAPEGEKKHHHKVPALKS
>gnl|bykdb|A0A1F9RGN6 [Bacteria] Bacterial tyrosine kinase [Elusimicrobia][Elusimicrobia bacterium GWA2_62_23] (length=584 residues).
MAEEKELEFDLSYYTELILRRRWIVLSVFVSVMLIAALITFNTRAIYQAQALLVIEKERGNNVVYQGGPTVERSNEDYYQ
TQYKLLKSEALLKTVYKRLELEKVPEFAGVYGYRKLIKPVTIAPVPRSRLVYIKVDFYDPRLAANIANTIAAVYIEQNLS
NQLFISKDVLTALQNEKGSGSRALYESLPAVVNNVLIQDLKREVVKLQSQLAEASGRYTPKHPQVVSLSANLTTLQGQLK
SETDKIIQSLKIDLSGQLMGNNIRLIDAAVPPLKPIKPRKGFNMLLALIGGFVLGLFAAALVEFIDQTIRTQEDVENKLG
LPFLGIVPLTRQIKDQSAYNHLLLQEHSLISESIRNLRTMVDFAEVGKKNKALIVTSTVQGEGKSYVAANLAVAVAQAGE
KVLIVDGDLRRSNLHKVFRVSNAKGLSDFLATGKNSEDLRPLIQPTDVPGLFILTCGPRPPNPAELLNTPRLSAFLAWAG
EDYDRVIVDCPPMFPISDVLLWGKYISNCIFVTAFGKTRVPIIRTAVKRIISSGIKVLGSVVNMSKFGGLSYSYYGYYQY
NYNYGPDAVDGEKGHTRKRTPVKA
>gnl|bykdb|A0A1F9RUT7 [Bacteria] Bacterial tyrosine kinase [Elusimicrobia][Elusimicrobia bacterium GWA2_69_24] (length=683 residues).
MLRKRRRLVLAVTLLVVAVVAIATAMQEPVYLASARVLVDRYRIDPLQQIEIDRPDMTNFYETQFELIRSRPVIQRAIDG
LQLATRRPGLAGAPDPAKAVLGGVKVEVVRGTRLVDIRVEDGDPVFAADLANAIANGFVRHVSDLRLEGSRNAYEYLTNE
VKNMKDSLNRAEMALGRYKEEHQLILLPQRANAAASKMSDFHAAYVDAQTRRLELEAQLRTVREGGPNSAALEAKSEALA
GLRAQEAAAQTELNNLLKTYKDKHPAVVRARAQLDDIRARLKTEHGRVFQALEGQYKIQKAREAAMLQAFERYKKETQDL
ARKEVQFNVLQREATVGRDMLDFLIKRLRETGLSSELNTNTVRVAEAATVPTFPIRPRRLQNLLMGLLAGLVGGLVIAFV
LEFAEDSVQNPDDVAQLLGAPLLGTVPVLQAVSPSALKDAPDKARHRLVETDGADTRAVESLNLIGVALRSDSNGSLPRR
ILVTSATPQEGKSTIAANLAVTLARLGTRVLLVDTDLRHPTLDRFFGVRTPSDIGEAARRGTPLGEAVRPTAVPGLSLLP
VGRVTGSPLALIKSAYFSAQLDALAEEFDLILFDSPPITLVADSMALAPLTEGIVLVVRHGHGSQWRLRKMVGQLDRIRV
PVLGFVYDGYTPRDDKHYSYYYGAPRKRTSRGRAGNQTVGRGS
>gnl|bykdb|A0A1F9WUH0 [Bacteria] Bacterial tyrosine kinase [Elusimicrobia][Elusimicrobia bacterium RIFOXYA2_FULL_50_26] (length=709 residues).
