BYKdb

Dataset for cluster tadcd of phylum euryarchaeota

[Download (right click)]

1 sequence(s)

>gnl|bykdb|A0A2E4GDS6 [Archaea] Bacterial tyrosine kinase [Euryarchaeota][Euryarchaeota archaeon] (length=733 residues).
MTDTPKTPQRTDEDEIDLLALLGTLWDGRWRIAALTLVFTMIGIIYALLATPVYRATSLVQVEEKSGSLPGMEDLSSLLG
SSSTATTEIQLIKSRAVLGQVVDDLHLDIVVEPNYFPVIGKAMARRFVGSEGELAEPLFGERFAWGGEDLSISRMAVPDV
ELGEPLVLEATEEGWRLYNSQAEPVLEGVVGQPSEAGDYALMVQALTARPGTTFEVTKRRRYSAIAELQEDISASEQGKD
SGIIALSYENEDYRLAEQVLDEVGNNYVRQNVERNSAEAAKSLEFLRNKLPEVKRELEAAEEQLNEYQIRAETIDISAEG
EAILDQVVELEKQISQLEIQRAEIEQRFRPTHPRYKAWLSQMQELKQRREELDKRIGGLPETQQELIRLRRDVEVGNETY
LQMLSNIQQLDIVRAGTVGNVRVVDAAAVNVEEPVRPKKALVVAVAFLLGAFIGVGVVLIRAALNRGVENPEQIEALGLP
VYAGIPLSETQPELGRGGKRGRRSGAHQTNLLAVENPADLAVEALRSLRTSLHFGMMDAKNNILMISGPSPGVGKTFVST
NLAAIMALADQKVLLIDADMRKGFCHEIFNTSNDRGLSDVLSGQCSAEEAIHCSDMAGFLSFMPRGTVPPNPSELLMGQR
FDELVQKLSPQYDLIIIDTPPILAVTDAAIVGRHAGTTMLVVRFGTNPVKEVDLTRQRFEQNGVVVKGVIFNAVQKKSSA
YGYYNYEYKSQNT
© 1998-2019