BYKdb

Dataset for cluster tadcd of phylum fibrobacteres

[Download (right click)] [Alignment] [Repertoires]

83 sequence(s)

>gnl|bykdb|A0A0J7HV92 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Chitinispirillum alkaliphilum] (length=718 residues).
MNGINETLISSRPALKDYLAIMMRRRLIIFFAFISVAASTYFYVDSIEDVFEAYSTVVIEDQGVSVNPLMQTNVRPLSFY
EGILNSRSFLEMLLDSIGVEIFSEVFPEYSRDQIRGYIHSNISLRRTPYSSFLRLNARGKTKEMAYMIAGIGTELLRDRC
QEVESEESRRALKEIENQLGLIRDNLEEAEYEYRKFKDRTGQIQDGTTPGLKTLQEAYGSSLANLGLKEADLEAERNQLA
NLENKITPDRQRSPEFLRLRSRLRELETERMRLENLGIRFSGLSNIDREIKDTERQLLQFQRQTSSVDPAVMRQWQELRK
SVINKEAELELFKRRLDSYENAIQTYKQGNPHMLSESLELIRLQRSREVYENIYNILLSKAEEQRIKSRSSGMGLKIVDM
PEMPQAPMPKNEAGYYTLGILLGLGLGISLAFLAEYNDTTIKTNEDVEKYLRLSVLGTIPHIVCNKKKDIEVRRFSSKKK
DKLTVNQYPRQVFTFTGDDSVITEAYRSLRTNLSFVSPDNPVQTVLLTSAGPGEGKSLTVSNLAMAYAQMGKKILLVDAD
LRRPVQHHIFGMKREPGFSELFIDNPDYEKIIRPTGRENLYLISAGIFTPNPAELVGSQKMVQIIDDLKARFDMIFFDTP
PIIAVTDAALLGTKVDGLLMVIKSHHTDRDIAYRAMNSLKNIGVKIYGTVLNDINLSDRYTSYGYYKYYYHYYKTKKD
>gnl|bykdb|A0A1J5E847 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacteres bacterium CG2_30_45_31] (length=701 residues).
MASKNQDETNELAELASDLWKNRIAVCLFLLLSGIIGVFAAYWIRPVYEVNALLQVETKGKGANASAMMGDLGSLFATGS
PAETEIELVKSRRVMGAAVEASRLQNVAIPLGFWDRLLHREGRLNLLDFRIPLENIPEEFRSEPWTLVAEDSVNFKLLDY
ADNFVLRGHAGETVVAPYAGDSVRIGVLRMMAHKGQTFAVSNRLRLDAISAFESAFSVAERGKKTGILEFTYQDIYPDRA
MNVVNQVANAYLRQNVEQRSAEAEKTLAFLEQQIPDVKLKLDSAEAELSAYRYQVGSVDINTETRIVLEGEMRLQQQILS
LEQRREDAVRLFHEEHPSVKTLDEQINNLRKELAESSHQARKLPSTQQEILRLASEVELDKLLYTNMLNSIQQLRLVAAG
EVGSVRIVDYAEQETKPVQPRKKMILMVALFLGFCASVVYVSVKKKFHSGIKDSRVIERELGISVYAKIPKGAASGTLGT
LPLAVAFPDDVAVESMRTLRTSLEFVMPETGASVIVLSGLIPAVGKSFVSVNLAALFAGTEKRVLLIDADLRKGRLHKEF
GIRRDQGLSEVLVGKCKLEECLHVTNVPNLSLLVAGKIPASPAELLGSHRYVQLLEKLKTMFDVIIVDTPPVMLVTDAML
VCRHSDQAILVVEYNRHSIDAIREGLALFTKGASESVHKSIVINKYVHSKVDGYGYKYGKY
>gnl|bykdb|A0A1M5F234 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWB8] (length=713 residues).
MADSEQQTIVVGAQAQTPNNTITLLEALFILWKRRYLLCLFLLVGAAIGVVVGQWIRPQYTSDALFQIDIKGNKSARALG
EMGSLLEVASPADAEIELIKSRLVLNYVVDQEHLMYSATPQGALNRLLHREGRMDIDFLNIPELARADRWEAVVTGDNSY
AIYTPEETKLVEGMVGDLLSAPYAGDTLRIRVKLMRATLGEKFVIKQGNPLLAVRGLAGSLKVAEKGKQTGVIGISYSHR
YADRAASILNTIANTYVRQNVEMRSAEAEKTLEFLETQLPGIKAKLDSSEKVLSDYRHSVGSVDMTGETRAHLDKEVDLQ
RQLLQLEQQRQQATRLFKEEHPSVQTIVKQQDRLRGELARLKKSAESMPVTQQEMIRLQEDVALNNAQYTAMLNNIQQLR
VVRAGEVGNVRVVDFAQIEPIQSKPKKLNILVCCMAASFMVGVLLVFMLRMMRNGIRSSQELEHATNVSVFAKIPESKNR
LVKDKRRKLTLVESSPNDQASEAFHTLQTALDFSLEAGQKVVMTCGLVPGVGKSFVAKNLAAVYAMNGKRVLLIDADMRK
GVIRSSKYIGLTEVLSGKVEWREAVADARCQNLFVMGCGKRLMSPSELLRHDKFKALLEDLKQEYDMIIVDTPPVSMVTD
AELIYPLVDFTLMVVHYGVDSLEQIKENLANLRRYADKPCAFVLNHCEYEPGHYYGYGYYGKGYYGKGYFSKS
>gnl|bykdb|A0A1M5G181 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWB8] (length=719 residues).
MEPNNQYNSTGSTSSANHKDDDEIDILEVLGLLLKHKFFLACCIAVGCAVGFLASNFMRPQYTSDALLQIDVKGNKAGKA
MGEMGALLDVASPAEAEIELLKSRMVLNYVVDKEHLCFNAYPKGLIDRLLHTEGRMDLEDLYIPEIARDEKWMAHVVGEN
EIAVFTPEGVKLLQGKVGESLSAPYGGDTLRIHVKHLHARPGQVFVIVQSEPLDAVRGLVKQLDVSERGKQTGIIGVSYT
NRYADKAASVLNTIANIYLRQNVEMRSAEAEKTLEFLEDQLPGVKAKLDTAEKKLADYRLKIGSVDMTGETKAHLEKVSE
LEKQVLELEQQRQEATRLFKEEHPAVQTIMQQQSRLRSELSRLKKSAENMPRTQQDVMSLQEEVAVNNAQYTAMLNNIQQ
LRVVRAGEVGNVRIVDYAQVERKPSKPNKKVVFAGCVGGSFLLGALLLYLLQMTKRGVRSSLEIERETGISVYAKIPKAE
NAILLKRNKGKNTKPLVEDDPDSPSSEALRSLYTAIEFATNDLRVMMVTGMIPGVGKSFVSKNVSALFAGSGKKTLLIDA
DMRRGVVYSHRKQGLGDVLEGKCSLDNAVADSITKNLYVLGAGKTDVSPSELLRGETFKNLLEEAKSKFDIIIVDTPPLE
LVTDSELIYPIVDFALFVLHYGKHSMDQIKESMMKLDRCCEGKPRAFVMNHCESDGHGYGYGSYGYGKYSYYGKDKKRK
>gnl|bykdb|A0A1M5IPF7 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWH9] (length=699 residues).
MASKKKEETDLTELLKDVAKNWYIMLPCLVVAGIVGVFVSLWIRPVYQVDALLQIESKNSKNSMGMMGGLGALFSNASPA
ETEIELIRSRQVMGAAVEKMRLQYEAEPLNFLDRLLHREGRLDLAQIEVPWDSVPKTDKIKEWEVEIKDSTGRFDLYDHL
DKVVLSGEPGHTYKFPYAGDSAAFGIISCDVRPGQRFVVRKRKRLDAISSFRSAFDVKEKGKKTGILEFTYQDIYPDRGM
AVLNEVASSYLRQNVEERNAEAQKTLEFLEKQLPDVKAQMDSSLMNLNAYRNRVGSVDVNAETQLVLQRRMKLQQDILAL
QQRKQEAIRLFHSEHPTVKTLEDQEDALKRELAGTASQVKKLPTTQQEVLKLTNEVEQSKILYTTMLNNIQQLRLVSAGE
VGSVRIVDFAEKALRPTKPKPKLIVAVALFLGFLFGTLIISLKTKFSSGVKSASFIEKETGFTVYAKVPKGNPQGTKGTR
PLAVVEPDDVAVESLRALRSSLEFSMMDDNGSVIGVSGLIPGVGKSFISVNLAALFAGLGKKVLLIDADLRKGRLHKEFG
IKRGNGLSQVLLREVQVEEVIHPTEVENMFVIPCGNVPANPAELLGSRHYSDLIERFKSEYDLVIVDTPPIMLVTDAALA
CRLAAQIVMVIEYNRHSIEAIQEGMGQILKGNSTAHASIVINKYEHSRTEGYGYKYGKY
>gnl|bykdb|A0A1M5J685 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWCM] (length=706 residues).
MDNNVSQNVAPKQEDDEIDILEILMFLKTKWKFLLVFLLLGLFAGGVAAMWMRPAYKSDILLQVDVKGNKSSKALGEMGA
LLDVSTPSEAEMQLIKSRMVLSSVVEEQRLCYSAVPLDKVDRLLHREGRMDLEFLSIPRAVSEAKIKIKARVLPDSTKFE
LLGEDDAVLLKGEVGETYRQPYAGDTLAICVRSMKARPGQTFLLGATHPQMAVAGLLGGLSVSEEGKNSGIIRVSMQHAY
PDRVADILNSIANTYLKQNIEMRSAEAKKTLDFLEEQLPSVKAKLDSSEQKLTSFRNANGTIDLSGETRVHLEKDVSLQQ
RLLELEQKKQEALRLFQAEHPTVRTIEQQQARLYGEIAKQKKAADKLPKTQQEFLSLQEEVEVNNKLYTNLLNNIQQLRV
VQAGEVGNVRIVDQAYVPIKPAKPNRKLIFGGVALAFLLLGCAIVLVRRMSHNGVASSTEVEQATGIGVYGKLPMLGKGT
ENNVLDPVVHEKPDEPFAEAVRALRTALEFSLFADGKKVLMVSGLIEGVGKSFVSTNLACSFAMSGKKVLLVDMDLRRGR
MFKKGHKGLCEMLRAEKFDDEYIEVVSENYHIIGSGKRVVNPGDLLNKNRFGTFLDTFRKKYDLIILDTPPVFQCSDALL
VEKYADYLLCVLKQSAHSMDNIQEALSTFDRSTETPLPKAFVFNKCERHSGYGYGGYYGYYGYKKY
>gnl|bykdb|A0A1M5LBR0 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWB8] (length=698 residues).
MATSKKEETDLGEFLKILVKNWQIMAPVMLLSAIIGVFVAMWARPIYQVDALLQIESKNSKPSGMMGSLGALFATSSPAE
TEMELIRSRQVMGSAVEKMRLDLVAEPLDKMDRLLHKEGRLELNNFNVPWDNVPKEERGMPWTVVAKDSLGNFELYDHNK
NLVLSGVAGQTYRFPYAGDTASFGIFRAVVREGQRFAVSKMKRLEAIEAFRSAFKVSEKGKKTGILEFSYQDIYPDRAVE
ILNEVASSYLRQNVEERNAEAQKTLEFLEKQLPDVKAQMDSSLLNLNTYRNRVGSVDINAETQLVLQQRMKLQQDILALQ
QRKQSAIRLFHAEHPSVKTLEEQENALKRELAGTSSAVKKLPATQQEVLKLQNEVELAKVMYTTMLNNIQQLRLVSAGEV
GSVRIIDFAEQVTKPTKPKKKIILCVALFLGFLLGAAIVSIKSKVSSGVKSANFIEKETGFTVYAKVPKGNPKGTKGTRP
LAVVEPDDVAVESLRALRSSLEFSMMDEGGSIVGVSGLIPGVGKSFVSVNLAALFAGLGKKVLLIDADLRKGRLHKEFGI
KRGNGLSQVLLREVEAESVVFPTEVENLFVIPCGNVPNNPAELLGSKHYAEVINKFKKEYDLVVIDTPPIMLVTDAALAC
HVASQIVMVIEYNKHSIDAIKDGMAQILKGNSSAHASIVINKYEHSRTEGYGYKYGKY
>gnl|bykdb|A0A1M5TLF1 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWH9] (length=718 residues).
MDNSQVNTKNGSNTGSAKNDDEIDLLEVLGILLKHKLFLFFCLVVGAVVGFLASNWVRPQYTSDALLQIDVKGNKAGKAM
GEMGALLDVASPAEAEIELLKSRMVLSYVVEQERLCFNAYPKGPMKRLTHKEGRMDLENLHIPEIAITEKWYALVTGQDE
FIVITPEDTELVKGRVGEPVSAPYAGDSLVIQVKALRAEPGQMFVLVESDPLAAVRELVKQLNVAERGKQTGIIGVSYTH
QYADRAASILNTIANIYLRQNVEMRSAEAEKTLEFLENQLPGVKAKLDSAEKKLADYRHKIGSVDLSGETRTHLEKEANL
EKQILELEQKRQEQTRLFKDEHPAVVTIVKQQDRLRAELARLKSSAAKMPLTQQEVISLQEEVAVNNAQYTSMLNNIQQL
RVVRAGEVGNVRIVDYAQIERKPSKPNKKLILIGCIAGFFLLGALLIYLLQMTKRGVRSSLEIERETGVSVYAKIPKSEN
SILSLRKKGKNTLPLVEEDPEDPASEAFRSLYTAIDFSVGEQKVIMVTGMIPGVGKSFVSKNLAALYAAAGKKTLLIDAD
MRRGVVYSHHKQGLGDVLSGRCTLESAVADSITKNLFVIGAGITDVSPSELLRGTKFKELLDSASETYDTIIVDTPPLNL
VTDSELIFPVVDFALFVLHYGRHSMEQIKEAMIKIERCGNKPHALVMNHCESDGHGYGHYGSYGSYGSYGSYKKKKKR
>gnl|bykdb|A0A1M5V3U1 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWCM] (length=707 residues).
MAEEVKNVQTEVDSLTVVDFVHHLWKKKFLVALFVVVATLIGSFYAMWVRPQFTSDALLQVNVKGTSSKATKAFGEMGAV
LDLASPADAEIELIKSRMVLSYVTMAEHLYLWTVPVGFWDRLLHREGRMDLDSLRIPLKVRAKKWMAEVTGKDSYSVISP
DGKKILDGVVGEVAFAEFADDTLSIRVNFMDAKQGQKFIIAQGSPINAERSLAGGLSVMEKGKQTGIIAVRYSHRYPDRA
ASILNTIAKTYLRQNVEMRSAEAEKTLEFLEAQLPGVKAKLDSAEKVLADYRYKIGSVDMTGETKAHLDKEGQLQRQIMQ
LEQERQAAMRLFKAEHPNVQTIVKQQNKLRVELAALKKNAEKMPLTQQEVKRLQEEVAVNNEVYTNMLNNIQQLRVVRAG
EVGNVRIVDFAQAEQSQTKPNKSRIIMASIVFGFIFGVLFVFLMYILRNGVKSTSRIERETGLSVFAKIPQSSHKFLRTN
KRVHHSAPFVLQNPEDKVSESFRSLQTALAFLMPNPEHCVILVMGLMPGVGKSFVSLNLAAVLAASGKKVLLIDADMRRG
VINGRSKFGLADVLAGIATLDTAVSQKHTDNLFVMNAGKTKLAACELLRGDAMDNLLKEARRKYDLVIVDTPPLNLVTDA
ELICPLVDYSLFVLHYGRHSIEEIKETIERVRRYSDKPSAIVMNHCEHEPGRYGYGYGYYGKGYYGK
>gnl|bykdb|A0A1M5VRV4 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWH9] (length=714 residues).
METNEQKATINLAGLLPQRAGDTITLIEAIGILWSKKFFIAAFMVVGALIGCLVMNWIRPEFTSDAMLQIDIRGNKATRA
MGEMGALLDMTSPADAEIELVKSRSVLAYVVEEEHLRFNAIPVGKMDRLLHREGRMDIDELDIPEIARRDRWTATVTGAN
SYAVITPEGAKLVEAEVGETVRAPYAGDTLVMRVRLIRAAVGQEFVLQQLKPLAAIRSLARKLSVSEKGKQTGILAVSLK
HRYADRSATILNAIANTYVRHNVEKRSAEAEKTLEFLEKQLPGVKAKLDTAEKILADYRHKIGSVDMTGETQVHLQKEVD
LQKQLLKLQQEYQEATRLFKDEHPAVRTIAKQQDKLKGELSKLKASAAKMPLTQQEVMRLQEDVQVNNAIYNTMLNNIQQ
LRVVRAGEVGNVRVVDYAMVEDRPSKPKKLNILICCVAASFMVAVLLVFLMRMLHNGVRSTTEVEKATSISVFAKIPERR
GKVMKARRRNLVPLVVSQPEDPASEAFRSLLTSVDFTVPSQTHPVIMVSGLIPGVGKSFVSSNLAALHATSGKRTLLIDA
DMRRGVHRSSCKMGLAEVLGGLCEFGVAVATSDIENLFVISAGHTKLSPSELLRGENFRSMLDEARKQFDVIIVDTPPMS
MVTDAELIYPAADFSLFVLHYGKHSMDEISEAMTKMNRFGEKPKAFVMNHCERETGRYGYGYGYGYYGYYSKKK
>gnl|bykdb|A0A1M6I669 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWP2] (length=700 residues).