MTDKKSAVQQGYRDKLESFIRWRWFMVGPLLISVIVSIFVSIMLSPQYETSSLIQISDKQIVDPLVEGLAVSPKPKEQIE
ALLKYVQSWPRLQKLVENLNLDTGSSDKERERYILSLRKRIKIEMKGSDLVQVSYFDPDPVAAQKVVNTITRDFIEENMR
IKKEEARKAIEFIGEQLNIYRKKLEDSEKNFATHKIDADLRTSLNRKKLLSDQLSSLQKIIPSQVKMEHSPVFSRLQSHL
AELEIERARLKMDSKAEHPRLVELNREIEELRRNIDAELKKDMVRESVSMVNPSYFESEQELKKLEMDLDYLAKRKKELE
ESGIRFDRQLSEEELATLQTGKKVDEDIYQVLLKQMEAAYVSERLQDSDKAARLTVIEYARLPISPMKPIRGKVMFVGIF
MGLLAGMGLVFTMEYLDRSFRTVEDAKSVLNLPVLGSISRLIACAGGAKTMRRRWGEMLRRYLQKHKMLSELRFISPHIA
KKSFHSPVSEHAILYHEPKCAIAEEFRIVRTNIQHYSEQAALRKLMVTSSVHSEGKSTTSMNLAIALADSGKNTLLIDAD
LRRGMLHEHLSVPQSPGLSTLLHGSMLMEAAFARTEIRNLTLIPCGTRPVRPAELLGSRAMEQLLSKGAASFDVVIIDAP
PVLNLPDASILSRLCDGVVLIVQAERTQREEALRAHGMLAQARANIIGFVLTNVQYYIPKYLYDYYYGR
>gnl|bykdb|A0A1F9WWA6 [Bacteria] Bacterial tyrosine kinase [Elusimicrobia][Elusimicrobia bacterium RIFOXYA2_FULL_50_26] (length=569 residues).
MSLVTGTNQFHENELLAYWNIIQRRKWVVLTVLVATVTIAAISGFKAPYVYRATAQLLIEKESNVSSYREGVAVDISGMD
YYQTQYKIIKSRSIAKRVIEELGPALNAGNRTANGDSVNSFLGSIIIEPIRGSRLVNISAESFSPELAVRMANTLSDVYV
KQNLENRLFASREILKKLPADISLASLSNKDVMESLPSVVSNSLIQDLKAELIKYESEYANLSQRYKEKHPSMQTLQAKI
NLLKERIGTEMRNTVESIKTELSGEYKSNNVRIVDYAEVPKNPVRPQRKRNIIIAFVLGLSLGAGLAFLVEYLDNTFKSG
SDIEQYLDVPFLGIVPIVKEKGENNMFVLDGVKSPQGEAVKTIRTNLIFSAAEGKLKTILVTSCVPGEGKTFSSMNIAAS
FSQAGKKTLLVDTDLRRSSLTKCMKMDIGNGLSNYLIGEADCDNITRETEVKNLYFISSGLHSPDPAELLGSQRMKEFVA
QVSAKFDRVIFDSAPVLPVSDTLNIANLMDGVVMVVYSGKLSRAMVNMGKQKLQGVKAKVVGALLNYVNVKARGYHGYSY
YSYSYNEYY
>gnl|bykdb|A0A1F9X688 [Bacteria] Bacterial tyrosine kinase [Elusimicrobia][Elusimicrobia bacterium RIFOXYA2_FULL_39_19] (length=574 residues).
MKTQIDQNSHLTDYIHILLKRKWIIITFFVIVVTTVVIGTFKTRPVYRATAQLLIDKENTATPYQEGISINISDVDYYQS
QYKIMKSRTLARKVIDDLNLKEEEEFIGSNDIVSSFLGKILIQPVRGSRLVNLSAESYYPELAAKMANKLVEIYVKQNLE
NRFFASREILKKLPKGSSIENLSIKEDFVRSLPSVVNNGLIQNLKAEYINLETQYAELSRRYRDKHPKIISLKSSIEALQ
SRIDAEIEKIIASVKVELSGDLKANNVRIIDPAEIPDEPVRPNKRLNISLGIFAGLLMGAGLALFFDYMDNTIKSEQDIE
KYLNLALIGLIPKVKDKEKKKYGGRSIFVLTQPKSPATESVKSIRSNILFSAPKDNLKVILITSAGPEEGKTLTSTNLAV
TFAQYGEKTLLIDMDLRRSSLHKVFKIGDSNRKGMSNCLIGEERIEDVIQKTEIENLDIIFAGPHPPNPAELLNPNKIKE
YFLKLRNMYDRIILDSPPVMPVSDSINLSSMADGVIQVVRYGKLSRQVVMRSKGMLADVGAKYIGVILNNIDIESGGHYY
YPYQYYYYYGNDKK
>gnl|bykdb|A0A1F9XM68 [Bacteria] Bacterial tyrosine kinase [Elusimicrobia][Elusimicrobia bacterium RIFOXYA2_FULL_53_38] (length=589 residues).
