BYKdb

Dataset for cluster tadcd of phylum environmental-samples

[Download (right click)] [Alignment] [Repertoires]

7 sequence(s)

>gnl|bykdb|A0A0B4R738 [Bacteria] Bacterial tyrosine kinase [environmental samples][uncultured bacterium] (length=739 residues).
MAEHKSDHHLPAVAEAFPVTPYIPLAAPAADAEGEEGAVPLTHYLWLLKRHRWKMLAFVAATVAATVIVSSRLTPVYEST
ATVDVDRQTPTGVIGQEATRSVTNDADQFLATQVKLIQSDSVLRPVVERYGLRGRDGEVEESGGLAEERAAEAPVMLKRL
KVTRPPNTYLLLISYRSSEPRLAAQVANGIAQSYLEHTYHIRYRSSLGLSSFMEKQLDELKAKMERSSGALMAFERELNV
INPEEKTSILSSRLLQLNTEYTSAQADRVRKEAAAASVKGGTLAAAQVSSQGESLRKLTERRDETQERFAEVKTHYGAGH
PEYRKAAAQLGEVERLLEETRSNIGQRVEIEYRQSAERERMLARAVGETKAEFDRLNARSFEYQALKREAEADKQLYEEL
VRKIKEAGINASFQNSSIRIADAARPALKPVFPNLKLNVLLALLLSTLAAVGAAVVSDVLDNTVRDPEQVARLLRTEVIG
SLPVVKNWRGRLGPVATNGNGNGNGHGMALAPVEAAAHTLTGYDEAIRTLRNSILLTDFDRRLRSVLVTSASPGEGKSTI
AAHLAVAHAEQGHKTLLIDGDLRRPSVHRRFEIPSVLGLSNVLVAELPWRDALVRLERLPELDILPAGPPSRRASDLVGR
GLEQVLGEASFQYDLIILDAPPLLGFAEPLQMATAVDGVVVVTRAGETSRKAVASVLATLGRLRATVVGLVLNEVHKEMS
DSYYYYGHYGKYYRTPSNA
>gnl|bykdb|A0A1S5Y018 [Bacteria] Bacterial tyrosine kinase [environmental samples][uncultured bacterium] (length=772 residues).
MSFEQNDGPEFSLRDVMDTLRRRKWVIIQAFVFVSIIGAVTAVLSPPVYSTGARLLVETPETRAILISSGDTSPLYRMRS
KQNVETQLEVLRSGLFRERLNKVMPRSEAAIPPQLTFAAQEKTNIIAIAAEGTNPKACAVWANTAAKEYIKLTSETNSGN
LTSTIRQYTRLQGIAKRELDVAEQALLLYQQTHQLSSDPNAQNMVREAAIKAQAEATKIKGDLASMETRIKVLNARLSKA
PPLVTETKQINNPEMESFRNRIATLKAERAVKLGTFTPESDEIKAIDEEIASLESEKAKVNPFVLETYEKPNPDIDAWKI
ELAKLELDRDALSSLQSTLAPVADIQVQHVEQFAPGQVELNRLKRRLDNAEKDYLNYSERLRSLSTGLIENVNASAQMLE
EAGVPGAPIRPHKAQQVALSMVMGLMLGVGFAFLQEFLDDRVNTSDDVERITSLPVLGVVPTIPDDNNRLLIGQDAFSPI
TESYRSLRTAVQYSTVDRKVQFVGVSSAHPGEGKSVTSANLGIAMALQGKRVILIDADLRRPSVHRMFRIEAEPGLTSVL
AGEVSLEDALHSTTIEGFFVLPSGPLPPNPPELLNSQAMMDLLQLLKEHADVVIFDTPPTVPVTDAQVLGTHLDGMVLVV
EAGQARKAAVKHARELLNQTHTRLLGVVLNKIDQSSKGYYHYYYYRSGYGKYGYRKRGYGYGGYGRGYGYGYGYGYGPEG
YGPEGSYGGGYGGYGYGRKGRKLGVGPETEETANVGAEQDQPKLPERLRDWE
>gnl|bykdb|K1XX15 [Bacteria] Bacterial tyrosine kinase [environmental samples][uncultured bacterium] (length=747 residues).