MASAKKEETDLFDLAKDLVKNWYIVLPCLILSGIIGVIVALWIRPVYQVDALLQIESKSNKSMAGAMMGGLGSLFASSSP
AETEIELIKSRQIIGDAVDKMHLQYIATPTLKLQRLFHKEGRMELVQLEIPWDNLPEEERGKPWVAVVKDSLTFKLLDHN
KKLIVDNCHAGETYKIPYAGDTVTFSVLRMNVKKGQFFNLYKKNRLDAIDAFKSAFEIKEKGKKTGILEFTYQDIYPDRA
TEILNEIAATYLRQNVERSNAEAQKTLEFLEKQLPEVKSQMDSAMLRFNNYRNRVGSVDINAETRLVLEKRTKLQQDLLV
LQQKKQDAIRLFQPEHPTIKTYEEQENALKRELASNTSESKKLPATQQEVLKLSNEVELTKVMYTTMLNNIQQLKLVSAG
EVGSVRIIDFAEQVSRPTKPKKKMIVLIALFFGLLLGAAIVSIKSKFSNGVRDAHFIERETGYSVYAKVPKGNPKGTKGT
RPLAVVEPDDVAVESLRALRSSLEFSMDEGCRPVIGISGLIPSVGKSFISVNLAALFAGLGKKVLLIDADLRKGRLHKEF
GLKRGNGLSQYLLHETTLEDVIHSTEVENLFVIPCGHVPSNPSEILGSKHYSDMIDELEKHYDLIIVDTPPIMLVTDAAL
ACRQASQIVMVIEYNKHSIEAIQDGMAQLLKGNTNAHASFVINKYQHSHSDGFGYKYGKY
>gnl|bykdb|A0A1M6IQ57 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWP2] (length=713 residues).
MEQNTQQTISVAAVAQPQSGNTITLLEALAILWKNKFRLMLFVLFGAFIGAVVGFWIRPAFTSDALLQIDVRGSKKGNVM
SQAMGDMGALLDVTTPADAEIELLKSRMVLSYVVDEEHLAFSATPTSKLNRLLHREGRMDVDKLNIPAAARAEELTAVAT
GDNTYKVVNPQNTVLVQGKVGDVLKALYAGDTLVIRVKFLSAKVGEEFALRQGNPLSVVRALSKSIKASEKGKQSGIIAV
SYSHRYADRAAGILNTVLNTYVRQNVEMRSAEAEKTLEFLEEQLPGVKAKLDSAEKVLADYRHSIGSVDMTGETRAHLDK
EVNLQSQIIALEQERQKATRLFKEEHPSVQTIKKQQDKLRGELAKLKRSAEKMPLTQQEVMRLQEEVQVNNQVYTTMLNN
IQQLRVVRAGEVGNVRIVDAAQIEPIQSKPKKFNIFVCSIAASFMVGVLLVFVLRMFKNGVRGSTEIERETDMSVYAKIP
ESHHKHTRSKHKTSLVEAAPNDLASEAFRGLQTALDFSLGEGQNVVMVCGLVPGVGKSFVSKNLSAVYAMNGKRVLLIDA
DMRKGVIRSTKYAGLTDVLAGKVDWHDVVADCPCKGLFILGRGSVVMAPSELLRHDDFKKLLDEAKKEYDMVIVDTPPLS
LVTDSELIYPHVDFLLMVLHYGIHSMEQIKESINGLKRFADKPGAFVMNHCEHEPGHYGYGYGYYGKKYYGSK
>gnl|bykdb|A0A1M6R2N3 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWB12] (length=724 residues).
MTNTTENQMNQGPVTQGGINQNDVIDVFELFGIFRRHWFIFALLSFIGLVVGATYARYSRDVFRSTAMLQLDTKSRSGKA
IADIGELFESHSPAKSEIYLIKSLSVLMPVVEKMHLNYGAEPVGVMDRLMHREGRMDLDLFEPPRVFDEDDGNWVAEVKS
EDSYELFTPLGTSVVVGKVGETYRVHVEGDSVAICVRSMDALPGQKFVLHRLSVLRMAEILQKIVQADELGKNTNIIEIA
YQDRYPDRAAKVLNAVAQMYVRQNVEMRSAEAEKSLEFLEKQLPTIKAKLDSAQQLLTNYRNKVGTVDLGAEAQGTLKRQ
VDLKTQLLALEQEYQEKSRLFKQDHPAMQAILSQQGRIRKEISKEEGKVKALPVTQQDVLKLKQDVELNNELYTSILNNI
QQLRVVRASEIGNVRIVDPAYIHWKPVKPKRKMIVLAGLGGGFGFAWVLVLLLHRIRNRGVGSSSEIERETGVSVYAKVP
KTHISHKLPGVNDKRFILAKADSEDFAIEKLRALRTALEFSCIDEGGRVLMVTGISPEAGKSFVSLNLTYLFAKQNKRVI
FIDADLRKSRLSHKHEKGVSDVIAKSATLDSVVVDMGEGAYFLPKGSRVANPGEMLASKAFAELVQECREKYDIVVIDTP
PCSLVSDAQAIAKLADFGLIVVEYKKHSMENIQEIIDQLSMAKLEKKAIVLNKCVHDGSSYGYGYGYGYGYGYGYRYRYG
EKKK
>gnl|bykdb|A0A1M6RBQ2 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWEL] (length=715 residues).
MKDSITAPVTPTTINLTGIQNIKPKGNFSLVKAVDVLWKQRWLLLTFVLVGAAVGVFVGNWIRPQYSSDALLKLEVKSSK
SNKSSDVLDMLFAQGSPADAEIEMIKSRRVLSYVVDAEGLCYKANPIGLVDRLRHHEGRMDVQSLVLPTHIRDGWTAKIV
NDRSYVVYSPDGRSVMKGVVGKESSATYKGESVSILVSKISGVPGQRFDLEITSSLKAARSLANKLIIEERGKQTGIIGI
TYAHRYPDRAVSILNSLADVYLNQNIEMRSAEAAKTLQFLEEQLPGVKARLDSAEKKLADYRQSVGAVDLSVESQSLLKK
EQDLTRQISALEQKRQETTRLFKAEHPSVQAITRQLSKARSELNKLKNDAGKMPATQQEMLALQEQVATNNAQYTSMLNN
IQQLRTVRAGEVGTVTVVDYAVEDNEQIKPRKARIFFWSVGIFLFAGVMLVLLMRLFRNGVRNALEIERKTGVSVYAKVP
ESSNRDLKKKSRKGTLPLVCCCPEDPASEALRSVFTSVEFSAAAERPVIMVAGLVAGVGKSFVSRNLAALYANFGKKVLL
VDVDMRRGVVYSKHSQGLADILSGKMSFDECLSKTDVDNMWVIGAGKPEQAPTDLLHGETFADMLRYAKQNFDVIVLDTP
PINLVADTELVLPLVDFSLFVLHYGRHTMDEIDEAVTKVNRLSESPKAFVMNHCDRFMSSHYYYNGYSSYGFKKK
>gnl|bykdb|A0A1M6RGU5 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWOV1] (length=714 residues).
MAENEQQTIVVGAQAQSTNNTITLLEALFILWKKRFTLCLFLAAGALIGFVIGQWIRPQFTSDALLQIDVKGNKAANRAM
GEMGAILDVASPADAEIELIKSRLVLNYVVSEEHLNYSATPTSALNRLLHREGRMDLDYLFIPDMARTEKWRAVVTGDDT
YAVYNEDETRLVEGKVGQMLKVLYAGDTLQIRVSRMRATVGEEFRINMTNPLIAVRSLAAGLKVAEKGKQTGVIGVSFSH
RYADRAASILNTIANTYVRQNVEMRSAEAEKTLEFLESQLPGVKAKLDSSEKVLADYRHSIGSVDMTGETQAHLNKEVDL
QRQLLHLEQERQQATRLFKEEHPSVQTIVKQQNRLRGELARLKKTAESMPVTQQEMIRLQEEVSVNNAQYTAMLNNIQQL
RVVRAGEVGNVRIVDFAQVEPIQSKPKKFNILICSMAAAFMLGVLWVFMLRMMHNGVRSSQELEHATEVSVFAKIPESRN
RLLRDKRHKLTLVEASPNDQASEAFRTLQTAVDFSLTEGQKVLMICGLMPGVGKSFVSKNLAAVYAMNGKRVLLIDADMR
KGVIRSSKYLGLAEVLSGKIPWRETVAESRCQNLFVMGCGKRLMSPSELLRHDLFKTLLEEMKSEYDMILVDTPPVSMVT
DAELIFPLVDFALMVVHYGTDSVAQIKENLANLRRYADKPCAFVMNHCEYEPGHYYGYGYYGKGYYGKGYFSKS
>gnl|bykdb|A0A1M6RVC1 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWH6] (length=699 residues).
MASKKKEETDLTELLKDVAKNWYIMLPCLVVAGIVGVFVSLWIRPVYQVDALLQIESKNSKNSMGMMGGLGALFSNASPA
ETEIELIRSRQVMGAAVEKMRLQYEAEPLNFLDRLLHREGRLDLAQIEVPWDSVPKTDKIKEWEVEIKDSTGRFDLYDHL
DKVVLSGEPGHTYKFPYAGDSAAFGIISCDVRPGQRFVVRKRKRLDAISSFRSAFDVKEKGKKTGILEFTYQDIYPDRGM
AVLNEVASSYLRQNVEERNAEAQKTLEFLEKQLPDVKAQMDSSLMNLNAYRNRVGSVDVNAETQLVLQRRMKLQQDILAL
QQRKQEAIRLFHSEHPTVKTLEDQEDALKRELAGTASQVKKLPTTQQEVLKLTNEVEQSKILYTTMLNNIQQLRLVSAGE
VGSVRIVDFAEKALRPTKPKPKLIVAVALFLGFLFGTLIISLKTKFSSGVKSASFIEKETGFTVYAKVPKGNPQGTKGTR
PLAVVEPDDVAVESLRALRSSLEFSMMDDNGSVIGVSGLIPGVGKSFISVNLAALFAGLGKKVLLIDADLRKGRLHKEFG
IKRGNGLSQVLLREVQVEEVIHPTEVENMFVIPCGNVPANPAELLGSRHYADLIERFKSEYDLVIVDTPPIMLVTDAALA
CRLAAQIVMVIEYNRHSIEAIQEGMSQILKGNSTAHASIVINKYEHSRTEGYGYKYGKY
>gnl|bykdb|A0A1M6S079 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWEL] (length=712 residues).
MDINEKNASANQTALPAQKGDDSIDLLEVLGILWSKKFTILSFLFMGGVIGFLLMNWVRPEYTSDAMIQVDIRGNKVSRA
MGEMGALLDMASPSDAEIELVKSRSVLAYVVEEEHLRFNATPIGKMDRLLHREGRMDIDELDIPQIARKERWIAQITGIN
SYEVITPEGAVLAKAEIGETIRAPYAGDTLVMRVRLMRGIEGQQFILRQLTPLSAIRGLASKLSVAEKGKQTGIIAVSLK
HRYADRSAAILNTIADTYVRRNVEKRSAEAEKTLEFLEKQLPGVRAKLDTAERILADYRHKIGSVDMTGETQVHLQKEVD
LQKQLLRLEQERQEATRLFKEEHPSVQTLTKQQDKLRRELAKLKSSAEKMPLTQQEVMRLQEDVQVNNAIYNTMLNNIEQ
LRVVRAGEVGNVRVVDYAMVEDRPSKPKKMRILLGAIAASFVLASLLIYLLRMLHNGVRSSNDVENTTGVSVYAKIPEHH
GKTSKSKKRIPVVISEPEDRVSESFRSLLTSVDFSMTSLSHPVLMISGLIPGGGKSFVSLNLAALYAESGKRTLLIDADM
RRGVHHSGCKMGLAELLSGTCELGAVAVQSNVENMYVVSAGHSRLSPSELLRGENFTKLMDVARKQFDIIIVDTPPMSMV
TDAELIYPVVDFSLFVLHYGKHNMNEIKESVAKMNRFGDKPKAFVMNHCEREAGRYGYGYGYGYYGYYSKNK
>gnl|bykdb|A0A1M6SHG3 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWEL] (length=720 residues).
MMDLNSQNNVQNVTQVATAKDDEIDLLEVLGILLKHKVFLVFCIMVGCCVGFLASNWARPQYTSDALLQIDVKGNKAGKA
MGEMGALLDVASPAEAEIELLKSRMVLSYVVNQEHLCFNAYPKDPIKRLTHKEGRMDLEELHIPEIAITDKWLAKTIDDT
TYAIITPEETELARGVIGQPLVASYAGDSLTILVKRMRAEPGQVFVLVQTDPLDAMRGLVKKLNVAEKGKQTGIIGVSFT
HQYPDRAAAILNSIANVYLRQNVEMRSAEAEKTLEFLEQQLPGVKAKLDSAEKNLADYRHKIGSVDMTGETRAHLEKDAA
LQRQILELEQQRQETTRLFKEEHPSVQTIVKQQNRLRAELSKLKNSAEKMPLTQQEVLRLQEEVAVQNAQYTSMLNNIQQ
LRVVRAGEVGTVRVVDYAQIERLPSKPNKKMIFLGCVAGAFLLGALLIYLLQMTKRGVRSSLEIERETGVSVYAKIPESD
NSLLSRRKKGKNTLPLVDESPDDPASEAFRSLYTAIDFSIADQKVIMVTGMVPGVGKSFVSKNLTALYASNGKKVLLIDA
DMRRGVVYSKHREGLGDVLSGKASLDAVVSESLVKNMYTLGAGNSEVAPSELLRGDNFKKLLEDAKTKFDMIVVDTPPLN
LVTDSELIYPVVDFALFVLHYGRHSMDQIKESMIKVDRCGDKPHAFVMNHVEHDGRGYGYGYGGHGYGKYGYYSNKKKKK
>gnl|bykdb|A0A1M6UBQ0 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWH4] (length=719 residues).
MTVTPNNNQPNTQLPFFMPIKAGDSFDLFSNVLHHWKLVAFLSIVGLMAGTVFSRYVRDSFDNKTMLQLDTKSKSGKAVS
DIGDLFDVQSPAVAEIHLIKSLSVLMPVVEQLRLNYMAEPQGVVDRLMRREGRMDLELFEPPRMDEELVKKGKKWIAVIQ
SEDSYELFSPMGQSLVVGKVGETYRIPMDADTVAICVKAINAEPGQSFSLSRASVLSVAEGLQASINAYEKEKNSNILEI
SYSDRYPDRVAEVLNAIAQTYVRQNVEMRSAEAEKSLDFLEEQLPSIKAKLDSSERLLTNYRNKMGTVDLGAEAKGTLER
QVELKTQLLSLQQQYHEKARLFKEDHPAMQAILQQQQRLSHEIGKEESKTKKLPITQQDVLKLQQDVEINNQLYTSVLNN
IQQLRVVRASEIGNVRIVDPAYIHVKPSKPNRKKIMAAGFGGGFALSLVLIYLLHTLSNRGVGSSSEIERETGVSVYAKI
PKTQISHKLPGASDKRFILAKADSEDLAVEKIRALRTALEFSFLDEGGKVLMVTGIAPGAGKSFVSLNLAYLFAQQGKRS
IFIDADLRKSRLSHKHEKGITDVIAKGCDLEKALIDIGDGAYFLPMGSRVANPGEMLGSKAFAELVQECKSKFDVVIIDT
PPIALVSDALAIAKLADFGLIVIEYKKHSMENIQETIEQLNIAKLDKKAIVLNHCIHDSGAYGYGYGYGYGYRYRYRDK
>gnl|bykdb|A0A1M6UFW9 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWH4] (length=698 residues).