MNETNSESDFEIDFAGYLEIFLRRIWVVVSVWAAVVIIAALITFNIRPVYQSSSLIVIEKERGGSANVYQGGPTVERSNE
DYYQTQYKLLKSETLLKAVYQKLNLAIVEDFAGGPGTLNSAVIIAPVPRSRLVYIRANSHDPRVSADIANAVASVYIDQN
LSNQLFISKDVLNALQNNQSMAESRKLFESLPAVVNNILIQQFKKDASNLRAQSAELSSRYMPRHPQLLSINANLQAVED
QIRNETDKIIQSLKIDLSGQLMGNNIRLIDPAAPVPTPIKPRKLFNMLLAFFGGLVLGLFAAMLVEIVDQTLRTQEDVEH
KLKLPFLGIVPFTQQSKSKTVYGHMLLAEHSLTSEAVRNLRTMVDFAEVSQKNKSFMITSAIQGEGKSYIGVNLAVAIAQ
AGEKVLIVDGDLRRSTLHRVFRVSNAGGLSNFLAAGRNVEDLSRLVQPTDVENLSLLTCGPRPPNPAELLNTPRLSAFLS
WAGAQYDRIIIDCPPIFPISDALLWGKYVNSVVFVSKFGKTRVPLIKTAIKQLNSSGIKVLGVVVNMSKFGGLTYSYYGS
HYYKYNYHYGAEDSEKSESSTRKSPSAKA
>gnl|bykdb|A0A1J4STN8 [Bacteria] Bacterial tyrosine kinase [Elusimicrobia][Elusimicrobia bacterium CG1_02_56_21] (length=600 residues).
MNDNNNDNELEFDLTYYLDLILRRRWVALSVFISVVIATALYTFNARPVFQAQSLLVIEKERGNNTIYQGGPTVERGNDD
YYQTQYKLLKSEALLKTVHKRLNLDRYPEFAGVYGYRKLIKPVAIAPVPRSRLVYVKVDSYDPLLAANIANTVANVFIEQ
NLSNQLFISKDVLNALQSEKPGGQSRAIYESLPAVVNNTLIMDLKRESAKLQSQVAEASGHYTAKHPQVLALNANLAAVQ
SQIKVETDKVIQSLKIDLSGQLMGNNIRLIDAAMPPLSPIKPRKMFNMLLSVIGGLVLGLFAAVLVEFIDQTVRTQEDVE
NKLGLPFLGIVPLTRQNKEQTAYNHLILQEHSLISESIRNLRTMVDFAEVGSKTKSLIVSSTVQGEGKSYVGGNLAAAIA
QTGEKVLIVDGDLRRSNLHKVFRVSNAKGLSDFLGGGRSTEDLQPLIQPTDVKNLSILTCGPRPPNPAELLNTPRLSAFL
TWATTEYDRVIIDCPPMFPISDALLWGKYIKNCVFVAAFGKTRVPLIKTAVKRLATSGIKILGAVVNMSKFGGLSYSYYG
YYQYNYNYGPDADAQGGEKTRRRKKADLKPEPAQTTVSGK
>gnl|bykdb|A0A1V5VJS3 [Bacteria] Bacterial tyrosine kinase [Elusimicrobia][Elusimicrobia bacterium ADurb.Bin231] (length=598 residues).
MIKVSNTAKAQELQLEDYIQLLFRRKWIFITFFIIVVTIVAIATFRMRPVYRATATLLIEKESTPNPYQENVMVDVSQLD
YYMSQYKIMKSRTLAKKVIDELKLEKHEEFIESKNIIDSFLKRIYVEPDRGTRLVKLSAESYYPNLAAKMANTLADAYME
QNLENKLFASKEILKRLPDSASDNWDSGKEDRLDSLPSVVNNTLIQSLKANYIKLETEYADLSKRYKDKHPSLVSLRAEM
EQLKNRIDIEIKNIVESIKFELSGQLKTNNVRIIDPAEVPQNPIKPKKKLNILLAIIVGLLGGSGLAFFVDYTDNTIKTQ
QDIEQYLIIPFLGFIPKLTAKNKNEKKGERKLFVVSNPHSPESESLKSIRSNVTLTLPDKKFKTLLITSAGPEEGKTIIS
SNLSVSFANMGERTLLVDCDLRRPAVSKVFQKLHNRGMGDYLTEEAGIDDIVHKTDIENFSVIFAGKHKHGHREILHPLK
IKKFIEEVKTKYDVVVFDSPPVMSVNDSMNIAICVDGIVQVIRYGKLNRKLVERCTQVLSDTGTKIIGAVLNGVDTESRG
HYYYYYYYNYYGKYGYGNIKSDKERDSTMSKPAVSQKA
>gnl|bykdb|A0A2M6Y4Q4 [Bacteria] Bacterial tyrosine kinase [Elusimicrobia][Elusimicrobia bacterium CG08_land_8_20_14_0_20_59_10] (length=595 residues).