MKNYPVQERLVEEEVEQEVNLREYFFIIQKRKFIVLSILTIVFLLTIITTFSKVPIYTSSAEVLIERNRGASGLENTYYS
NYDPEFLATQSAIITSLKVARRVVDSQKLATTYRKYFIKDAEESSFLASLKTGIKTGVKDFLGKMTGIMKSPAPDGDVPD
DAALIVSEPLTDEDIIAGMIKGNLAVVPSKDSKIVRITSSHESPVMAKLVADAVTKAYVDEILDMKLTTSRYALQWMTAK
ADEERKKLENSEKAMQQYMRENDLVTVENKLTIAPQKMSGFSTQLSKAQTDRKALEDLSKQIAAAGSNIHLLENIPVFAE
NGVLKSLRETIFKARQNIAELSKKYGEKHPMMIKANDELSQLISQQQSEVNRVIATTKNSYELAKSQEESLQQMLDSSKN
ELLNLNEKFIQYSIMKRDVDANRVVYEALTANIKKEGVTEQSQSVNVWVIRNAFLPDAPSKPNKKRNLMLGLILGLMGGI
GCAFLIEYLDNTVKSEKDLEARYGLTVLGSVELVKEKGASIESFIIQKPLSPLAESYRLIRTGLLLSAAEHPPRSILITS
MGPQEGKTSTTINVARVLSQGNKKVLIIDCDLRRPRVHSIFAMQNDKGLSNFLTGNTQENIICKIPGEDIFVVPSGTIPP
NPSELLSSRKLKTFVEKMVENFDFVLIDSPPIQSVTDSLALTRVVDGTIVVVRAGKTTYEMLQSGLKKLRDVQCPLLGCV
LNGQKRSHTSGSYYYGYTTYYAKDGEA
>gnl|bykdb|K2AGP2 [Bacteria] Bacterial tyrosine kinase [environmental samples][uncultured bacterium] (length=747 residues).
MNRVDLEKNQQSSFFLPEDALDFKKIATKLYQNIWIVLGVSFSTAFIAFLQTFSYVPMYQTSALLQVKKSSNSSIFSKLS
MNANGDSALETQEALIRTRYILEPVIAENGLNISASPQYFPLIGSRIARMHSSEKLAKPFLGLKQYAWGGEKLLIQKLTP
ANTTASQNFRLVVREKNTFDFYSADGKFILKGKLGELLTGPGIQLKIDEMKARPGNVFFIHYSSPVNFTSSLSRKINIID
VAGNDPTQSTGLFELLLTDSDPQRAMNILNQIANYVVLKNREQSVKEAKNTLDFLQQRLAEIKAKLGSTENNINRYHSDN
ETLSIPMTNQLIINKLLRSEMDLEKLKLQKDALLQLYTTEHPNVIANENKINSLQKRMLELKEKVKKLPFINQQEINLQR
DAKITVSAYLYLLNQQQQLEITEAGLSSNVAILSDAIPAFQLPSHKFFTVIAGFLLGLFSSVVFIIIRDILKKIVESSEQ
VENEFKIPVQVVLPFSRKQKQMEKLQSEGQRTLGTALSTQLILAKQEPNDITIESLRSLRVSLHVMSQHGSHVIAIMGSL
SNIGKSFVSLNLTQIFADAKKKTILVDCDVRKGRLHTALNQNKSKGLGEYLENKYSYDEIIRPISDQFYFISCGIPDSHP
IQLFQSERFKDLIQKLKQDFEQIILDTPPVIPVTDSIIIAQYCDVKLFVIGAGRDTIDDVKQAIKKVQSHQIQVDGFVLN
HRKSLVPYGSRYYQRYGYGDSKTMTSL
>gnl|bykdb|K2AZG2 [Bacteria] Bacterial tyrosine kinase [environmental samples][uncultured bacterium] (length=754 residues).
MNETNSGNQPASTALLFFPHDGVDIRKILMELYHYKWIILAVSMTSFFIAFLYTFTIQPTYQTTALLQVHPQSANAGVLS
KLGYKSSADSALETQQALIRTRYILEPVIIQTGLNISVTPHYYPLFGAWMARHHSGDSLARPLFRLKSYAWGGEKIEVSQ
FTVPEEYVGQTFKLIAGKNNSYQLFSPEGELLLTGKAGELSTSAKTNALTLKLGKFQANPGTQFSISYKAPIYLVNSLAN
NLRITDVYGNDPAQNTGIFQLTLTDSDPARVVKLLNGIAHYTVIKNRQQNAEEAQETLEFLNRRLPELRNKLASAEDAVN
QYHIQNNTLSMSMISQLLLHQLTTLEQAIDKLKTEREELLQLYMPEHPQVLANISKEDALQKRIDELKGEIRKFPLINQE
EINLVREAKIKNSMYLYLLNSEQQLEIAKAGLSSDVIVLSDAIPAGKIPSHKMMIIFMGFFMGAFLSIAVLLLKNALNKT
IEDSEQIEDAIKLPVQCVLPFSRKQKRLEKAHKKGMNTFGTGLSAPLILAKQEPDDITIESLRSLRISLNMLSPSAHHQA
IALMGSLPGIGKSFVSLNLSQVIADSGKRTLLIDGDIRKGLLHRALNQPKSNGLSEYLEGKCQYEELARHINENLFYIPC
GNHTAHPIQLFQSNRFQELIKKTKQDFDQVIIDTPPILPVIDSVLISKYCEIKLFVVSAGKDTIGDVKLAVKKARACHIE
INGIVLNHSKPLKNAARYEYRYTYGDVNTSSATT
>gnl|bykdb|K2BAV7 [Bacteria] Bacterial tyrosine kinase [environmental samples][uncultured bacterium] (length=746 residues).