MATKKKEDTDLGELLKELAKNWPIMVPIMLLAGIIGVFVAMWVRPVYQVDALLQIESKNSKPSGMMGSLGALFATSSPAE
TEMELIKSRQVMGAAVEKMRLDLVADPQSKLDRLMHKEGRLELSNFNVPWNNVPKEKRNLPWTVVAKDSLGNFELFDQDK
KLVLTGSAGQTYHFTYAGDTASFGIFRAEVRPGQTFSVYKLKRLDAIEKFRGAFNVSEKGKKTGILEFSYQDIYPDRGVE
ILNEVASSYLRQNVEERNAEAQKTLEFLEKQLPDVKAQMDSSLMNLNTYRNRVGSVDINAETQLVLQRRMKLQQDILALQ
QRKQEAIRLFHSEHPTVKTLEDQEDALRRELAGTSSEVKKLPATQQEVLKLQNQVELTKVMYTTMLNNIQQLRLVSAGEV
GSVRIIDFAEQVTVPTKPKKKVILCVALFLGFLLGATIVSIKSKFSSGVKSANFIEKETGFTVYAKVPKGNPKGTKGTRP
LAVVEPDDVAVESLRALRSSLEFSMMDEGGSIIGVSGLIPGVGKSFISVNLAALFAGLGKKVLLIDADLRKGRLHKEFGI
KRGDGLSQILLRKVEPEDVIFPTEVENLFVIPCGNVPANPAELLGSKHYSEIINKFKQEYDLVIVDTPPIMLVTDAALAC
HVADQIVMVIEFNKHSIEAIKDGMSQILKGNPQAHASIVINKYEHSRTEGYGYKYGKY
>gnl|bykdb|A0A1M6V3G7 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWB12] (length=698 residues).
MAASSKKEETDLFDLLKEFVKNWKIMVPCIILAGIIGVFVAMWIRPVYKVDALLQIESKNNKSVGLMGGLPSLFASASPA
ETEIELIYSRQIIGEAVEKLRLQYTATPINKMDRLLHHEGRMELSQFEVPWKSIPKDEKRGPWIATAVDSTSFDLYDHNN
NKILTGTVGQTYRVPYAGDTLIFSVFHMDATAGQKFKLNKLERLDAIAKFKKAFEVKEKSRKTGILEFSYQDIYPDRATK
ILNEIATSYLRQNVEQRNAEAQKTLEFLEKQLPDVKAQMDSSLLKFNTYRNKVGSIDIGAETQLILEKRNKLQQSLLDLQ
QKKQSAVRLFQPEHPTIKTLEDQESNLKRELASNYAATKKLPNTQQEVLKLTNEVDMSKHMYTTMLNNIQQLKLVSAGEV
GSVRIIDFAEEVSSPIKPKKSMIVCVALFIGLLFGTLIISIKSKFNNGVRDANFIERETGFSVYAKVPKGNPNGTKGTRP
LAVVEPDDVAIESLRALRSSLEFSMEDESKSIIGVSGLIPGVGKSFISVNLAALFAGLGKRVLLIDADLRKGRLHKEFGI
KRDKGLSQILLHTATPAEVISKTEVPNLEVMQCGNVPSNPSELLGSKHYAAMIEELKKQYDLIIIDTPPIMLVTDAALAC
RVVSEIVMVIEYNRHSIDAIKDGMKQLLKGNNDVHASLVINKYEHGHSDGYGYKYGKY
>gnl|bykdb|A0A1M6VST0 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWT2] (length=713 residues).
MADSEQQTIVVGAQAQTPNNTITLLEALFILWKRRYLLCLFLLVGAAIGVVVGQWIRPQYTSDALFQIDIKGNKSARALG
EMGSLLEVASPADAEIELIKSRLVLNYVVDQEHLMYSATPQGALNRLLHREGRMDIDFLDIPELARADRWEAVVTGENTY
AIYTPEETKLVEGKVGDLLSAPYAGDTLRMRVKLMRATLGEKFVIKQGNPLLAVRGLAGSLKVAEKGKQTGVIGISYSHR
YADRAASILNTIANTYVRQNVEMRSAEAEKTLEFLETRLPGIKATLDSSEKVLSDYRHSVGSVDMTGETRAHLDKEVDLQ
RQLLQLEQQRQEATRLFKEEHPSVQTIVKQQDKLRGELARLKKSAESMPVTQQEMIRLQEDVSLNNAQYTAMLNNIQQLR
VVRAGEVGNVRVVDFAQIEPIQSKPKKFNILVCSMAASFMVGVLLVFLLRMMRNGIRSSQELEHATNVSVFAKIPESKNR
LVKDKRRKLTLVESSPNDQASEAFRTLQTALDFSLEAGQKVVMTCGLMPGVGKSFVAKNLAAVYAMNGKRVLLIDADMRK
GVIRSSKYIGLTEVLSGKVEWHEAVADARCENLFVMGCGKRLMSPSELLRHDKFKTLLEDLKQEYDMIIVDTPPVSMVTD
AELIYPLVDFTLMVVHYGADSLEQIKENLANLRRYADKPCAFVLNHCEYEPGHYYGYGYYGKGYYGKGYFSKS
>gnl|bykdb|A0A1M6VSY0 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWOS] (length=717 residues).
MAENENTMNAPVSAAPKDDEISILEVCGILWEKKFFLLFCLILGAVVGVLAAYWIRPQYTSDALLQIDVSGSASAKALGD
MGALLESSSPADAEIELIKSRMVLNDVVEHEKLCYSATPIGKMNRLLHREGRMDLDSLYIPEFARTEEWKAVVLSPDSFA
VLDPEEKQVLRGEVRKLLVAPYAGDTLAIRVSLLRAEAGEEFALAQSSPLNVARALATGLEIAEKGKKTGILTMNFSHRY
PDRAAAILNAVANAYFRQNVEMRSAEAEKTLAFLEEQLPAVKAKLDTSEKVLADYRFQVGSVDMTGETHALLEKETNLQK
QLLELGAERQRLVRLFTEEHPNVQTIVAQQQRIQNELNRLKKNAEKMPKTQQEILRLQADLSVNNTVYLDMLNKIQQFRV
VRAGAIGNVRIVDYAQVETKPSKPKKTMIVLGSVAGGFVLGVLIIFFLRALSPRGVRSSVELERETGEVVLAKIPRTFSR
VLTNRRRSGEGNPILVLEDPDDPASENIRSLLTAVEFGMLSKTNNVIMVTGIDKGIGKSFISLNFAAAMANAGKKVLLID
ADMRRGKLIRKRRKGLVEVLLGKESLDSMVTLYDNVENLYVLSTGILNVTASELLRGQAFANLVAEAREKYDVVLIDTPP
VALATDAELMANLASLVLFVIKYNTHSMEEIQEMLKRLKRYLNGQIALVMNSCMRERGYGYGYYGGYGGGYSRYEKY
>gnl|bykdb|A0A1M6VYU0 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWT2] (length=719 residues).
MEPNNQYNSMGSSSPAKHKEDDEIDILEVLGLLLKHKFFLACCIAVGCAVGFLASNFMRPQYTSDALLQIDVKGNKAGKA
MGEMGALLDVASPAEAEIELLKSRMVLNYVVEKEHLCFNAYPKGIIDRLLHTEGRMDLEDLYIPEIARDEKWMAHVVGED
EIAVFTPEGVKLLQGKVGEALSAPYGGDTLRIHVKHLLARPGQVFAIVQSEPLDAVRGLVKQLDVSERGKQTGIIGVSYT
NRYADKAASVLNTIANIYLRQNVEMRSAEAEKTLEFLEEQLPGVKAKLDTAEKNLADYRLKIGSVDMTGETRVHLEKVSE
LEKQVLELEQQRQEATRLFKEEHPSVQTIVQQQNRLRAELSRLKKSAENMPKTQQDVRSLQEEVAVNNAQYTAMLNNIQQ
LRVVRAGEVGNVRIVDYAQIERRPSKPNKKVVFAGCVGGSFLLGALLLYLLQMTKRGVRSSLEIERETGISVYAKIPKAE
NAILLKRNKGKNTKPLVEDDPDSPSSEALRSLYTAIEFATNDLRVMMVTGMIPGVGKSFVSKNVSALFAGSGKKTLLIDA
DMRRGVVYSHRKQGLGDVLEGKCSLDNAVADSITKNLYVLGAGKTDVSPSELLRGETFKNLLEEAKSKFDIIIVDTPPLE
LVTDSELIYPIVDFALSVLHYGKHTMDQIKESMMKLDRCCEGKARAFVMNHCESDGHGYGYGSYGYGKYGYYGKDKKKK
>gnl|bykdb|A0A1M6WDT9 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWEL] (length=698 residues).
MASPKKKEDIDILDLIKTQLKNWYIILPCVILAGIIGVVVSMWIRPIYKVDALLQIESKNNKSMGVMGGLTNLFATSTPA
ETEIELINSRQILGDAVEKMHLQYSANPKNVLDRLLQKEGRMDINQFEVPWDKLPADEKTGPWVAITKDSLSFDLYDHKG
AFVLTGVPGQTYKVPYAGDSVTFSVFKMKVKANQKFEINKSERLDAIDAFRGAFEVKERGKKTGILEFSYKDIYPDRATE
ILNEVASSYLQQNVEQRNAEAQKTLEFLEKQLPEIKARMDSSLLKYNTYRNKVGSVDINAETRIVLERRTKLQQDLLALQ
QKKQDAVRLFQPEHPTVKTLEDQEAALKRELYSNSSEAKKLPATQQEVLKMTNEVDISKVMYTSMLNNIQQLKLVSAGEV
GSVRIIDFAEQVTQPAKPNKKMIIVAFLFMGLLLGCAIVTIKSKFSNGVRDAHFIERETGFSVYAKIPKGNPNGTKGTRP
LAVVEPDDVAVESLRTLRSSLEFSMEDGARQIIGVSGLIPGVGKSFVSVNLAALCAGLGKKVILIDADLRKGRLHKEFGI
KRGNGISQVLLHEAEINDVIHATEVENLFVMPCGNSPSNPSELLGSKHYTNLIEELEKQFDLIIVDTPPIMLVTDASLAC
KVASQIVMVIEYNKHSIDAIQDGMKQLLKGSPDAHASFVINKYEHSHSDGYGYKYGKY
>gnl|bykdb|A0A1M6WJF1 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWH4] (length=721 residues).
MEPNSQYSSSTSSSASHNKDDDEIDLLEVLGILLKHKLFLSVCIVFGCIVGFLVSNWMTPQYTSDALLQIDVKGNKAGKA
MGEMGALLDVASPAEAEIELLKSRMVLSFVVEQEHLCFNAYPVGVLDRLLHKQGRMDIENLYIPEIARIEKWTAEVVSEN
EIAVYTPEGVKLLQGPVGERLTAAYGGDTLVIQVKRLLATPGQKFVIAQSEPLDAVRGLVKSLDVAEKGKQTGIIGVSYT
NRYADKAASVLNSIANIYLRQNVEMRSAEAEKTLEFLEAQLPGVKAKLDTAEKALADYRLKIGSVDMSGETRSHLEKVAE
LEKQILELDQQRQEATRLFKEEHPAVQTIMQQQGRLRSELSRLKKSAENMPRTQQDVLSLQEEVAVNNAQYTAMLNNIQQ
LRVVRAGEVGNVRIVDYAQIEREPSKPNKKVIFAGCVGGCFLLGALLIYLLQMTKRGVRSSLEIERETGISVYAKIPKAE
NAILSKRNKGKYTKPLVEDDPESPSSEALRSLYTAIEFATTDLRVMMVTGMIPGVGKSFVSKNIAALFAGSGKKTLLIDA
DMRRGVIYSHRKQGLGDVLSGHCSLDSAIADSITKNLFVLGAGKTDVSPSELLRGDTFKNLLEEAKSKYDIVIVDTPPLE
LVTDSELIYPIVDFALFVLHYGKHSMDQIKESMMKLDRCCEGKSRAFVMNHCEHEGHGYGYGGYGYYGKYGYYNKDKKKK
S
>gnl|bykdb|A0A1M6WR43 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWH6] (length=714 residues).
METNEQKATINLAGLLPQRAGDTITLIEAIGILWSKKFFIAAFMVVGALIGCLVMNWIRPEFTSDAMLQIDIRGNKATRA
MGEMGALLDMTSPADAEIELVKSRSVLAYVVEEEHLRFNAIPVGKMDRLLHREGRMDIDELDIPEIARRDRWTATVTGAN
SYAVITPEGAKLVEAEVGETVRAPYAGDTLVMRVRLIRAAVGQEFVLQQLKPLAAIRSLARKLSVSEKGKQTGILAVSLK
HRYADRSATILNAIANTYVRHNVEKRSAEAEKTLEFLEKQLPGVKAKLDTAEKILADYRHKIGSVDMTGETQVHLQKEVD
LQKQLLKLQQEYQEATRLFKDEHPAVRTIAKQQDKLKGELSKLKASAAKMPLTQQEVMRLQEDVQVNNAIYNTMLNNIQQ
LRVVRAGEVGNVRVVDYAMVEDRPSKPKKLNILICCVAASFMVAVLLVFLMRMLHNGVRSTTEVEKATSISVFAKIPERR
GKVMKARRRNLVPLVVSQPEDPASEAFRSLLTSVDFTVPSQTHPVIMVSGLIPGVGKSFVSSNLAALHATSGKRTLLIDA
DMRRGVHRSSSKMGLAEVLGGLCEFGVAVATSDIENLFVISAGHTKLSPSELLRGENFRSMLDEARKQFDVIIVDTPPMS
MVTDAELIYPAADFSLFVLHYGKHSMDEISEAMTKMKRFGEKPKAFVMNHCERETGRYGYGYGYGYYGYYSKKK
>gnl|bykdb|A0A1M6X012 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWH6] (length=718 residues).
MDNSQVNTKNGSNTGSAKNDDEIDLLEVLGILLKHKLFLFFCLVVGTVVGFLASNWVRPQYTSDALLQIDVKGNKAGKAM
GEMGALLDVASPAEAEIELLKSRMVLSYVVEQERLCFNAYPKGPMKRLTHKEGRMDLENLHIPEIAITEKWYALVTGQDE
FIVITPEDTELVKGRVGEPVSAPYAGDSLVIQVKALRAEPGQMFVLVESDPLAAVRELVKQLNVAERGKQTGIIGVSYTH
QYADRAASILNTIANIYLRQNVEMRSAEAEKTLEFLENQLPGVKAKLDSAEKKLADYRHKIGSVDLSGETRTHLEKEANL
EKQILELEQKRQEQTRLFKDEHPAVVTIVKQQDRLRAELARLKSSAAKMPLTQQEVISLQEEVAVNNAQYTSMLNNIQQL
RVVRAGEVGNVRIVDYAQIERKPSKPNKKLILIGCIAGFFLLGALLIYLLQMTKRGVRSSLEIERETGVSVYAKIPKSEN
SILSLRKKGKNTLPLVEEDPEDPASEAFRSLYTAIDFSVGEQKVIMVTGMIPGVGKSFVSKNLAALYAAAGKKTLLIDAD
MRRGVVYSHHKQGLGDVLSGRCTLESAVADSITKNLFVIGAGITDVSPSELLRGTKFKELLDSASETYDTIIVDTPPLNL
VTDSELIFPVVDFALFVLHYGRHSMEQIKEAMIKIERCGNKPHALVMNHCESDGHGYGHYGSYGSYGSYGSYKKKKKR
>gnl|bykdb|A0A1M6Z6I9 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWOV1] (length=719 residues).
MELNNQYNSIGSTSSANHKDEDEIDILEVLGLLLKHKLFLAFCIVLGCAAGFLASNWMRPQFTSDALLQIDVKGNKAGKA
MGEMGALLDVASPAEAEIELLKSRMVLNYVVEQERLCFNAYPKGAIDRLLHQEGRMDLEDLYIPEIARIEKWTAEVVGDN
EFAVYTPEGVKLLQGKVGESLSAPYGGDTLRVHVKHLLARPGQRFVLVQSEPLDAVRALVKKLDVAEKGKQTGIIGVSYT
DRYADKAASVLNTIANIYLRQNVEMRSAEAEKTLEFLEEQLPGVKAKLDTAEKKLADYRLKIGSVDMTGETRVHLEKVTE
LEKQVLELEQQRQEATRLFKEEHPAVQTIMQQQSRLRSELSRLKKSAENMPRTQQDVMSLQEEVAVNNAQYTAMLNNIQQ
LRVVRAGEVGNVRIVDYAQIERKPSKPNKKVIFAGCVGGAFLLGALLIYLLQMTKRGVRSSLEIERETGISVYAKIPKAE
NAILLKRNKGKNTKPLVEDDPDSPSSEALRSLYTAIEFATNDLRVMMVTGMIPGVGKSFVSKNVSALFAGSGKKTLLIDA
DMRRGVVYSHRKQGLGDVLEGKCSLDNAVADSITKNLYVLGAGKTDVSPSELLRGETFKNLLEEAKSKFDIIIVDTPPLE
LVTDSELIYPIVDFALFVLHYGKHSMDQIKESMMKLDRCCEGKPRAFVMNHCESDGHGYGYGSYGYGKYSYYGKDKKKK
>gnl|bykdb|A0A1M7CD42 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWOV1] (length=698 residues).