LEFDLTYYLDMFMRRRWVVLSVWLSVLIVTAIVTFNTRPVFQAQALLVIEKERGNNVIYQGGPTVERGNDDYYQTQYKLL
KSEALLKTVHGRLNLDKYPEFAGVYGYRSLIKPVTIAPVPRSRLVYVKANSYNPLLASRIANTIANVFIEQNLSNQLFIS
KDVLAALQGEKTGGSNSRAMYESLPAVVNNVLVQQMKQDAARLQAQAAEASGRYTAKHPQVVAMTANLKAIQGQIKAETD
KIIQSLKIDLSGQLMGNNIRLIDAAMPPLGPIKPRKVFNMLLAAIGGLVLGFFAAVLVEFIDQTVRTQEDVENKLGLPFL
GVVPLTPFGKKLTAYNHLLLREHSLIAESVRNLRTMVDFAEVSQKSKSLIITSSVQGEGKSYVCANLTVAVAQAGEKVLL
VDGDLRRSNIHKVFKVSNAKGLSDFLAGGRSVEDLVPLIQATEVPNLCLLTCGPRPPNPAELLNTPRLSAFLSWAQQSYD
RVIIDCPPMFPISDALLWGKYIPSVMYVVNFGRTRVPLIKNAIKRLTGSKIKILGAVVNMSKFGGLSYSYYGYYQYKYNY
NYNYAYAPDDDQPSDGPEPKDKDHHAKKTAKKELV
>gnl|bykdb|A0A2N2ESN1 [Bacteria] Bacterial tyrosine kinase [Elusimicrobia][Elusimicrobia bacterium HGW-Elusimicrobia-3] (length=596 residues).
MNENNNEKELEFDLTYYLDLVLRRRWIVLSVWVSVIIITALVTFNTRPVFQSQALLVIEKERGNNVIYQGVGTVERGNDD
YYQTQYKLLKSEALLKTVHKRLDLGRYPEFSDPYGYRKLLKPVAVAPVPRSRLVYVKADAYDPLLSSKIANMVANVYIEQ
NLSNQLFISKDVLSALQGGKNGNQRAVYDSLPAVVNNVLIQDLKREGAKLQSLLAEATGRYTAKHPQVVSLAANLKAVQE
QIKAETDKIIQSLKIDLSGQLMGNNIRLVDAAMPPLQPIKPRKLFNMLLSLMGGFVLGLFAAVLVEFIDQTIRSQEDVEN
KLGLPFLGVVPMTPFSKKNTAYNHLLLQEHSLIAESIRNLRTMIDFAIVGQKSKSFMVTSTVQGEGKSYVCSNIAVAIAQ
AGEKVLLVDGDLRRSNLHKNFRVSNTRGLSEFLAGGKHTDDLKHLIQPTDVENLSILTCGPRPPNPAELLNTPRLSAFLA
WAGEYYDRVIIDCPPMFPISDALLWGKYINSVVYVTSFGKTRVPIIKNGAKRLQTAGLKILGSVVNMSKFGGLSYSYYGY
YQYKYNYHYGYAPDEKDTPETPPVADSKKKPQKELV
>gnl|bykdb|A0A2N2EX59 [Bacteria] Bacterial tyrosine kinase [Elusimicrobia][Elusimicrobia bacterium HGW-Elusimicrobia-2] (length=567 residues).