MNNQNSELRNIISLSNLEGTIDIHKILRDLYHYKLIILLVSFCTTLIAFLYTFTIQPQYKTSALIQLNPQSGNSIVNSLG
LRTSQSSITETELALIRTRYILEPVIRENNLNIKISADYFPVFGEWMARHYQDSGLAKPFLGLKSYAWGGEKVQIKYFTV
PSEYEGQNFQLIVGKNDTYQLYLPEKNLVLTGRVGERAVSHSYPGVALFLTTLKAHPGTDFVLSNQSPTQMVNQLSRQLH
LKKVESDTSSELNQDTGIIQLQLVGSDPEQIKHILNAIVNYSIEKNIQLKSREAQKTLDFLHQRLPDFKKGLERVENALN
QYHARSGTLSMSITSQLLIQELNNVIISLDKLKAQKKEILQIYTPLYPQVIAVEQQQKELEEKLQEIKKQITNFPAARQE
EINLERDVKIKTKMYESLLSNLHQLEIVKAGLVGDIIALDNATPSVKESSNKLSIILVGFFIGLWLSTIMIIIKSVLTKT
IEDSDKLENELQIPVKAIVPFSNKQKQLEKISTKGVDVPDDMPRLPLILAQHDPKDISVESLQSLRISLYITHSSTHHVI
AIMGSLSGIGKSFVSLNLAQVLADSGKRTLLIDADIRKGRLHRAFFQAKNGGLSEYLAGDITFEDSIRHIHDNLFFIPCG
NHLRHPIELLKSSRVNDLIQRARSEFDQVIVDTSPILPVIDAILITQYCDTKLFVVGGSSDQFDEVKQAVKKAQAHGINI
DGFVFNHCKPIARYGAKKYAYYRYGT
>gnl|bykdb|K2E015 [Bacteria] Bacterial tyrosine kinase [environmental samples][uncultured bacterium] (length=729 residues).
MMDSNTTRQHQLSHSGEYEIDLRALLNLLKHSYKLILLIVSLFLCAGIYYASTRSPVYRSTALMEVKSANMSSVLGIMSA
DHFGRASSSADIETTLLSTPYILGDVVRQFGFDISVSPHYFGFFEKRRIEHTGQVPRAKIDVLSVPNILLGKKLRLVIKT
ATQYDLFSPDNNKILSGVVGQLMQSTYLGEPVKIQVGQLQGLLGAQLTVVKQPVLNVASSLSDSLTIQSKGTTGVLELAY
DSSTPEQAQKILNAVLFTALRRDQEQKALEANHMLQFLDTQLPILQSQLDATQDKISKYGVKTGIFNIRSTEQMLTANLM
NLHQSLQKMDAEKIALLENFTSRHPLVIAENEQELQLKNQIADTQAMLNKIPFTAEKETDLLRDLTIQEKLYFNMLGSIQ
KMQMMKAGIISTVRILDQASYPTAPIAAKTISIVFASIVFGLIAGVSVVFIRHVLSPVIEDPDVVERALGIPVSAIVPYS
KKQVEHNKLAVRSPNYLSANPHLLALKDPKDISIEGLRSLRTAIQMLLLDAADNVIAITGCSPSVGKSFISSNLAVLLSD
LNKRVLIIDSDIRLGKLHHAFGKTKSPGLSTFLQGEANLEQIIQTMIPGRLDIITAGVYPANPSELLSLKSLGDLISTLK
VAYDLVIIDTPPVLAVTDPALILRHSSTNFIVIGVGKNHIKEVQHAKSMLEKGGVKLTGMIFNHTKQHKAGFGYQYGYGK
YSYYYAYDK
© 1998-2019