MATKKKEETDLGEFLKELAKNWYIMVPCILLAGAVGAFVAQWIRPVFQVDALLQIEAKNNKSAGLVGGLGNLFATNSPAE
TEMELIKSRQVMGSAVEKMRLDLVAEPLNKLDRLLHKEGRVDLMNFSYNKDLLPSDFRDEPWFLEMKDSLGNFDLYDYKD
SLVLSGAVGQTYHFAYAGDSAAFGIFKAEVREGQRFAVSKLKRLDAIEQFRSAFDVKEKGKKTGILEFSYQDIYADRAVE
ILNEVASSYLRQNVEERNAEAQKTLEFLEKQLPDVKAQMDSSLLNLNTYRNQVGSVDINAETQLVLQRRMRLQQDILSLQ
QKKQEAIRLFHSEHPTVKTLEDQENALRRELAGTSSEVKKLPATQQEVLKLQNEVELTKVMYTSLLNNIQQLRLVSAGEV
GSVRVVDFAEQVTKPAKPKKRVILCMALFLGFLLGAMLVSIKSKFSSGVKSASFIEKETGYTVYAKVPKGNPKGTKGTRP
LAVVEPDDVAVESLRALRSSLEFSMMDEGGSVVGVSGLIPGVGKSFVSVNLAALFAGLGKSVLLIDADLRKGRLHKEFGI
KRGNGLSQVLLREVKAEDVIHKTEVENLYVMPCGNVPNNPAELLGSKHYAELIEQFKKDYDLVIVDTPPIMLVTDAALAC
RVAAQIVMVIEYNKHSIEAIKDGMAQILKGNSSAHASIVINKYEHSRTEGYGYKYGKY
>gnl|bykdb|A0A1M7DAK0 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWH4] (length=712 residues).
MIIEKETKSNSSNSTHISGSAITMMEFLMLLWRKKFIILLFVVLATIFGACYAMWVRPSFTSDVLLQVNTKGASSKSTKA
LGEMGAVLDLASPADAEIELIKSRMVLNYVVSVEHLHLKAIPIGFWDRFTHSEGRLDLDSLIIPEKARNGKWTAIVKSDE
SYSVVAPDGKEVLNGKVGHVYKTKYAEDSLTIRVSYMDAKVGQRFKLLQGSLLKTEQILMRSLNVNERGKQTGIISVRYS
HRYPDRAASILNTIAKTYLRQNVEMRSAEAEKTLEFLEGQLPAVKAKLDSAEKILADYRYSIGSVDMTGETKAHLDKEGQ
LQRQIMQLEQERQAALRLFKEEHPNVQTIVKQQSKLRAELAALKKNAEKMPLTQQEVKRLQEEVAVNNEVYTNMLNNIQQ
LRVVRAGEVGNVRIVDFAQIEQSQSKPNKSRIVLVSAVAGFMLGVLFVLLTYLLRNGVKSASEIERETGLSVFAKIPQSR
NRLLRGHRHLHHGAPFVLQNIDNGVCEAFRALQTALTFLMPNPEHCVLLVMGLNPGAGKSFVSLNLAATMATSGKKVLLI
DADMRRGVIHSGSKFGLADVLLGLATLDTAVVSKHDDNLFVMNAGKTKLAACELLRGDAMDKLFKEARQKFDMVIVDTPP
LNLVTDAELICPLVDYSLFVLHYGRHSIEEIKETIDRVKRYSDKPAAIVMNHCEQEPGRYGYGYYGKGYKSK
>gnl|bykdb|A0A1M7DJN3 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWT2] (length=698 residues).
MATSKKEETDLGEFLKILVKNWQIMAPVMLLSAIIGVFVAMWARPIYQVDALLQIESKNSKPSGMMGSLGALFATSSPAE
TEMELIRSRQVMGSAVEKMRLDLVAEPLDKMDRLLHKEGRLELNNFNVPWDNVPKEERGMPWTVVAKDSLGNFELYDHNK
NLVLSGAAGQTYRFPYAGDTASFGIFRAVVREGQRFAVSKMKRLEAIEAFRSAFKVSEKGKKTGILEFSYQDIYPDRAVE
ILNEVASSYLRQNVEERNAEAQKTLEFLEKQLPDVKAQMDSSLLNLNTYRNRVGSVDINAETQLVLQQRMKLQQDILALQ
QRKQSAIRLFHAEHPSVKTLEEQENALKRELAGTSSAVKKLPATQQEVLKLQNEVELAKVMYTTMLNNIQQLRLVSAGEV
GSVRIIDFAEQVTKPTKPKKKIILCVALFLGFLLGAAIVSIKSKVSSGVKSANFIEKETGFTVYAKVPKGNPKGTKGTRP
LAVVEPDDVAVESLRALRSSLEFSMMDEGGSIVGVSGLIPGVGKSFVSVNLAALFAGLGKKVLLIDADLRKGRLHKEFGI
KRGNGLSQVLLREVEAESVVFPTEVENLFVIPCGNVPNNPAELLGSKHYAEVINKFKKEYDLVVIDTPPIMLVTDAALAC
HVASQIVMVIEYNKHSIDAIKDGMAQILKGNSSAHASIVINKYEHSRTEGYGYKYGKY
>gnl|bykdb|A0A1M7GQ27 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWB7] (length=697 residues).
MASAKKEETDLWDLLKDLAKNWKIMVPCIFVAGIIGVFIAFWIRPVYKVDALLQIESKSNKSVGMMGGLPSLFASSSPAE
TEIELIKSRHIIGEAVEKMHLQYTATPVNSLDRLLHREGRMEISRFEVPWTLIPKNEKIVPWIAEATDSTTFNLYDHNNK
LVLSGSVGNTYHFPYAGDTAVFCVHRMEATAGQKFELQELNRLDAIAAFKKAFEIKEKGKKTGILEFSYQDIYPDRATQI
LNEIATSYLRQNVEQRNAEAQKTLEFLEKQLPAVKEQMDSSLLKFNTYRNKVGSVDIGAETQIILEKRNVLQQKLLDLQQ
KKQSAIRLFQPEHPTIKTLEEQENNLKRELANNTAATKRLPNTQQEVLKLTNEVDMSKHMYTTMLNNIQQLKLVSAGEVG
SVRIIDFAEEVSRPMKPKKSMIIFAMLFLGLLTGATFVTLRSKFSNGVRDANFIERETGFSVYAKVPKGNPNGTKGTRPL
AVVEPDDVAVESIRALRSSLEFSMEEGSSPTIGVSGLIPGVGKSFISVNLAALYAGLGKKVLLIDADLRKGRLHKEFGIK
RGKGLSQILLGEATVDEVIHNTEVDNLFIMQCGTVPPNPSELLGSKHYASMISELEKSYDLIIVDTPPIMLVTDAALACR
VVSQIVMVIEYNKHSIDAIKDGMTQLLKGNSNAHASFVINKYEHGHSDGYGYKYGKY
>gnl|bykdb|A0A1M7HDE6 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWR3] (length=701 residues).
MASSAKKEETDLFDLLKDLAKNWQIMLPCLILSGVVGVFVAMWIRPIYQVDALLQIESKNNKGMASAMMGSLGSLFASSS
PAETEIELIKSRQIIGDAVDKMRLLYVATPTRKLQRLLHKEGRMELNQLEIPWDNLPEEERGGAWTAVANDSLSFELYDH
NNKKVMSNCHAGETYRIPYAGDTATFSVLKMDIKKGQRFSLYKMNRLDAIDAFKSAFDIKEKGKKTGILEFSYQDIYPDR
ATEILNEIANAYLRQNVERSNAEAQKTLEFLEKQLPEVKAQMDSAMLRFNSYRNRVGSVDINAETRLVLERRNKLQQDLL
NLQQKKQDAIRLFQPEHPTIKTYEEQEATIKRELAHNTSESKKLPATQQEVLKLNNEVDLTKIMYTTMLNNIQQLKLVSA
GEVGTVRIIDYAEQVRKPTKPKKKIILCVALFLGFLFGAALVSIKSKFSNGVRDPNFIEKETGFSVYAKIPKGNPNGTKG
TRPLAVVEPDDVAVESLRALRSSLEFSMDEGCRPIIGVSGLIPGVGKSFISVNLAALFAGLGKKVLLIDADLRKGRLHKE
FGIKRGNGLSQLLMRNAELADVIHSTEVENLFVMPCGNVPSNPSELLGSKHYTELISNLEKEYDMIIIDTPPIMLVTDAT
LACRYASQLVMVIEYNKHSIDAIKDGMAQLLKGNGDAHASIVINKYEHSHSDGYGYKYGKY
>gnl|bykdb|A0A1M7JMJ6 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWR3] (length=706 residues).
MDNNVSQNVAPKQEDDEIDILEILMFLKTKWKFLLVFLLLGLFAGGVAAMWMRPAYKSDILLQVDVKGNKSSKALGEMGA
LLDVSTPSEAEMQLIKSRMVLSSVVEEQRLCYSAVPLDKVDRLLHREGRMDLEFLSIPRAVSEAKIKIKARVLPDSTKFE
LLGEDDAVLLKGEVGETYRQPYAGDTLAICVRSMKARPGQTFLLGATHPQMAVAGLLGGLSVSEEGKNSGIIRVSMQHAY
PDRVADILNSIANTYLKQNIEMRSAEAKKTLDFLEEQLPSVKAKLDSSEQKLTSFRNANGTIDLSGETRVHLEKDVSLQQ
RLLELEQKKQEALRLFQAEHPTVRTIEQQQARLYGEIAKQKKAADKLPKTQQEFLSLQEEVEVNNKLYTNLLNNIQQLRV
VQAGEVGNVRIVDQAYVPIKPAKPNRKLIFGGVALAFLLLGCAIVLVRRMSHNGVASSTEVEQATGIGVYGKLPMLGKGT
ENNVLDPVVHEKPDEPFAEAVRALRTALEFSLFADGKKVLMVSGLIEGVGKSFVSTNLACSFAMSGKKVLLVDMDLRRGR
MFKKGHKGLCEMLRAEKFDDEYIEMVSENYHIIGSGKRVVNPGDLLNKNRFGTFLDTFRKKYDLIILDTPPVFQCSDALL
VEKYADYLLCVLKQSAHSMDNIQEALSTFDRSTETPLPKAFVFNKCERHSGYGYGGYYGYYGYKKY
>gnl|bykdb|A0A1M7LKR0 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWB7] (length=725 residues).
MTITPNNKQVNPQQPMFMSAKASDSFDLLDSILRHWKLVVFFSIIGLFVGVVVSRYVRDSFENKTMLQLDTKSKSGKAVS
DFGDLFDAKSPAVAEIHLIKSLSVLMPVVEQLHLNYTAEPQGIVDRLMRREGRMDLDLFEPPKMDREDKSLKGKKWIAVV
QSQDSYELFSPMGQSLVVGKIGETYRIPMGADTVAICVKAIYAAPGQSFSLSKSSVLNVAEGLQSAINAYEKEKNSNILE
VSFSGRYPDRVANVLNAIAQAYVRQNVEMRSAEAEKSLEFLEEQLPSIKAKLDSSERLLTDYRNKMGTIDLGAEAKGTLE
RQIALKTQLLSLQQEYQEKARLFKEDHPAMQAIVQQQQRLSREIGKEENKTKKLPTTQQDVLKLQQDVEINNQLYTSVLN
NIQQLRVVRASEIGNVRIVDPAYVREKPSKPNRKKIMLAGFGGGFAFSVILIYLLHTMRNRGVGSSSEIERETGVSVYAK
IPKTQISRKLPGVSDKRFILAKADPEDIAVEKVRTLRTALEFSFLDEGGRVLMVTGVAPGAGKSFVSLNLSYLFAKQNKR
VVFVDADLRKSRLSHSREKGISDILINNSKLEDCVIDMGEGMYFLPKGSRAPNPGEMVSSKAFADLIDECKAKYDVVVID
TPPNSLVSDAQAIAKLVDFGLVVIEYKKHSLEVIQETIDQLNIAKLKKVAIALNQCVNDGSSYGYGYGYGYGYGYRYRYG
DKKKS
>gnl|bykdb|A0A1M7MCZ6 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWB7] (length=706 residues).
MNEKMTQNVSNASADDEIDILEILVYLKGKWKFLLIFLFLGVVFGGLVSMWIRPAYKSDILLQVNVKGNKQGLALGEMGA
LLDVSTPSAAEMELIKSRGVLDQVVQDERLCYSAIPLNKKDRLLHKEGRMDIELLSIPRAFEEADGKLIARVTADSSAYE
VLGLEDEVVLSGKVGETYRKPFAGDTLVICVKSMTATVGQTFLLVAVHPQIAVNNLLSGLGISEEGKNSGIIRVSLEDRY
ADRVAAILNTIANTYLKQNIEMRSAEAKKTLMFLEEQLPGVKAKLDSAEQKLTSFRHANGTIDLTGETRVHLEKDVSLQQ
RLLELEQKKQEALRLFRAEHPTVRTIEEQQSKLRREIAKQQRSAASLPVVQQEVLSLQEEVEVNNKLYTNLLNNIQQLRV
VQAGEVGNVRIVDQAYVPLKPSKPKRKLVFLGVVFAFLLLGCFIVYIRRILSNGVCSSSEVEQATGIGVYGKLPMLDGRT
QNDVTKPCVSTNPDDPFAEGVRALRTALEFSVFSDGKKILMVSGLVQGVGKSFVSTNLAASFAMSGKKVLLVDMDLRRGH
FFKHTQKGLCEMLEKENYTDEYVVKVTDNFHVLGSGARVVNPGGLLNSSRFSAFLDSFRDKYDLIVLDTPPVFQCSDALL
VEKHADYLLCVLKHAAHTIESIQDALNTFDRSTETPLPKAFVFNKCERHAGYGYGSYGYYGYHKKY
>gnl|bykdb|A0A1M7NG89 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWR3] (length=707 residues).
MNENTKKISSLGNSLTIVEFALLLWKKKFLVALFVIVAAMLGATYAMWVRPLFTSDVLLQVNVKGTSSKSTKALGEMGAV
LDLASPADAEIELIKSRMVLSDVVAKEHLYVWTVPIGFWDRLTHKEGRMDVDSLRIPEKVRAKKWMAVAKSDSAYSVVSS
DEKNVLDGVVGEVAFKEYAGDTLAIRVNFMDARKGQKFALVRGTPLKAERALAAGLNVMEKGKQTGIISVRYSHRHPDRA
ASILNTIAKTYLRQNVEMRSAEAEKTLEFLEGQLPGVKAKLDSAEKILADYRYKVGSVDISGETKAHLDKEGQLQRQIMQ
LEQERQSALRLFKAEHPNVQTIVKQQNKLRAELAALKKNAEKMPLTQQEVKRLQEEVAVNNEVYTNMLNNIQQLRVVRAG
EVGNVRIVDFAQVEQSQTKPNKSRILMASVVFGFIFGVLFVFLMYILRNGAKSASEIERETGLSVFAKIPQSTHKLLRGH
KHLHHGAPFVLQNAEDKVSESFRSLQTALMFLMPNPEHSVVLVMGLIPGVGKSFVSLNLAATIAASGKKVLLIDADMRRG
VIHGRSKFGLADVLAGIATLDTAVSQKHVDNLCVMNAGKTKLAACELLRGDAMDKLLKEAREKFDMVIVDTPPLNLVTDA
ELICPLVDYSLFVLHYGRHSMEEIKETVERVKRYSDKPAAIVMNHCEREPGHYGYGYYDKGYYGKKS
>gnl|bykdb|A0A1N6GS15 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWB11] (length=724 residues).
MTNTPEKQMNQLPVSQGAIKPVDVIDVFELFSIFRRHWLIFALLSVVGLVAGATYARYSRDVFRSTAMLQLDTKSKSGKA
IADIGALFESHSPALAEIHLIKSLNVLMPVVEKLRLNYGAEPIGLVDRLMHREGRMDLDLFEPPKVFDDDDGDWVAEVKS
EDSYELFTPLGSSVVVGKVGETYRVPVEGDSVAICVRSMDALPGQKFVLYRLSVLRMAEILQKTVLADEKGKNTNIIEIA
YQDRYPDRAAKVLNAVAQMYVRQNVEMRSAEAEKSLEFLEKQLPTIKAKLDSAQQLLTSYRNKVGTVDLGAEARGTLDRQ
VQLKTQLLSLQQQYQEKSRLFKQDHPAMQAILSQQERIRKEIGKEEGKVKALPVTQQDVLKLQQDVELNNELYTSVLNNI
QQLRVVRASEIGNVRIVDPAYIHRKPIKPKRKMIALAGLGGGFAFAWVLVLMLHRMRNRGVGSSSEIERETGVSVYAKVP
KTHISHKLPGVNDKRFILAKADSEDFAIEKIRALRTALEFSCLDEGGRVLMVTGISPEAGKSFVSLNLTYLFAKQNKRVI
FIDADLRKSRLSHKHEKGVSDVIAKTATLDSVVVDMGEGAYFLPKGSRVANPGEMLASKSFAELVQECREKYDIVVIDTP
PCSLVSDAQAIAKLADFGLIVVEYKKHSMENIQEIIDQLSMAKLEKKAIVLNKCVHDGSSYGYGYGYGYGYGYGYRYRYG
EKKK
>gnl|bykdb|A0A1N6J281 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWB11] (length=698 residues).