MIEEDEIDLRQIYALAGKHKLLIFLFFVAGIAAAIITTMIKTPVYRASTMLLIEKKSGGGLQEAIGFEMTQSDYYQTQYS
IITSRSIAEKVAAAVNARKKNGSARDLTTGFMSNVSVEPVKSSRLVRISYDSIYPAEASEVANTLAEVYISENLKSRLLL
SHSILDKISLAKGASVSEDDSDINSLPQILNNPLLQRLKGDLISLQVKLASLSTKYKDNYPEIIGLKKAVDFMEEKIREE
TLNIISSIKSELEGKLTVNNIRVIDTAETPKKPILPNKRKNLMLGSFSGLALGILAAFLLEFLDNSIKTKDDIEHYLSVP
FLGYIPRVADGFKNVIDLTKDLDSRQHSHFAESLRNIRVSINFAGEIRSLLVTSTMPGEGKTSFAVALAHILAHAENSVV
LIDTDLRKPKIQGIFDIDTSPGLSGYLSGQAGLEKIIHKTEIPNLAIIPAGVIPPNPSELLERDTFGKLLKKLREQFRWV
IFDSPPIFPVSDAVIISKLTEGTVFLINFGKTKKEPAKEGKEKLEKVGAKIIGAVINNIDIEKHKYYYPYYSYYHYYGGG
EKGEYSK
>gnl|bykdb|A0A351UI79 [Bacteria] Bacterial tyrosine kinase [Elusimicrobia][Elusimicrobia bacterium] (length=607 residues).
MNDNNTHDEELEFDLSHYIEMFMRRRWVVLSVWVTVLIVTAIVTFNTRPVFQAQSLLVIEKERGNNVIYQGGPTVERGND
DYYQTQYKLLKSEALLKTVHKRLNLDRYPEFAGVYGYMKLNKPVVIAPVPRSRLVYVKVDSFDPLLSANIANAIANVFIE
QNLSNQLFISKDVLSALQGEKTGGGNSRAMYESLPAVVNNVLVQQLKQDAARLQAQVAEATGRYTPKHPQVVAMTANLAA
IQGQIKTETDKIIQSLKIDLSGQLMGNNIRLIDAAMPPLSPIKPRKKFNMLLAFIGGLVLGMFAAVIVEFIDQTVRTQED
VENKLGLPFLGVVPMTPFNKKQTAYNHLLLQEHSLIAESVRNLRTMVDFAEVSQKSKSLIVTSSVQGEGKSYVCGNLAVA
VAQAGEKVLLVDGDLRRSNMHKVFKVSNAKGLSDFLAGGKNVEDIPPLIQATDIPNLSILTCGPRPPNPAELLNTPRLSA
FLSWAQQTYDRVIIDCPPMFPISDALLWGKYIPSAMYVINFGKTRVPLIKNAVKRLTSSNIKILGAVVNMSKFGGLSYSY
YGYYQYKYNYNYNYAYAPDEPAEGESPVDKDKQKDHHSKKSSKKELV
>gnl|bykdb|A0A353CQL1 [Bacteria] Bacterial tyrosine kinase [Elusimicrobia][Elusimicrobia bacterium] (length=580 residues).
MTEEKELEFDLTYYWDLLMRRRWVALSAWLAAIIITALVTFNMRPVYQSQALLVIEKERGNNVVYQGGPSVERSNEDYYQ
TQYKLLKSEALLKTVHNRLDLAKHEEFKDPYGYRKLIKPVTIAPVPRSRLVYIKVDSYDRLLASKIANTIAQVFIEQNLS
NQLFISKDVLTALQDDKGGKSRAIYESLPAVVNNPLIQQLKQDTAKLQAQVAEASNRYTAKHPQLMAMTANYEALRGQLK
AETDKIIQSLKIDLSGQLMGNNIRLIDAAIPPLKPIKPRKLFNMLLAVIGGFVLAIFAAVLVEFIDQTVRTQEDVENKLG
LPFLGSVPLTRQTKTHTAYNHLLLQEHSLISESVRNLRTMVDFAEVGQKSKSFMITSSVQGEGKSYVGANLATAFAQAGE
RVLIVDGDLRRSNLHKLFRVSNSKGLSDYLAGGRNVEDVAPLIQETDVKGLSILTCGPRPPNPAELLNTPRLSAFLNWAS
TEYDRLIIDCPPMFPISDALLWGKYIKGCVFVTAFGKTRVPLIKNAARRLTQAGIKVLGNVVNMAKFGGLSYSYYGYSYQ
YNYHYGPDAEEKTKKAPVKA
>gnl|bykdb|A0A3C1EME8 [Bacteria] Bacterial tyrosine kinase [Elusimicrobia][Elusimicrobia bacterium] (length=572 residues).
