BYKdb

Dataset for cluster orphancd of phylum environmental-samples

[Download (right click)] [Alignment] [Repertoires]

7 sequence(s)

>gnl|bykdb|A0A1L5KMJ5 [Bacteria] Bacterial tyrosine kinase [environmental samples][uncultured bacterium] (length=382 residues).
MEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISKSSAIGNVRIIDPAVTQPQPVKPKK
ALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEHGISVYATIPMSEWLDKRTRLRKKNLFSNQQRHRTKNIPFLAV
DNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRRGYSHNLFTVSNE
HGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDHYDLVIVDTPPMLAVSDAAVVGRSV
GTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGYSYSEKE
>gnl|bykdb|K1YLM0 [Bacteria] Bacterial tyrosine kinase [environmental samples][uncultured bacterium] (length=325 residues).
MPVASSILTIFGDGWQEFIDPIDVFKEIEHSKQNKMKISEALEKAGYGEDLEKRAEEGPEKEFDHDRIVVSQTRAGQEEH
SANNNSVQKSISGKWDERLFKAVNDSSYVPEIFKTLRSRILHPLSGEAIPKTILITSAIPREGKSFVAANLGISLAHGLD
QHSLLVDCDLRKPAMAKMFGLDNSPGLVDYLRDGVALSKLIQKTPIAALSVLTSGIPPENPAELLGSSKMSALVEELSSR
YDDRIIIFDSPPMLVAAEASVLAGQVDAMVLVVRQSTSGKAQIQKLIDIVGTERILGIVFNDQKTNLLQKRIIKGYASNH
GAYYE
>gnl|bykdb|K1YRR9 [Bacteria] Bacterial tyrosine kinase [environmental samples][uncultured bacterium] (length=201 residues).
SSAEQPPKTILVTSMDAKEGKTSTTINIARVLSQGGKKVLIIDCDLRRPRVHAVFAMQNDRGLSNFLTGNLQENIIHKIP
GEEIYVISSGTIPPNPSELVSSRKLKTLVEKMAEDFDFVLLDSPPIQSVTDSLALTQIVDGTVVVIRVGVTTYEMLQSGL
KKLKDVQCHLLGCVLNGQRKNNSSGSYYYGYTTYYAKDSEG
>gnl|bykdb|K1ZAW7 [Bacteria] Bacterial tyrosine kinase [environmental samples][uncultured bacterium] (length=276 residues).
KDAPKDNIFDKQKVQPSKPAPKDIALDDRLVSYFDPSSMVAEQFKRLRTYVIKPGTENSPKTILVTSTMEGEGKSMIAIN
LAITIAVDLNSNALIVDCDLRNPSLSRWFGFREQRGLSNYLLGEAQLPELLVKTSVDKLTILPGGTVRDNPVELIGSKKM
KSLVADLKMRYDDRYIILDSSPLLATTEPRVLSDMADGILFVIKSADTPRESVQQALKLIDKKCIIGVVLNQVEFKTEAL
IRRYFGTDRYSDYRYSAKQSEPSSSRQSASRTRIRK
>gnl|bykdb|W0FPE0 [Bacteria] Bacterial tyrosine kinase [environmental samples][uncultured bacterium Contig783] (length=243 residues).
MAKKRKTTDGFDHIGNLLNFSGKEAYNLLRTNLMFSIRKEEDRARIVGVTSSIHGEGKSLTAINTAYSLAENGYKVLIID
CDMRLPTLDKKLGLKKSAGLSNILAGMDTDDDILFKDVIVKGLNVVQAGDIPPNPSELLGSAQFKSLIENLGGYYDFIIL
DLPPVGEVSDALVASKRVDGMVVVVRQDYTNQADLAYTMRQLELVNAKVIGFVCNYASGKDHKYGYGKYGKYKKYKYAQK
PAK
>gnl|bykdb|W0NTY4 [Bacteria] Bacterial tyrosine kinase [environmental samples][uncultured bacterium B3TF_MPn2] (length=364 residues).
MVEQSKRFRRGMRQRPAKAPEEAPVDPPVEASVEVPADVTETAPVQRRGLLSGSGRSAEEIAREDRALRSAFPFLDLDDV
EAESPERAEEVAPVAAPEPLILNPESEVMPEPEAEQPSEQPPEDDGWNDLGPMPVQRQQMMRNLIITASRKNPVHAAFDV
LRARLVQALSDNGWRRVAITSPTRDCGKTFVSVNLAVALSRYENCRTVLMDMDMRNPSVAKTLGLRDVGSMGAYLRGEIE
TRDQFFKFDQNDMSLGDNLAIAMNDRVEPFASELMQQPATRDRLTRMEAELHPDVVLFDLPPALANDDVIAFKSNFDGVL
IVIDGTRTSGAEVREVMRRLGEDVPLLGVVLNKAEDATGDEYGY
>gnl|bykdb|X2LJV2 [Bacteria] Bacterial tyrosine kinase [environmental samples][uncultured bacterium lac193] (length=310 residues).
MSRLFEASQRAVTDTEADPGVSATAPIAGAGDATQVFPLERRLRPSPTESSALARVPTHAGVALPAPPPVGAQKEIAIAS
DGPGALKLVTAGLEQASFNEYRQLAATLLQTNADKPVLVVAVTSALPGEGKTLTSANLALILADAYRRRVLLVDGDMRRP
TLHTLFGAANSLGLGDCLKAAHLVPGSTVEIGRGLTLLPAGRPDRDPVGQLSSPRFKEFLDHASKTFDCIVFDTPPAVLL
PDAELIASAVHTVLLVVQAAKTPYQDVQRAVAALGRERIAGVVLNRVAQDTRRASGYHQYYAGFHDASEP
© 1998-2019