MAASSKKEETDLFDLLKEFVKNWKIMVPCIILAGIIGVFVAMWIRPVYKVDALLQIESKNNKSVGLMGGLPSLFASASPA
ETEIELIYSRQIIGEAVEKLRLQYTATPINKMDRLLHHEGRMELSQFEVPWKSIPKDEKRGPWIATAVDSSSFDLYDHNN
NKILTGTVGQTYRVPYAGDTLIFSVFHMDATAGQKFKLNKLERLDAIAKFKKAFEVKEKSRKTGILEFSYQDIYPDRATK
ILNEIATSYLRQNVEQRNAEAQKTLEFLEKQLPDVKAQMDSSLLKFNTYRNKVGSIDIGAETQLILEKRNKLQQSLLDLQ
QKKQSAVRLFQPEHPTIKTLEDQESNLKRELASNYAATKKLPNTQQEVLKLTNEVDMSKHMYTTMLNNIQQLKLVSAGEV
GSVRIIDFAEEVSSPIKPKKSMIVCVALFIGLLFGTLIISIKSKFNNGVRDANFIERETGYSVYAKVPKGNPNGTKGTRP
LAVVEPDDVAIESLRALRSSLEFSMEDESKSIIGVSGLIPGVGKSFISVNLAALFAGLGKRVLLIDADLRKGRLHKEFGI
KRDKGLSQILLHTATPAEVIRKTEVPNLEVMQCGNVPSNPSELLGSRHYAAMIEELKQQYDLIIIDTPPIMLVTDAALAC
RVVSEIVMVIEYNRHSIDAIKDGMKQLLKGNNDVHASLVINKYEHGHSDGYGYKYGKY
>gnl|bykdb|A0A1T4QDW5 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter intestinalis] (length=717 residues).
MAENENTMNAPVSAAPKDDEISILEVCGILWEKKFFLLFCLILGAVVGVLAAYWIRPQYTSDALLQIDVSGSASAKALGD
MGALLESSSPADAEIELIKSRMVLNDVVEQEKLCYSATPIGKMNRLLHREGRMDLDSLYIPEFARTEEWKAVVLSPDSFA
VLDPEEKQVLRGEVRKLLVAPYAGDTLAIRVSLLRAEAGEEFALAQSSPLNVARALATGLEIAEKGKKTGILTMNFSHRY
PDRAAAILNAVANAYFRQNVEMRSAEAEKTLAFLEEQLPAVKAKLDTSEKVLADYRFQVGSVDMTGETHALLEKETNLQK
QLLELGAERQRLVRLFTEEHPNVQTIVAQQQRIQNELNRLKKNAEKMPKTQQEILRLQADLSVNNTVYLDMLNKIQQFRV
VRAGAIGNVRIVDYAQVETKPSKPKKTMIVLGSVAGGFVLGVLIIFFLRALSPRGVRSSVELERETGEVVLAKIPRTFSR
VLTNRRRSGEGNPILVLEDPDDPASENIRSLLTAVEFGMLSKTNNVIMVTGIDKGIGKSFISLNFAAAMANAGKKVLLID
ADMRRGKLIRKRRKGLVEVLLGKESLDSMVTLYDNVENLYVLSTGILNVTASELLRGQAFANLVAEAREKYDVVLIDTPP
VALATDAELMANLATLVLFVIKYNTHSMEEIQEVLKRLKRYTSGQLALVMNSCMRERGYGYGYYGGYGGGYSRYEKY
>gnl|bykdb|A0A1X7IS68 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWB13] (length=722 residues).
MINEVNQKQNSQCSEHSKPVDAAQDILNLLNIIRHHWIIIVSFTIVGLMAGLTYSRYSRNLFECTTMLQLDTKSKNAKAI
VDIGDLFQQQSPAKAEILLIQSMSVMLPVVEKLHLNYTAKPLGIIDRLLQREGRMDLKLFEPPKPKDDEKIEWITEILSD
STYDLRSPFGGSLVIGKIGETYRVPFADDTVAISVESISAKPGQKFSLTRIPALYAAKNLSLAINAIEKEKNTNIIEISY
MDRYPDRAAAVLNAIAETYVRQNVEMRSAEAEKSLEFLEQQLPSIKAKLDSAQQLLTNYRNTVGTVDLGAEAQGTLKRQV
ELRTMLLASQQDYQEKSRLFKQDHPVMQALLQQQARLKKEIGIEENKTKKLPTTQQDVLKLQQDVEINNELYTSVLNNMQ
QLRVVRASEIGNVRIVDKAYIDAKPAKPNRKKITLAGFAGGLGFGCILVILLQRIRNRGVGSSTQIEHETGVSVYAKIPK
TKINPKLPNVNDKRFILAKEDSEDIAIERIRTLRTTLEFSCLDEGGKVVIVTGITPGAGKSFISLNLAYLFAKQEKRVLF
IDADLRKSRLSHIREKGVSDIISKVCHLEDVIINLGEGADFLPNGTHTQNPAEMLSSKAFAELIHECREKYDVVIIDTPP
TSLVSDAQAIAKLADFGLLVIEYKKHTMESIQEAIDLISSSKLEKKAIVLNQCVQDDSSYGYGYGYGYGYGYKNRYRSDE
KK
>gnl|bykdb|A0A1X7JCK4 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWB13] (length=697 residues).
MASAKKEETDLWDLLKDLAKNWKIMVPCIFVAGIIGVFIAFWIRPVYKVDALLQIESKSNKSVGMMGGLPSLFASSSPAE
TEIELIKSRHIIGEAVEKMHLQYTATPVNSLDRLLHREGRMEISRFEVPWTLIPKNEKIVPWIAEATDSTTFNLYDHNNK
LVLSGSVGNTYHFPYAGDTAVFCVHRMEATAGQKFELQELNRLDAIAAFKKAFDIKEKGKKTGILEFSYQDIYPDRATQI
LNEIATSYLRQNVEQRNAEAQKTLEFLEKQLPAVKEQMDSSLLKFNTYRNKVGSVDIGAETQIILEKRNVLQQKLLDLQQ
KKQSAIRLFQPEHPTIKTLEEQENNLKRELANNTAATKRLPNTQQEVLKLTNEVDMSKHMYTTMLNNIQQLKLVSAGEVG
SVRIIDFAEEVSRPMKPKKSMIIFAMLFLGLLTGATFVTLRSKFSNGVRDANFIERETGFSVYAKVPKGNPNGTKGTRPL
AVVEPDDVAVESIRALRSSLEFSMEEGSSPTIGVSGLIPGVGKSFISVNLAALYAGLGKKVLLIDADLRKGRLHKEFGIK
RGKGLSQILLGEATVDEVIHNTEVDNLFIMQCGTVPPNPSELLGSKHYASMISELEKSYDLIIVDTPPIMLVTDAALACR
VVSQIVMVIEYNKHSIDAIKDGMTQLLKGNSNAHASFVINKYEHGHSDGYGYKYGKY
>gnl|bykdb|A0A1X7JP42 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWB13] (length=725 residues).
MTITPNNKQVNPQQPMFMSAKAGDSFDLLDSILRHWKLVVFFSIIGLFVGVVVSRYVRDSFENKTMLQLDTKSKSSKAVS
DFGDLFDAKSPAVAEIHLIKSLSVLMPVVEQLHLNYTAEPQGIVDRLMRREGRMDLDLFEPPKMDREDKSLKGKKWIAVV
QSQDTYELFSPMGQSLVVGKIGETYRIPMGADTVAICVKAIYAAPGQSFSLSKSSVLNVAEGLQSAINAYEKEKNSNILE
VSFSGRYPDRVANVLNAIAQAYVRQNVEMRSAEAEKSLEFLEEQLPSIKAKLDSSERLLTNYRNKMGTIDLGAEAQGTLK
RQVDLKAQLLMLQQEYQEKARLFKEDHPAMQAILQQQQRLGKEIAMEEGKTKKLPTTQQDVLKLQQDVEINNQLYTSVLN
NIQQLRVVRASEIGNVRIVDPAYVREKPSKPNRKKIMLAGFGGGFAFSVILIYLLHTMRNRGVGSSSEIERETGVSVYAK
IPKTQISRKLPGVSDKRFILAKADPEDIAVEKVRTLRTALEFSFLDEGGRVLMVTGVAPGAGKSFVSLNLSYLFAKQNKR
VVFVDADLRKSRLSHSREKGISDILINNSKLEDCVIDMGEGMYFLPKGSRAPNPGEMVSSKAFADLIDECKAKYDVVVID
TPPNSLVSDAQAVAKLVDFGLVVIEYKKHSLEVIQETIDQLNIAKLKKVAIALNQCVNDGSSYGYGYGYGYGYGYRYRYG
DKKKS
>gnl|bykdb|A0A1X7KIP6 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWB13] (length=706 residues).
MNEKMTQNVSNASADDEIDILEILVYLKGKWKFLLIFLFLGVVFGGLVSMWIRPAYKSDILLQVNVKGNKQGLALGEMGA
LLDVSTPSAAEMELIKSRGVLDQVVQDERLCYSAIPLNKKDRLLHKEGRMDIELLSIPRAFEEADGKFIARVTADSSAYE
VLGLEDEVVLSGKVGETYRKPFAGDTLVICVKSMTATVGQTFLLVAVHPQIAVNNLLSGLGISEEGKNSGIIRVSLEDRY
ADRVAAILNTIANTYLKQNIEMRSAEAKKTLMFLEEQLPGVKAKLDSAEQKLTSFRHANGTIDLTGETRVHLEKDVSLQQ
RLLELEQKKQEALRLFRAEHPTVRTIEEQQSKLRREIAKQQRSAASLPVVQQEVLSLQEEVEVNNKLYTNLLNNIQQLRV
VQAGEVGNVRIVDQAYVPLKPSKPKRKLVFVGVVFAFLLLGCFIVYIRRILSNGVCSSSEVEQATGIGVYGKLPMLDGRT
QNDVTKPCVSTNPDDPFAEGVRALRTALEFSVFSDGKKILMVSGLVQGVGKSFVSTNLAASFAMSGKKVLLVDMDLRRGH
FFKHTQKGLCEMLEKENYTDEYVVKVTDNFHVLGSGARVVNPGGLLNSSRFSAFLDSFRDKYDLIVLDTPPVFQCSDALL
VEKHADYLLCVLKHAAHTIESIQDALNTFDRSTETPLPKAFVFNKCERHAGYGYGSYGYYGYHKKY
>gnl|bykdb|A0A254RG57 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWR2] (length=698 residues).
MASSSKKEETDLFDLLKNIAKNWQIMVPCLILAGIIGVFVAMWIRPIYKVDALLQIESKNGKNVGMMAGLGNLFSTTSPA
ETEIELIMSRQIIGEAVEKMHLQYEATPISKINRILHQEGRMELSAFEVPWSKLPPDEETGPWHAVVIDSNHYYLLDHNK
KKFLECTVSQTCRAPYAGDTVTINVFYMDAEPKQKFKLQKMERLDAIASFKSKFKVKERGKKTGILEFSYQDIYPDRATS
ILNEIATTYLRQNVEQRNAEAQKTLEFLEKQLPDVKAQMDSSLLKYNTYRNRVGSIDINAETRLVLEKRTKLQQNLLDLQ
QKKQSAIRLFQPEHPTIKTLEEQENALKRELASNYNETKKLPSTQQEVLKLTNEVDMSKIMYTTMLNNIQQLKLVSAGEV
GSVRIIDFAEPALRPAKPKKPLIISAALFIGLLFGFALISIKSKLSSGVRDANFIERETGFSVYAKVPKGNPKGTKGTRP
LAVVEPDDVAVESLRALRSSLEFSMEDGQRRIIGVSGLIPGVGKSFISVNLAALCAGLGKKVLLIDADLRKGRLHKEFGI
KRGKGLSQVLLHNATLDEVICSTEVENLDIIPCGNVPSNPSELLGSKHYTSTIDELEKKYDLIIVDTPPIMLVTDAALAC
RVASQIVMVIEYNKHSIDAIKDGMKQLLKGNNDVHASFVINKYEHSHSDGYGYKYGKY
>gnl|bykdb|A0A254RLG7 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWH1] (length=714 residues).
METNEQKATINLAGLLPQRAGDTITLIEAIGILWSKKFFIATFMVVGALIGCLVMNWIRPEFTSDAMLQIDIRGNKATRA
MGEMGALLDMTSPADAEIELVKSRSVLAYVVEEEHLRFNAIPVGKMDRLLHREGRMDIDELDIPEIARRDRWTATVTGAN
SYAVITPEGAKLVEAEVGETVRAPYAGDTLVMRVRLIRAAVGQEFVLQQLKPLAAIRSLARKLSVSEKGKQTGILAVSLK
HRYADRSATILNAIANTYVRHNVEKRSAEAEKTLEFLEKQLPGVKAKLDTAEKILADYRHKIGSVDMTGETQVHLQKEVD
LQKQLLKLQQEYQEATRLFKDEHPAVRTIAKQQDKLKGELSKLKASAAKMPLTQQEVMRLQEDVQVNNAIYNTMLNNIQQ
LRVVRAGEVGNVRVVDYAMVEDRPSKPKKLNILICCVAASFMVAVLLVFLMRMLHNGVRSTTEVEKATSISVFAKIPERR
GKVMKARRRNLVPLVVSQPEDPASEAFRSLLTSVDFTVPSQTHPVIMVSGLIPGVGKSFVSSNLAALHATSGKRTLLIDA
DMRRGVHRSSSKMGLAEVLGGLCEFGVAVATSDIENLFVISAGHTKLSPSELLRGENFRSMLDEARKQFDVIIVDTPPMS
MVTDAELIYPAADFSLFVLHYGKHSMDEISEAMTKMNRFGEKPKAFVMNHCERETGRYGYGYGYGYYGYYSKKK
>gnl|bykdb|A0A254RLK0 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWB5] (length=714 residues).
MAENEQQTIVVGAQAQSANNTITLLEALFILWKKRFTLCLFLAAGALIGLVIGQWIRPQFTSDALLQIDVKGNKAANRAM
GEMGAILDVASPADAEIELIKSRLVLNYVVSEEHLNYSATPTSALNRLLHREGRMDLDYLFIPDMARTEKWMAVVTGDDT
YAIYNEDETKLIEGKVGQMLKVLYAGDTLQIRVSRMRATIGEEFRINMSNPLIAVRSLAAGLKVAEKGKQTGVIGVSFSH
RYADRAASILNTIANTYVRQNVEMRSAEAEKTLEFLESQLPGVKAKLDSSEKILADYRHSIGSVDMTGETQAHLNKEVDL
QRQLLQLEQERQQATRLFKEEHPSVQTIVKQQNRLRGELARLKKTAESMPVTQQEIIRLQEEVSVNNAQYTAMLNNIQQL
RVVRAGEVGNVRIVDFAQIEPIQSKPKKFNILVCSMAAAFMLGVLWVFMLRMMRNGIRSSQELEHATEVSVFAKIPESKN
RLLRDKRHKLTLVEAAPNDQASEAFRTLQTAVDFSLSEGQKVVMVCGLVPGVGKSFVSKNLAAVYAMNGRRVLLVDADMR
KGVIRSSKYLGLTEVLSGKIPWRETVAESRCQNLFVMGCGKRLMSPSELLRHDLFKNLLEEMKSEYDMILVDTPPVSMVT
DAELIFPLVDFALMVVHYGTDSLAQIKENLANLRRYADKPCAFVMNHCEYEPGHYNGYGYYGKGYYGKGYFSKS
>gnl|bykdb|A0A254RM08 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWB5] (length=698 residues).