MPDNEQDVEIDLARYFGILSRRKWIVLSVAASAMLGTAAYAFLATPIYRASTLLDIEPVAKAIRSETESGRDMDEEYADT
QHRLITSNTLLERVYNDLDLASTGEFSKGLKILQASVSVAPIPNTHLCYVHAESMHPALATNISTTLSRYYVEQNLNSQL
FMSKDVLDALQMKTNGADSVKVSESLPTVVNNRLIQSIKEQIFTAEAQLTDLRMKYTDSHPAVIAMRSRIESMKKVQLNE
IDNIVRSLKTDLSGQLQGNNVRVVDPARLPDRPIRPKKLLVIIFGILGGAFLGAFAAVFIEFLDQTVRTQDDVEKRMKVP
FLGTIPHCRHKKHAKIFEPLVSGDVSLTSEAFRNLRTMIGYSGSTREDASFLVTSTVQSEGKSYVATGLGVVLAQLGQKV
LIVDGDLRRPRQHRHMGSSAERGLSDYLSGAVRDPAELLQETGIPALDVITCGPRPPNPAELLNTDKLEALAAWARQRYA
RVVIDCTPVFPISDAMLWGRVVKSAVFVVRFGRTRLPLIQTAIRRLEGGGLKVLGGVINGARLSTMSYADGRYYEQYYRD
YTDTEPPQSRKS
>gnl|bykdb|A0A3C1EPJ8 [Bacteria] Bacterial tyrosine kinase [Elusimicrobia][Elusimicrobia bacterium] (length=580 residues).
MNPTPDSETELDLTHYMDIILRRRWIVLSALSIVFISTMLVTFTTKPIYQASSLLVIEKERSSSNAVYTNGALIESSNDD
YYQTQYKLLQSKSLTQKVFDDLHLSNAADFADPRGIEKFRNALTISPVLRSRLVYVRVQSHNPHLAAKAANALSETFVDQ
NLSNQLFISKEVLQALQVNEDSPKARQMYEALPAVVSNPLIQTLKGEHAKLEAQCAEMSQKFTAKYPAMIALRSNLNALK
GQIQAETDKVVQSLKTELSGQLRGNNVRIVDSATVPESPIKPTKRTNALLGLIGGLGLGLALAFLVEMIDQSVRTQEDIE
EKLGQPFLGIIPQSIIRNNTIIEAMLAKELSLTSEAFRNMRTMVDFAGIGGKAKTVLLTSTVQGEGKTYIASNLAVAWAQ
IGESVLLIDGDLRRPKIHKAFHLSAEKGLSDFLVSGRHTEDVANLVQQCVVPGLSLLPCGQRPPNPSELLNTPRLGAMIA
WAQEHYDRVVVDSTPMFPINDTLLWGRHIPSSIFVVRYGETRTPLIRSACQKLITSSIKPLGVAINAAKAGGLSYASYGY
YYQQYYQQYHQESELSKKST
>gnl|bykdb|A0A3D1N2U3 [Bacteria] Bacterial tyrosine kinase [Elusimicrobia][Elusimicrobia bacterium] (length=589 residues).
MPDNELEFDLSYYLDLILRRRLVALSAFISVVIVTALVTFNTRPVYQASALLVIEKERGNNTIYQGGPTVERGNDDYYQT
QYKLLKSEALLKTVHKRLNLDSVSEFAGVYGYRRLLGPVAIAPVPRSRLVYVKVNSYDPLLAAKIANTVATVFIEQNLSN
QLFISKDVLNALQIERSGNQSRAIYESLPAVVNNTLIQDLKRETAKLQAQVAEASGRYTPRHPQLLAMAATLQTLQRQIK
EETDKVIQSLKIDLSGQLMGNNIRLIDAAVPPLGPIKPRKMFNMLLSLIGGLVLGLFAAVAVDFIDQTVRTQEDVENKLG
LPFLGVVPFTRQTKEQTAYHHLLLPEHSLIGESIRNLRTMVHFAEVGRKNKALIVSSTVQGEGKSYVAANLAVAIAQAGE
KVLVMDGDLRRSNLHKLFGVSNSKGLSDFLASGNNVEELRPHIQSSDVSNLSILTCGPRPPNPAELLNTPRLSAALAWAQ
QAYDRVIVDCPPMFPISDALLWGKHINSCIFVAAFGKTRVPLIKTAAKRMTAAGLKILGTVVNMSKFGGLSYSYYGYYQY
DYHYGPDKPETEKHQEPRHKKPTPKKELV
© 1998-2019