BYKdb

Dataset for cluster orphancd of phylum fibrobacteres

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bykdb|A0A0J7HUK3 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Chitinispirillum alkaliphilum] (length=770 residues).
MSFRKDKKDSVPWDHYLHLFLRNIWFILPVSLTVLVLWIVVMGRMNMFTPEMQARAVLRFDDPQALSGVDERVSYESESR
ASLVKSRSFLEQIAAKHSLQLMTSRVQREDVFDSVWVGPDAPRGSYSLRIHNNMYRLVYSNKEQGIDNRVVQRGKLSSLG
TTEFPGVYLSFSPSFKEEPFEVNFSVIRLRDAVDFILNNLEVRQSEPLGTILSITLSGRDYPLITQVLNSIVEDFVHNKS
NLRYSRTEEIISILQEQLSVAETEMRKAESELRAFRNANPSVGLPDAMLPPSSIPDLIENEAGYRSYVLQARSLRERYNH
VSSNDIIPMLNEMVAFISTHRAPTAAGLQRELDYLTERERMFRQDYSPSHPHAIENRNRLRALGRKVNSALGTVISDFER
RIAENQNRINNLNNDLAALPAKEIQLSNLQRQFEVNADIYSTILGRYKEARIASSIELGDVSIIDHAVQPERKYNFRNLV
LIFGAGLLLSMTAGFGPVMAVDHFDRKARTEKDLSRLTSLLLLESVPVKGKWSGPGWRPENGEVDPKLVSADYSRNFVDE
TFRSLRAKVLLSLFDEKKKRIVISSLNMSEGKSFTAANLAVTMAQQNIRTLLIDGDMRRGLQHESFGLSRKPGLSNILMS
TEPLSSSLLKRKIRPSHISNLSLLPCGSSIPNSAELLNTQRFRDLLDLCSEQFDMLIMDTPPLSVTTDAVGVMDSFNKYL
VVVRSAHTNISHLNKKISEFPGLRKKILGIVFNGAPYRRPEYYQYSSYRY
>gnl|bykdb|A0A1J5EXB2 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacteres bacterium CG2_30_45_31] (length=536 residues).
MNDTIHFSVAFLMAKQGQEFVLSQVDPLIAFRNLSEQLSVSEKGKKTGILQMTYANRYPDRAASILNTIANAYVRQNVAM
LSAEAEKTLLFLEGQLPALRMKLDSSEKALTEYRHSVGTVDLTGEARVVLEKQVDLQQQLLTLARQKQEMTRLFKEDHPS
VIAISEQEATLRKEMGKVAISAKELPLTQQEVIKLQEDVNINNALYSSMLNNIQELRVVRAGEIGNVRIVDYASHEIFPI
KPRRKLIFAGILLGSLLLGAGFIFLLRMTMRGVRSSSEIERDTGVSVYAKIPESEHDTGSRKKGSNVQTLMEADPDDFAC
EALRTLRTALDFSFLERGQKVLVITGLLPSVGKSFVSENLSVLFAGMKKNVLLIDADLRRGRISHRNKKGLTDVLHGHAS
LDEVIEKKNNGGISVLGAGSIPTNPSELLASDMFANIIAKVRENYDLIVIDTPPILLVTDAQLVCKYADFALMIVRYGAH
NMEAIKEGMQLIDRSGIHNKAIVLNRCQYEGGRYGYGYGYGYRYHGKYGYKPSVNV
>gnl|bykdb|A0A3C0PF94 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacteres bacterium] (length=789 residues).
MNSMQSRNVLPVPKVMGMDYYIPHYLNLIWRWKWYICIVTPVIFVAWAIGVIKFGNTRPALESSAVLQFMQSSGTTGPID
NETMLVQKSSCDAFIHSRSFIENISDKLSLRLSVKKYFRSEIFDSISIDKDAAVGKYDFVVGNDGYSIYYSNKKLRINKK
IVISGRLIELSSFFLPSILLKLTNDFVSEPHSFTFFISTQRQAVDNVLKYLSTKFPGSGERDNSIMAITLQEHDYPLGTQ
VVNEIADEFVQHNSEQRLNTKNENVEVLEKQLQEARNNLAGADNALRQFREVNSNVGVTNSAASSVSELVTLENSVNSLK
SSITEANVLQARCQIANSDDISDDKMTALNEAITYLASRQSVAAPALQSDFNEASADKKRVDAEYAPQHPRVIENRKKIA
RIAANISKALSDAVAKMRADAVGAVNRKDALTSENQRLPAQELRYSDLMRKRDNAEELFTNLLSRYNISKMSAASQSSFV
TIMDHAVVPNSPSRLQSMLRVLLIGLVIALVFGFGLPAGIDYLDKRARNEGDCRRFSALPFLEGIPKKNDSEKNNVSKKE
KIDDKLVAAGFEPDTFDEMYRSLRTKILLHLHGEAHKMLVVTSLNAGEGKSLTASNLAIVMAQQKLRTLLIDGDMRRGVQ
HNSFVLEKKPGLSEIISSPDELTTMPVSSFIQKAHIPDLSLLSCGMPIPNPAECMNSSKFRDLTAMLAEWFDVIVLDTPP
LRVAVDAAILPEAFSHYIIVVRAVKTNIVALEKKIVDFPGLYQKVLGIVLNGAPIDKKMHNYTYSYYRH
© 1998-2019