MATKKKEETDLGEFLKELAKNWYIMVPCILLAGAVGAFVAQWIRPVYQVDALLQIEAKSNKSAGLVGGLGNLFATNSPAE
TEMELIKSRQVMGSAVEKMRLDLVAEPLNKLDRLLHKEGRVDLMNFSYNKELLPTDFRDEPWFLEMRDSLGNFNLYDYKD
SLVLSGAVGQTYHFEYAGDSAAFGIFKAEVREGQRFAVSKLKRLDAIGLFRSAFDVKEKGKKTGILEFSYQDIYADRAVE
ILNEVASSYLRQNVEERNAEAQKTLEFLEKQLPDVKAQMDSSLLNLNTYRNQVGSVDINAETQLVLQRRMRLQQDILSLQ
QKKQEAIRLFHSEHPTVKTLEDQENALRRELAGTSSEVKKLPATQQEVLKLQNEVELTKVMYTSLLNNIQQLRLVSAGEV
GSVRVVDFAEQVTKPAKPKKRVILCMALFLGFLLGAMLVSIKSKFSSGVKSASFIEKETGYTVYAKVPKGNPKGTKGTRP
LAVVEPDDVAVESLRALRSSLEFSMMDEGGSVVGVSGLIPGVGKSFISVNLAALFAGLGKRVLLIDADLRKGRLHKEFGI
KRGNGLSQVLLREVKVEDVIHKTEVENLFVVPCGNVPANPAELLGSKHYAELIEEFKNSYDLVIVDTPPIMLVTDAALAC
RVAAQIVMVIEYNKHSIEAIKDGMAQILKGNSSAHASIVINKYEHSRTEGYGYKYGKY
>gnl|bykdb|A0A254RQS8 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWB5] (length=720 residues).
MEPNNQYNSTGSTSSAKHKDEDEIDILEVLSLLLKHKLFLACCIVLGCVAGFLASNWMRPQYTSDALLQIDVKGNKAGKA
MGEMGALLDVASPAEAEIELLKSRMVLTYVVEQERLCFNAYPKGAIDRLLHQEGRMDLEDLYIPEIARIEKWTAEVVGEN
EFAVYTPEGVKLLQGKVGEALAAPYGGDTLRINVKHLLARPGQLFVLAQSEPLDAVRGLVKKLDVGEKGKQTGIIGVSYT
DRYADKAASVLNTIANIYLRQNVEMRSAEAEKTLEFLEEQLPGVKAKLDTAEKKLADYRLKIGSVDMTGETRVHLEKVSE
LEKQVLELEQQRQEATRLFKEEHPAVQTIMQQQSRLRSELSRLKKSAENMPRTQQDVMSLQEEVAVNNAQYTAMLNNIQQ
LRVVRAGEVGNVRIVDYAQIERRPSKPNKKMIFLACVGGAFLLGALLIYLLQMTKRGVRSSLEIERETGISVYAKIPKAE
NAILSKRNKGKNTKPLVEDDPDSPSSEALRSLYTAIEFATSDMRVMMVTGMVPGVGKSFVSKNVSALFAGSGKKTLLIDA
DMRRGVVYSHHKQGLGDVLSGHCSLDSAVADSITKNLYVLGAGKTDVSPSELLRGDNFKNLLDEAKAKFDIVIVDTPPLE
LVTDSELIYPIVDFALFVLHYGKHTMDQIKESMMKLDRCCEGKPRAFVMNHCESDGHGYGYGGYGYYGKYSYYGKDKKKK
>gnl|bykdb|A0A254RX70 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWH1] (length=699 residues).
MASKKKEETDLTELLKDVAKNWYIMLPCLVVAGIVGVFVSLWIRPVYQVDALLQIESKNSKNSMGMMGGLGALFSNASPA
ETEIELIRSRQVMGAAVEKMRLQYEAEPLNFLDRLLHREGRLDLAQIEVPWDSVPKTDKIKEWEVEIKDSTGRFDLYDHL
DKVVLSGEPGHTYKFPYAGDSAAFGIISCDVRPGQRFVVRKRKRLDAISSFRSAFDVKEKGKKTGILEFTYQDIYPDRGM
AVLNEVASSYLRQNVEERNAEAQKTLEFLEKQLPDVKAQMDSSLMNLNAYRNRVGSVDVNAETQLVLQRRMKLQQDILAL
QQRKQEAIRLFHSEHPTVKTLEDQEDALKRELAGTASQVKKLPTTQQEVLKLTNEVEQSKILYTTMLNNIQQLRLVSAGE
VGSVRIVDFAEKALRPTKPKPKLIVAVALFLGFLFGTLIISLKTKFSSGVKSASFIEKETGFTVYAKVPKGNPQGTKGTR
PLAVVEPDDVAVESLRALRSSLEFSMMDDNGSVIGVSGLIPGVGKSFISVNLAALFAGLGKKVLLIDADLRKGRLHKEFG
IKRGNGLSQVLLREVQVEEVIHPTEVENMFVIPCGNVPANPAELLGSRHYSDLIERFKSEYDLVIVDTPPIMLVTDAALA
CRLAAQIVMVIEYNRHSIEAIQEGMSQILKGNSTAHASIVINKYEHSRTEGYGYKYGKY
>gnl|bykdb|A0A254RXS0 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWH1] (length=718 residues).
MDNSQVNTKNGSNTGSAKNDDEIDLLEVLGILLKHKLFLFFCLVVGAVVGFLASNWVRPQYTSDALLQIDVKGNKAGKAM
GEMGALLDVASPAEAEIELLKSRMVLSYVVEQERLCFNAYPKGPMKRLTHKEGRMDLENLHIPEIAITEKWYALVTGQDE
FIVITPEDTELVKGRVGEPVSAPYAGDSLVIQVKALRAEPGQMFVLVESDPLAAVRELVKQLNVAERGKQTGIIGVSYTH
QYADRAASILNTIANIYLRQNVEMRSAEAEKTLEFLENQLPGVKAKLDSAEKKLADYRHKIGSVDLSGETRTHLEKEANL
EKQILELEQKRQEQTRLFKDEHPAVVTIVKQQDRLRTELARLKSSAAKMPLTQQEVISLQEEVAVNNAQYTSMLNNIQQL
RVVRAGEVGNVRIVDYAQIERKPSKPNKKLILIGCIAGFFLLGALLIYLLQMTKRGVRSSLEIERETGVSVYAKIPKSEN
SILSLRKKGKNTLPLVEEDPEDPASEAFRSLYTAIDFSVGEQKVIMVTGMIPGVGKSFVSKNLAALYAAAGKKTLLIDAD
MRRGVVYSHHKQGLGDVLSGRCTLESAVADSITKNLFVIGAGITDVSPSELLRGTKFKELLDSASETYDTIIVDTPPLNL
VTDSELIFPVVDFALFVLHYGRHSMEQIKEAMIKIERCGNKPHALVMNHCESDGHGYGHYGSYGSYGSYGSYKKKKKR
>gnl|bykdb|A0A254S3F1 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWB4] (length=706 residues).
MNEKMTQNMSNASADGEIDILEIIVYLKSKWKFLLVFLFFGVVFGCLAAMWIRPSFKSDILLQVNVKGNKQGLALGEMGA
LFDVSTPSAAEMELIKSRVILDQVVQDERLCYSAVPLNKLDRLMHREGRMDLELLVIPRAFEEAKGELVARVTADSSAYE
VIGLEGEVVLSGKVGETYRKPFAGDTLAICVKNLTATVGQTFLLTAVHPQVAAGNLLKGLSISEEGKSSGIIRVSLENRY
ADRVAAILNTVANTYLKQNIEMRSAEAKKTLMFLEEQLPGVKAKLDSAEQKLTSFRNAKGTIDLSGETRLHLEKDVTLQQ
RIIELEQKKQEVLRLFRAEHPTVRTIEEQQARLRRELARQQRSASSLPVLQQEVLSLQEEVEVNNKLYTNLLNNIQQLRV
VQAGEVGNVRIVDQAYEPLKPNKPNRKLIFLGVMGAFLLLGCFIVYIRRLLSNGVCSSSEVEQATGVGVYGKLPMLDGKT
LNDVYKPCVATNPDDPFAEGIRALRTALEFSVFSDGKKVLMVSGLVQGVGKSFVSTNLAASFAMSGKKVLLVDMDLRRGH
LFKHSQKGLCEMLEEENYGDDYVVKVMDNFHVLGAGARVVNPGGLLTSSRFSAFLDAFRDKYDLIVLDTPPVFQCSDALL
VEKHADYLLCVLKHAAHTIESIQDALNTFDRSTETPLQKAFVFNKCERHAGSGYGSYGYYGYHKKY
>gnl|bykdb|A0A254S791 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWB4] (length=698 residues).
MASSSKKEETDLFDLLKELAKNWKIMIPSIILSGIIGVFVAMWIRPVYKVDALLQIESKNSKSLSLMGGLGNLFASTSPA
ATEIELINSRQIIGEAVEKMHLQYIADPINKLDRLTHHEGRMELSAFEVPWDSIPTDEKIKPWIAKAIDSLSFELYDHND
KKILTGVIGQTYRIPYARDTVIFSVFNMEAVAGQKFELTKLDRLDAIAKFKGAFEVKERGKKTGILEFSYQDIYPDRATK
IVNEIATTYLRQNVEQRNAEAQKTLEFLEKQLPDVKAQMDSSLLKFNTYRNKVGSIDIDAETRLVLEKRTRLQQSLLELQ
QKKQSAIRLFQPEHPTIKTLEEQEAAIKRELALNSNETKKLPATQQEVLKLTNEVDMSKIMYTTMLNNIQQLKLVSAGEV
GSVRIIDFAEEVKKPSKPRKTVIVCIALFFGVLLGACIALLKSKFSNGVRDAHFIERETGFSVYAKVPKGNPKGTKGTCP
LAVVEPDDVAIESLRTLRSSLEFSMDEGSSPIIGISGLIPGVGKSFISVNLAALYAGLGKKVLLIDADLRKGRLHKEFGI
KRGKGLSQVLLHTATAEEVISKTEVENLEIIPCGNVPSNPSELLGSKRYNDLIQELKSRYDLIIIDTPPIMLVTDAALAC
RVAAQIVMVIEYNKHSIDAIQDGMKQLLKGNNTAHASFVINKYEHGHNDGYGYKYGKY
>gnl|bykdb|A0A254SB44 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWB4] (length=717 residues).
MTVTPNNKQQNPQQPFFMQVNTGDSFDLLGNILRHWKLVAVLSIVGLLAGTVASRYVRDSFDNKTMLQLDTKSKSGKAVS
DFGDLFDAKSPAVAEIHLIKSLSVLMPVVEQLHLNYMAEPQGIVDRLMRREGRMDLDLFEPPKAGMLGIDKKDEKWIAVV
RSQDTYELFSPMGQSLVVGKVGETYRIPMGADSVAICVRAFSAEPGQSFRLFRSSVLSVAEGLQAAINAYEKEKNSNILE
ISYSGRYPDRVADVLNAVAQAYVRQNVEMRSAEAEKSLEFLEEQLPSIKAKLDSSERLLTNYRNKMGTVDLGAEAKGTLE
RQVELKTQLLSLQQQYQEKARLFKEDHPAMQALLQQQQRLNREIGKEESKTKKLPITQQDVLKLQQDVEINNQLYTSVLN
NIQQLRVVRASEIGNVRVVDPAYIHEKPSKPNRKKIMAAGLGGGFAFSVVLIYLLHLIGGRGVGSSSEIERETGVSVYAK
IPKTQISRKLPGVNDKRFILAKADAEDIAIEKVRTLRTALEFSFLEEGGRVLMVTGIVPGAGKSFVSLNLAYLFAKQNKR
VLFVDADLRKSRLSHMREKGVSDILINNGKLEDLVVDMGEGFFFLPKGSRAPNPGEMVSSRAFAELIDECKSKYDVVVID
TPPNSLVSDAQSIAKLADFGLIVIEYKKHSMDEIQDVIDQLSIAKLDKKAIVLNQCLQDGLGYGYDYRYRYDEIKKS
>gnl|bykdb|A0A254SF58 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWB2] (length=699 residues).
MAASSKKEETDLFDLLKDLAKNWKIMIPCLIVSAIIGVFVAMWIRPIYQVDALLQIESKNNKSMGMTGGLSSLFATTSPA
ETEIELIGSRQIIGEAVEKMHLQYVAIPTNKLDRLMHREGRMELSLFEFPWKTIPKEKRKGSWTTEALDSTTQYNLYDNK
KQKVLSGIVGKTYHVPYLSDTLTFRIERMEAAPGQKFKIGKMERLDAIEAFKGAFNIKERGKKTGILEFSYQDIYPDRAT
KVLNEIATSYLRQNVEQRNAEAQKTLEFLEKQLPIVKAQMDSTLLKYNTYRNKVGSVDIYAETKLVLEKRNKLQQSLLEL
QQKKQSAIRLFQPEHPTIKTLEEQENNLKRELANNTAATKKLPNTQQEVLKLTNEVDMSKLMYTTMLNNIQQLKLVSAGE
VGSVRIIDFAEEVFRPIKPKKSLIVCIALFLGFLIGASISTLKSKISNGVRDAHFIERETGYSVYAKVPKGNPKGTKGTR
PLAVVEPDDVAVESLRTLRSSLEFSMDESSNSIIGVSGLIPGVGKSFVSVNLAALYAGLGKKVLLIDADLRKGRLHKEFG
IKRGKGLSQILLHTATAEEVISSTEVENLDIIPCGMVPSNPSELLGSKRYSELIEELKSKYDLIIVDTPPIMLVTDAALA
CRVAAQIVMVIEYNKHSIEAIQDGMKQLLKGNTSAHASFVINKYEHGHNDGYGYKYGKY
>gnl|bykdb|A0A254SFQ7 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWB2] (length=706 residues).
MNEKMTQNASNASADDEIDILEILVYLKGKWKFLLIFLFLGVIFGGFVSMWLRPSYRSDILLQVNVKGNKQGLALGEMGA
LLDVSTPSAAEMELIKSRVVLDHVVNEERLCFSATPLNKQDRLLHHEGRMDLELLVIPRAFQEAKGKLVARVTADSSAYE
VIGLEGEVVLSGSVGETYRKPFAGDTLVICVKSLTATVGQTFLLSAVHPQIAAASLLKGLSISEEGKNSGIIRVSLENRY
ADRVAAILNTIANTYLKQNIEMRSAEAKKTLAFLEEQLPGVKAKLDSAEQKLTSFRNSKGTIDLTGETRVHLEKDVSLQQ
RLIELEQKKQEALRLFRAEHPTVRTIEEQQSRLRRELAKQQRSAATLPVVQQEVLSLQEEVEVNNKLYTNLLNNIQQLRV
VQAGEVGNVRIVDQAYAPLLPSKPNRKLIFLGVVAAFLLLGCFIVYIRRMLANGVCSSSEVEQATGVGVYGKLPMLDGKT
QNDVMKPCVSVKPDDPFAEGIRALRTALEFSVFSDGKKVLMVSGLVQGVGKSFVSTNLAASFAMSGKKVLLVDMDLRRGH
LFKHSQKGLCEMLEKEDYSDEYVVKVTDNFYVLGSGARVVNPGGLLNSSRFSAFLDAFKDKYDLIVLDTPPVFQCSDALL
VEKHADYLLCVLKHAAHTIESIQDALNTFDRSTETPLQKAFVFNKCERHAGYGYGSYGYYGYHKKY
>gnl|bykdb|A0A254SNB3 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWB2] (length=712 residues).
MAESEQQTIVVGAQQMQAENTITLLEALFILWKRRFLLLLFLAFGAIVGVLIGMWIRPQFTSDALLQIDVKGNKAGKAMG
EMGALLEVASPADAEIELIKSRMVLSYVVSQEHLDYSAAPLSAMNRLLHKEGRMDIDYLEIPELARAERWIAVVTGADTY
DVYTPEETKLVGGKVGDLLKAPYAGDTLCIRVNLMRATVGERFAIGQSNTLLAVRGLASALKVAEKGKQTGIIGVSYSHR
YADRAASILNTIANTYVRQNVEMRSAEAEKTLEFLESQLPGVKSKLDSAEKVLADYRHQIGSVDMTGETQAHLSKEMDLQ
RQLLQLEQQRQEATRLFKEEHPAVVTIVKQEAKLRRELSRLKKNAESMPITQQEVLRLQEDVAVNNAQYTSMLNNIQQLR
VVRAGEVGNVRIVDFAQIEPIQSKPKKLNILICSMAASFMLGVLLVFLLRMMKNGVRSSQELEHATDVSVFAKIPVSKNK
VVRNKHNAMTLVESSPNEPASEAFRTLQTAIDFSLSEGQKVIMICGLVPGVGKSFVSKNLAAVYAMNGKRVLLIDADMRK
GVIHSSKHVGLTEVLSGKVDWHEAVSDNRCQNLFVMGGGKRLMSPSELLRRDTFKNLLEEMKSEFDMILVDTPPVSMVTD
AELIFPLVDFTLMVVHYGTDSLAQVKESLANLRRYADKPCAFVMNHCEYEPGHYYGYGYYGGGYYGKGYYSK
>gnl|bykdb|A0A254SQM8 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWB1] (length=714 residues).
MAENEQQTIVVGAQAQSTNNTITLLEALFILWKKRFTLCLFLAAGALIGLVIGQWIRPQFTSDALLQIDVKGNKAANRAM
GEMGAILDVASPADAEIELIKSRLVLNYVVSEEHLNYSATPTSALNRLLHREGRMDLDYLFIPDMARTEKWWAVVTGDDT
YAVYNEDETRLVEGKVGQMLKVLYAGDTLQIRVSRMRATVGEEFRISMTNPLIAVRSLAAGLKVAEKGKQTGVIGVSFSH
RYADRAASILNTIANTYVRQNVEMRSAEAEKTLEFLESQLPGVKAKLDSSEKVLADYRHSIGSVDMTGETQAHLNKEVDL
QRQLLHLEQERQQATRLFKEEHPSVQTIVKQQNRLRGELARLKKTAESMPVTQQEMIRLQEEVSVNNAQYTAMLNNIQQL
RVVRAGEVGNVRIVDFAQVEPIQSKPKKFNILICSMAAAFMLGVLWVFMLRMMRNGVRSSQELEHATEVSVFAKIPESRN
RLLRDKRHKLTLVEASPNDQASEAFRTLQTAVDFSLTEGQKVLMICGLMPGVGKSFVSKNLAAVYAMNGKRVLLIDADMR
KGVIRSSKYLGLAEVLSGKIPWRETVAESRCQNLFVMGCGKRLMSPSELLRHDLFKTLLEEMKSEYDMILVDTPPVSMVT
DAELIFPLVDFALMVVHYGTDSVAQIKENLANLRRYADKPCAFVMNHCEYEPGHYYGYGYYGKGYYGKGYFSKS
>gnl|bykdb|A0A254STU0 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWB1] (length=721 residues).
MKMELNNQYNSIGSTSSANHKDEDEIDILEVLGLLLKHKLFLAFCIVLGCAAGFLASNWMRPQFTSDALLQIDVKGNKAG
KAMGEMGALLDVASPAEAEIELLKSRMVLTYVVEQERLCFNAYPKGAIDRLLHQEGRMDLEDLYIPEIARIEKWTAEVVG
DNEFAVYTPEGVKLLQGKVGESLSAPYGGDTLRVHVKHLLARPGQRFVLVQSEPLDAVRGLVKKLDVAEKGKQTGIIGVS
YTDRYADKAASVLNTIANIYLRQNVEMRSAEAEKTLEFLEDQLPGVKAKLDSAEKKLADYRLKIGSVDMTGETRVHLEKV
SELEKQVLELEQQRQEATRLFKEEHPAVQTIMQQQSRLRSELSRLKKSAENMPRTQQDVMSLQEEVAVNNAQYTAMLNNI
QQLRVVRAGEVGNVRIVDYAQIERKPSKPNKKVIFAGCVGGAFLLGALLIYLLQMTKRGVRSSLEIERETGISVYAKIPK
AENAILLKRNKGKNTKPLVEDDPDSPSSEALRSLYTAIEFATNDLRVMMVTGMIPGVGKSFVSKNVSALFAGSGKKTLLI
DADMRRGVVYSHRKQGLGDVLEGKCSLDNAVADSITKNLYVLGAGKTDVSPSELLRGDNFKNLLDEAKSKFDIVIVDTPP
LELVTDSELIYPIVDFALFVLHYGKHSMDQIKESMMKLDRCCEGKPRAFVMNHCESDGHGYGYGSYGYGKYSYYGKDKKK
K
>gnl|bykdb|A0A254SZB4 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWB1] (length=698 residues).
MATKKKEETDLGEFLKELAKNWYIMVPCILLAGAVGAFVAQWIRPVFQVDALLQIEAKNNKSAGLVGGLGNLFATNSPAE
TEMELIKSRQVMGSAVEKMRLDLVAEPLNKLDRLLHKEGRVDLMNFSYNKDLLPSDFRDEPWFLEMKDSLGNFDLYDYKD
SLVLSGAVGQTYHFAYAGDSAAFGIFKAEVREGQRFAVSKLKRLDAIEQFRSAFDVKEKGKKTGILEFSYQDIYADRAVE
ILNEVASSYLRQNVEERNAEAQKTLEFLEKQLPDVKAQMDSSLLNLNTYRNQVGSVDINAETQLVLQRRMRLQQDILSLQ
QKKQEAIRLFHSEHPTVKTLEDQENALRRELAGTSSEVKKLPATQQEVLKLQNEVELTKVMYTSLLNNIQQLRLVSAGEV
GSVRVVDFAEQVTKPAKPKKRVILCMALFLGFLLGAMLVSIKSKFSSGVKSASFIEKETGYTVYAKVPKGNPKGTKGTRP
LAVVEPDDVAVESLRALRSSLEFSMMDEGGSVVGVSGLIPGVGKSFVSVNLAALFAGLGKSVLLIDADLRKGRLHKEFGI
KRGNGLSQVLLREVKAEDVIHKTEVENLYVMPCGNVPNNPAELLGSKHYAELIEQFKKDYDLVIVDTPPIMLVTDAALAC
RVAAQIVMVIEYNKHSIEAIKDGMAQILKGNSSAHASIVINKYEHSRTEGYGYKYGKY
>gnl|bykdb|A0A285ZTW6 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWB16] (length=698 residues).
MSASSKKEETDLFDILKDLAKNWRIMIPCIIVAGIVGVFVAMWIRPIYKVDALLQIETKSNKSVGLMGGLPSLFASSSPA
ETEIELINSRQIIGDAVEKMHLQYEANPINVMDRLLHREGRMELNQYEIPWDKIPEDEKIKPWIAEATDSTSFKLIDHND
KEVLSGTVGKTYHFIYAGDTATFSVFNMKARAGQRFELFKRTRLDAIAKFKSAFDVGEKGKKTGILEFSYQDIYPDRATK
ILNEIATSYLRQNVEQRNAEAQKTLEFLEKQLPDVKAQMDSSLLKFNTYRNKVGSVDIDAETRLILEKRNRLQQNLLDLQ
QKKQSAIRLFQPEHPTIKTLEEQENNLKRELASTSIATKKLPNTQQEVLKLTNEVDMSKIMYTTMLNNIQQLKLVSAGEV
GSVRIIDFAEEVTRPAKPKKSLIICVALFLGFLLGACIATLKSKLSNGVRDAHFIERETGYSVYAKVPKGNPKGTKGTRP
LAVVEPDDVAVESLRTLRSSLEFSMDDGSSPIIGISGLIPGVGKSFISVNLAALYAGLGKKVLLIDADLRKGRLHKEFGI
KRGKGLSQILLHSATFEEVVSKTEVENLEIIPCGMVPSNPSELLGSKRYLDLIDELKSKYDLIIIDTPPIMLVTDAALAC
RVAAQIVMVIEYNKHSIDAIQDGMKQLLKGNNTAHASFVINKYEHGHSDGYGYKYGKY
>gnl|bykdb|A0A285ZYD6 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWB16] (length=723 residues).
MAEKEEKKVVSQATIQLPPDNNTITLLEAMQILWEKKFTLLLFILVGGLVGFSIANWLRPQYTSDILLQIDAKGGNATKA
MGEMGSILDVASPADAEIELIKSRMVLSYVVEAERLCFNATPVGAVDRFTHKEGRMDLDSLYIPTLARAEKWMARAVDEN
TYEVISPEEQVILEGKVGELYKAPYAGDTLDIHVSKMLAQPGQEFVLSQSGMLGAIAALKGGLKVAEKGKKSGIIEASFN
HRYPDRAASILNTVAKTYLRQNVEMRSAEAAKTLEFLEKQLPGVKAKLDSVEKILADYRYSIGSVDMTGETHAHLNKESE
IQRQILDLEQQKQAAMRLFKEEHPSVQTLIRQQNRLRAELAKLKKTAEKMPLTQQEVARLKEDVAVNNEIYTTMLNNIQQ
LRVVRAGEVGNVRIVDFAQINGAPSKPKKMNIIICSVAASFMLGVLLVFLLRMMHNGVRSVTEIERETNTSVLAKVPQYP
DTGLNLKFRKTRKTHVQTDPDDPLSESIRSILTAIDFSFNMNKEHQVIMVSGITPGVGKSFISTNLAATFAMVGKKTLFI
DADMRKATCRFTKVGLADVLMGKVAFENAKISSPNLPNLDILESGKFTLSAFELLRGDMLKKLIDEIRPQYDAIIIDTPP
TNLVTDAYMICPLIDFALVVLHYGRHSMDSIKESLHTLERYCDKPKAFVLNHCEHRHGYGYGYGYGYGYGYGYYGSKSKK
HKN
>gnl|bykdb|A0A286A129 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWB16] (length=706 residues).
MNEKMTQNVSSKSDDDEIDILEILVYLKSKWKFLLIFLILGIGFGGLFSMWLRPSFRSDILLQVNVKGNKQGLALGEMGA
LLDVSTPSAAEMELLKSRVVLDQVVEDERLCFSAVPLNKMDRLKHREGRMDLELLSIPRAFVEAKGELIARVTADSSAYE
VLGLEGEVVLSGSVGETYRKPFAGDTLVICVKSLTATVGQTFLLNAVHPQTASASLLKGISISEEGKNSGIIRVSFEHRY
ADRVAAILNTIANTYLKQNIEMRSAEAKKTLAFLEEQLPGVKAKLDSAEQKLTSFRHANGTIDLSGETRVHLEKDVSLQQ
RLLELEQKKQEALRLFRAEHPTVRTIEEQQSRLRREIAKQQRSAASLPVVQQEVLSLQEEVEVNNKLYTNLLNNIQQLRV
VQAGEVGNVRIVDQAYVPLKPAKPNRKLVFLGVVFAFLLLGCFIVYVRRMLSNGVCSSSEVEQATGIGVYGKLPMLDGKT
QNDVYKPCVSTNPDDPFAEGIRALRTALEFSVFSDGKKILMVSGLVQGVGKSFVSTNLAASFAMSGKKVLLVDMDLRRGH
LFKHSQKGLCEMLEKEDYSDEYVVHVMDNFYVLGSGARVVNPGGLLNSSRFSAFLDAFRDKYDLIVLDTPPVFQCSDALL
VEKHADYLLCVLKHAAHTIESIQDALNTFDRSTETPLQKAFVFNKCERHAGYGYGSYGYYGYHKKY
>gnl|bykdb|A0A2A3HHG6 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWS1] (length=717 residues).
MAENENTMNAPVSAAPKDDEISILEVCGILWGKKFFLLFCLILGAVVGVLAAYWIRPQYTSDALLQIDVSGSASAKALGD
MGALLESSSPADAEIELIKSRMVLNDVVEQEKLCYSATPIGKMNRLLHREGRMDLDSLYIPEFARTEEWKAVVLSPDSFA
VLDPEEKQVLRGEVRKLLVAPYAGDTLAIRVSLLRAEAGEEFALAQSSPLNVARALATGLEIAEKGKKTGILTMNFSHRY
PDRAAAILNAVANAYFRQNVEMRSAEAEKTLAFLEEQLPAVKAKLDTSEKVLADYRFQVGSVDMTGETHALLEKETNLQK
QLLELGAERQRLVRLFTEEHPNVQTIVAQQQRIQNELNRLKKNAEKMPKTQQEILRLQADLSVNNTVYLDMLNKIQQFRV
VRAGAIGNVRIVDYAQVETKPSKPKKTMIVLGSVAGGFVLGVLIIFFLRALSPRGVRSSVELERETGEVVLAKIPRTFSR
VLTNRRRSGEGNPILVLEDPDDPASENIRSLLTAVEFGMLSKTNNVIMVTGIDKGIGKSFISLNFAAAMANAGKKVLLID
ADMRRGKLIRKRRKGLVEVLLGKESLDSMVTLYDNVENLYVLSTGILNVTASELLRGQAFANLVAEAREKYDVVLIDTPP
VALATDAELMANLASLVLFVIKYNTHSMEEIQEMLKRLKRYLNGQIALVMNSCMRERGYGYGYYGGYGGGYSRYEKY
>gnl|bykdb|A0A2C8Y654 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWT3] (length=706 residues).
MDNKVPQGATAKPEDDEIDILEILVFLKSKWKFLTIFLVLGLFAGGVASMWMRPAYKSDILLQVDVKGNKSSKALGEMGA
LLDVSTPSEAEMQLIKSRMVLSTVVDEQRLCYSAVPLDKVDRLLHREGRMDLEFLSIPRAVTEAKIKIKARVLPDSTKFE
LLGEDDAVLLKGEVGETYRQPYAGDTLAICVRSMKARPGQVFLLGATHPQMAVAGLLGGLSVSEEGKNSGIIRVSMQHAY
PDRVADILNSIANTYLKQNIEMRSAEAKKTLDFLEEQLPSVKAKLDSSEQKLTSFRNANGTIDLSGETRVHLEKDVSLQQ
RLLELEQKKQEALRLFQAEHPTVRTIEQQQARLYGELAKQKKAADKLPKTQQEFLSLQEEVEVNNKLYTNLLNNIQQLRV
VQAGEVGNVRIVDQAYVPIKPAKPNRKLIFGGVALAFLLLGCAIVLVRRMSHNGVASSTEVEQATGIGVYGKLPMLGKGT
ENNVLDPVVHEKPDEPFAEAVRALRTALEFSLFADGKKVLMVSGLIEGVGKSFVSTNLACSFAMSGKKVLLVDMDLRRGR
MFKKGHKGLCEMLRAEKFDDEYIEMVSENYHIIGSGKRVVNPGDLLNKNRFGTFLDTFRKKYDLIILDTPPIFQCSDALL
VEKYADYLLCVLKQSAQSMDNIQEALSTFDRSTETPLPKAFVFNKCERHSGYGYGGYYGYYGYKKY
>gnl|bykdb|A0A2C8YXS0 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWT3] (length=707 residues).
MDENIKKIQPLEGSITLLDVAQTLWNRRWVILLFTLLTVVFGYAYAMWVRPQFTSDVLLQVNVKGSSSKSTKALGEMGAV
LDLASPADAEIELIKSRMVLSEVVAIEHLHIWTIPIGVSDRFTHKEGRMDVDSLIIPEKLRVKKWIAVVKDENSYAVIAP
DGKVALEGRVGEVYSAVFAGDTLTIRVNYMQARKGQKFQIVQGSPLKAERALKASLNVAEKGKQTGIISVRYSHRYPDRA
ASILNTIAKTYLRQNVEMRSAEAEKTLEFLEGQLPGVKAKLDSAEKVLADYRHKVGSVDIGGETKAHLDKEGQLQRQIMQ
LEQERQSALRLFKAEHPNVQTIVKQQNKVKAELAQLKKNAEKMPLTQQEVKRLQEEVAVNNEVYTNMLNNIQQLRVVRAG
EVGNVRIVDFAQIEPSQSKPNKSRIIIASVAFGFALGILFVVLMRILKNGVRSASEIERETGLSVFAKIPQSTHKFLRAN
TRVHHSAPFVLQNTEDKVSESFRSLQTALMFLMPNPEHSVVLVMGLIPGVGKSFVSLNLAATIAVSGKKVLLIDADMRRG
VIHGRSKFGLADVLAGIATLDTAVSQKHDDNLYVMNAGKTKLAACELLRGEAMDKLLKEARERFDMIIVDTPPLNLVTDA
ELICPLVDYSLFVLHYGRHSMEEIKETVERVKRYSDKPAAIVMNHCEREPGRYGYGYYDKGYYGKKS
>gnl|bykdb|A0A2C9A7H2 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWT3] (length=701 residues).
MASSAKKEETDLFDLLKDLVKNWHIMLPCLILSGFIGIILAMWIRPIYQVDALLQIESKSNKGMTGAMMGGLGSLFASSS
PAETEIELIKSRHIIGDAVDKMHLQYIATPTNKLDRLLHKEGRMELNQLEIPWALFPREERNKPWIAVIMDSLTFKLYDH
NKKLIADNCHAGITYKFPYMGDSVTFSVLKMNVKKGQTFNLTKIDRLDAINAFRDVFDITEKGKKTGILEFSYQDIYPDR
ATEILNEISTAYLRQNVERSNEEAQKTLEFLEKQLPDVKMQMDSAMLRFNNYRNRVGSVDINAETRLVLERRNKLQQDLL
SLQQKKQDAIRLFQPEHPTIKTYEEQEAAIKRELAHNTSESKRLPATQQEVLKLNNEVDLTKIMYTTMLNNIQQLKLVSA
GEVGTVRIIDYAEQVTRPAKPKKKIIVCIALILGLLFGFALISLKKKMSSGVRDANFIEKETGFSVFAKIPKGNPNGTKG
TRPLAVVEPDDVAVESLRALRSSLEFSMDEGCRPIIGVSGLIPGVGKSFISVNLAALFAGLGKKVLLIDADLRKGRLHKE
FGIKRGDGLSQLLMRNAELKDVIHTTEVENLFVMPCGNVPSNPSELLGSKHYAELINGLEKEYDLIIIDTPPIMLVTDAA
LACRIASQIVMVIEYNKHSIDAIKDGMAQLLKGNTDAHASIVVNKYEHSHSDGYGYKYGKY
>gnl|bykdb|A0A2M9A3A4 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWS3] (length=720 residues).
MQQNNVNMDYAQQKNADDEIDILELVGVLLAKWPILAVFVVLGTVSGFIVSNYIRPVFSSDALLQVDLNGNSASLAMGEM
GALLDAASPADAEIQLIRSRRVLSVVVDKEHLSYGATPVALLPRLLHKEGRVDVGLLHFPEVYEPDANWFLVASSDSSLS
NSHYQIVDPMQKVILEGIVGDTYRVPVAGDTFAIQILNMMASPSEKFRLFESDPRQALDALRNQLSVTEQGKKTGIIQMQ
IHHRYADRAAHILNSIADTYVRQNVESRSEEATKTLEFLEKQLPGVKAKLDSAEQILSSYRQEEGSIDLSGEARGVLEKR
MQLEKSLLELQQKYEETTRLFKEDHPTVLSLKKQQNQLRREMAKLSEETKDLPTKQQEILRLQGDVNVNNAIYTNMLNNI
QQLRVVQAGEVGNVRVVDYARIEIKPVKPRKLVILLGFIAGGFILGACLIFVLRLLSSRGIRSSSDVERETGVSVYAKVP
ETAQMKKMKKMKTFSLVEVDSEDVACEALRTLRTSLEFSMMDSKVLLVTGLSPGSGKSFISKNLAALIAMNGKKVLLIDT
DFRASYMSSRGRKRGLSDYLLGQIALDEAVEHLDGAQVDLLGAGSYSSSPSEMISSKAFENLLNEMKSKYDLIIVDSAPV
LAVADALVASRYADFVLLVIHYGHDSMEALREGLGQFEKANVEHKAMVFNRCVYEGGHSSYGYGYGYGYGYGKNKKKKKS
>gnl|bykdb|A0A2N3RSN9 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWT1] (length=699 residues).
MASKKKEETDLTELLKDVAKNWYIMLPCLVVAGIVGVFVSLWIRPVYQVDALLQIESKNSKNSMGMMGGLGALFSNASPA
ETEIELIRSRQVMGAAVEKMRLQYEAEPLNFLDRLLHREGRLDLAQIEVPWDSVPKTDKIKEWEVEIKDSTGRFDLYDHL
DKVVLSGEPGHTYKFPYAGDSAAFGIISCDVRPGQRFVVRKRKRLDAISSFRSAFDVKEKGKKTGILEFTYQDIYPDRGM
AVLNEVASSYLRQNVEERNAEAQKTLEFLEKQLPDVKAQMDSSLMNLNAYRNRVGSVDVNAETQLVLQRRMKLQQDILAL
QQRKQEAIRLFHSEHPTVKTLEDQEDALKRELAGTASQVKKLPTTQQEVLKLTNEVEQSKILYTTMLNNIQQLRLVSAGE
VGSVRIVDFAEKALRPTKPKPKLIVAVALFLGFLFGTLIISLKTKFSSGVKSASFIEKETGFTVYAKVPKGNPQGTKGTR
PLAVVEPDDVAVESLRALRSSLEFSMMDDNGSVIGVSGLIPGVGKSFISVNLAALFAGLGKKVLLIDADLRKGRLHKEFG
IKRGNGLSQVLLREVQVEEVIHPTEVENMFVIPCGNVPANPAELLGSKHYADLIERFKSEYDLVIVDTPPIMLVTDAALA
CRLAAQIVMVIEYNRHSIEAIQEGMSQILKGNSTAHASIVINKYEHSRTEGYGYKYGKY
>gnl|bykdb|A0A2N3RVJ9 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWT1] (length=718 residues).
MDNSQVNAKNGSNTGSAKNDDEIDLLEVLGILLKHKLFLFFCLVVGAVVGFLASNWVRPQYTSDALLQIDVKGNKAGKAM
GEMGALLDVASPAEAEIELLKSRMVLSYVVEQERLCFNAYPKGPMKRLTHKEGRMDLENLHIPEIAITEKWYALVTGQDE
FIVITPEDTELVKGRVGEPVSAPYAGDSLVIQVKALRAEPGQMFVLVESDPLAAVRELVKQLNVAERGKQTGIIGVSYTH
QYADRAASILNTIANIYLRQNVEMRSAEAEKTLEFLENQLPGVKAKLDSAEKKLADYRHKIGSVDLSGETRTHLEKEANL
EKQILELEQKRQEQTRLFKDEHPAVVTIVKQQDRLRAELARLKSSAAKMPLTQQEVISLQEEVAVNNAQYTSMLNNIQQL
RVVRAGEVGNVRIVDYAQIERKPSKPNKKLILIGCIAGFFLLGALLIYLLQMTKRGVRSSLEIERETGVSVYAKIPKSEN
SILSLRKKGKNTLPLVEEDPEDPASEAFRSLYTAIDFSVGEQKVIMVTGMIPGVGKSFVSKNLAALYAAAGKKTLLIDAD
MRRGVVYSHHKQGLGDVLSGRCTLESAVADSITKNLFVIGAGITDVSPSELLRGTKFKELLDSASETYDTIIVDTPPLNL
VTDSELIFPVVDFALFVLHYGRHSMEQIKEAMIKIERCGNKPHALVMNHCESDGHGYGHYGSYGSYGSYGSYKKKKKR
>gnl|bykdb|A0A2N3RVS2 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWT1] (length=714 residues).
METNEQKATINLAGLLPQRAGDTITLIEAIGILWSKKFFIATFMVVGALIGCLVMNWIRPEFTSDAMLQIDIRGNKATRA
MGEMGALLDMTSPADAEIELVKSRSVLAYVVEEEHLRFNAIPVGKMDRLLHREGRMDIDELDIPEIARRDRWTATVTGAN
SYAVITPEGAKLVEAEVGETVRAPYAGDTLVMRVRLIRAAVGQEFVLQQLKPLAAIRSLARKLSVSEKGKQTGILAVSLK
HRYADRSATILNAIANTYVRHNVEKRSAEAEKTLEFLEKQLPGVKAKLDTAEKILADYRHKIGSVDMTGETQVHLQKEVD
LQKQLLKLQQEYQEATRLFKDEHPAVRTIAKQQDKLKGELSKLKASAAKMPLTQQEVMRLQEDVQVNNAIYNTMLNNIQQ
LRVVRAGEVGNVRVVDYAMVEDRPSKPKKLNILICCVAASFMVAVLLVFLMRMLHNGVRSTTEVEKATSISVFAKIPERH
GKVMKARRRNLVPLVVSQPEDPASEAFRSLLTSVDFTVPSQTHPVIMVSGLIPGVGKSFVSSNLAALHATSGKRTLLIDA
DMRRGVHRSSSKMGLAEVLGGLCEFGVAVATSDIENLFVISAGHTKLSPSELLRGENFRSMLDEARKQFDVIIVDTPPMS
MVTDAELIYPAADFSLFVLHYGKHSMDEISEAMTKMKRFGEKPKAFVMNHCERETGRYGYGYGYGYYGYYSKKK
>gnl|bykdb|A0A2P6UPN2 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWRM] (length=715 residues).
MQTITNQDVANSTQKAEDEIDLLELAGILIAKWPVLLLFILLGGGIGFFVANFLRPSYSSDALLQVDQNGKTAGLAMGEM
GALLDVASPSDAEIELIKSRRVLDEVVELEHLAYSAKPVAFLPRLLHTEGRVDVEFLHIPEIARTEKWMLMASADSALSN
SEFSIIDPMEKVILQGKVGDTYRIPVMGDTFAIRISQMNALPEEKFELTELDPRTALDILKKQLVVSEMGKKTGIIQMQI
AHRYPDRAASILNSIADTYVRQNVEARSEEATKTLAFLEKQLPGVKAKLDSSEQVLSTYRKDEGSVDLNGEARNALEKRM
ELEKQLLELQQKHQEVSRLFKEDHPNVISLKKQQAQIRREMAKLSDETKDLPEKQQEILRLQGDVEVNNSIYTNMLNNIQ
QLRVVQAGEVGNARIVDRARMEIRPVKPQKSVILLGSIVGGFILGAVFVFLYRMIFNRGIRTSRELEQATGVSVYAKIPE
LKERKKSFTLIEEGGEDIASEALRILRTSLEFSMGVGKVLLITGCVPNCGKTFISKNLAALYAASGKKVLLLDTDFRASE
LSPRGRKHGLSDYLLNKISLDEAIDHLEKLGFDLIGAGSYTSSPTEMLASSAFGDLISQMRNRYDLIILDSAPILSVADA
LTTSRYADFVLVAVRYAKDSLEGVEEALSLLDKAEVKNRALVINRILSDEISHYGYGYGYGYGYGYKKKYGHKKS
>gnl|bykdb|A0A316ANB4 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWR4] (length=701 residues).
MASTSKKEETDILDLFKELLNNWKIMIPCIFLAGVVGVIVAMWIRPIYQVDALLQIENKNSKGPAASMMGGLASLFASAS
PAETEIELINSRQVIGDAVEKMHLQYVATPTNKLDRLLHKEGRMELNQFIVPGNVMPKEEKHDPWIAKVIDSTTFEVYDH
NHQKVVTSGKVSQTYHIPYGQDTVVLSVYRMIARAGQEFELSQVERLESIEAFKHAFGVKERGKKTGILEFSYQDIYPDR
ATEVLNEIATNYLRQNVEQRNAEAQKTLEFLEKQLPEVKAQMDSSLLKFNTYRNRVGSVDINAETRIVLEKRAKLQQDLL
SLQQKKQDAIRLFQPEHPTVKTLEEQENALKRELSTNSSEARRLPATQQEVLKLTNEVDMSKIMYTSMLNNIQQLKLVSA
GEVGSVRIIDFAEPVNKPTKPKKKIILLVALFIGFLVGATIVSIKSKLSSGVKDANFIERETGYSVYAKVPKGNPNGTKG
TRPLAVVEPDDVAVESLRALRSSLEFSMDDTMRQIIGVSGLIPGVGKSFISVNLAALYAGLGKRVLLIDADLRKGRLHKE
FGLSRDKGLSQILLGEINAQDVTYETEVENLYVMPCGKSPTNPSEILGSKHYAELIESLEKQFDLIIVDTPPIMLVTDAA
LACRFASQVVMVIEYNKHSINAIKDGMAHLLKGNNSAHASFVINKYEHSHADGYGYKYGKY
>gnl|bykdb|A0A316ATY6 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWR4] (length=712 residues).
MDSNDQKNSVNQASEPLKTDDSIDLLEVIGILWAKKHIIFVFLLMGGLFGFLLMNWIRPEYTSDAMIQVDIRGNKVSRAM
GEMGALLDMASPSDAEIELVKSRSVLAYVVEEEHLRFNAVPIGKMDRLLHREGRMDIDELDIPEIARKEKWIAQVTGVNS
YEVITPEGAVLAKADIGETIRAPYAGDTLVMRVRLMRGIEGQQFVLRQLTPLSAIRSLAHKLSVSEKGKQTGIITVSLKH
RYADRSASILNAIADTYVRRNVEKRNAEAEKSLKFLEKQLPSIKAKLDSSEKILADYRHKIGSVDLTGETQVHLQKEVDL
QKQLLKLDQQYQEATRLFKQEHPAVQTIAKQQNKLRAELAKLKANAEKMPLTQQEVLRLQEDVQVNNAIYNTMLNNIEQL
RVVRAGEVGNVRVVDYAMVEDRPSKPKKTHILMGAIAASFVMAALLIYLLRMLHNGVRSSTEVENTTGVSVYAKIPEHHG
KSSKSKKRRPIVITDPEDRVSESFRSLLTSVDFTLPTQGHPVMMISGLIPGVGKSFVSLNLAALYAEAGKKTLLIDADMR
RGVHHSGSKMGLAELLGGTCELAAVAKPSPEAENLFIVSSGHSRLSPSELLRGDNFKNLMDEARKQFEVVIVDTPPMSMV
TDAELIYPVVDMSLFVLHYGKHSMNEIKESVNKINRFGDKPKAFVMNHCEREAGKYGYGYGYGYYGYYSKNK
>gnl|bykdb|A0A316B5S0 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWR4] (length=721 residues).
MDLNSQNNLQSVNQVSVVPTKDDEIDLLEVLGILLKHKVFLILCVIVGCGIGFLASNWARPQYTSDALLQIDVKGNKAGK
AMGEMGALLDVANPAEAEIELLKSRMVLSYVVQKENLCFNAYPKDPIKRLTHTEGRMDLENLHIPEIAITEKWMARTIDD
STYAIITPEETELARGVLGKELVAPYGGDSLVILVKRMRAEPDQMFVLVESDPLDAVRSLVKQLNVAEKGKQTGIIGVSF
THQYPDRAAAILNSIANVYLRQNVEMRSAEAEKTLEFLEQQLPGVKAKLDSAEKNLADYRHKIGSVDMTGETRAHLEKDA
ALQRQILELEQQRQEATRLFKEEHPSVQTIVKQQNRLRAELSKLKNSAEKMPLTQQEVLRLQEEVAVQNAQYTSMLNNIQ
QLRVVRAGEVGNVRVVDYAQIERKPSKPNKKMIFLGCVAGAFLLGALLIYLLQMTKRGVRSSLEIERATGVSVYAKIPES
DNNILHHRKKGKNTLPLVEQSPDDPASEAFRSLYTAIDFSIANQKVVMVTGMVPGVGKSFVSKNLAALYATNGKRVLLID
ADMRRGVVYSKHRQGLGDVLSGKVPLDNVISETLVKNMFALGAGNSEVAPSELLRGENFKRLLEDAKSQFDMIVVDTPPL
NLVTDSELIYPVVDFALFVLHYGRHSMEQIKESMIKVERCGDKPHAFVMNHVEHDGRGYGYGYGGYGYGKYGYYSNRKKK
K
>gnl|bykdb|A0A316BGL2 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter sp. UWR4] (length=714 residues).
MKETVATPVTPTTINLTGIQNIKPNGSFSLVKAIETLWKERWLLLMFILVGAAVGVFIGNWARPQYSSDALLKLEVKSAK
SSKPTDVLDFFFEKASPADAEIEMIKSRKVLSYVVDAEGLCFNAVPVGIVDRLRNNEGRMDVQSLVLPAERRKGWTAKIV
NDRSYVVYGPDGNSVMKGEVGKESVGKFKGDSVSILVSKIKGQPGQEFDLQITTPLKAARSLAQQLKIEEKGKLTGIIGI
TYAHRYPDRAMSVLNSLTDVYLNQNIEMRSAEAAKTLQFLEEQLPSVKARLDSSEKKLADYRQSIGSVDVSVESQALMKK
EHDLNVQIMNLEAKRQEATRLFKSEHPSVQTITRQLSRLRNELSKLKTDAEKMPLTQQEILTMQEEVAANNAQYTSMLNN
IQQLRTVRAGEVGTASVVDYAVEDSEQIKPRKAVIFLWSVAIAFAIGVLLVVFIRLFRNGVRNSLEIERRTGISVYAKVP
ESGNRDLKKKDRKGTLPLVCSNPEDPASEALRSVFTSVEFSATADHPVIMVAGLVAGVGKSFVSRNLAALYANFGKKVLL
IDVDMRRGVVYSKNAQGLADILSGKRSFDECLSKTDVEGMWVIGSGKPLQAPTDLLHGETFAELLKFAKQNFDVIVLDTP
PINLVADTELVLPLVDFSLYVLHYGRHTMDEIDEAVNKIERLSEAPRAFVMNHCDRDLGSRYYYNGYGYGFKKK
>gnl|bykdb|A0A380RVE7 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter succinogenes] (length=712 residues).
MAESEQQTIVVGAQQMQAENTITLLEALFILWKRRFLLLLFLAFGAIVGVLIGMWIRPQFTSDALLQIDVKGNKAGKAMG
EMGALLEVASPADAEIELIKSRMVLSYVVSQEHLDYSAAPLSAMNRLLHKEGRMDIDYLEIPELARAERWIAVVTGADTY
DVYTPEETKLVGGKVGDLLKAPYAGDTLCIRVNLMRATVGERFAIGQSNTLLAVRGLASSLKVAEKGKQTGIIGVSYSHR
YADRAASILNTIANTYVRQNVEMRSAEAEKTLEFLESQLPGVKSKLDSAEKVLADYRHQIGSVDMTGETQAHLSKEMDLQ
RQLLQLEQQRQEATRLFKEEHPAVVTIVKQEAKLRRELSRLKKNAESMPITQQEVLRLQEDVAVNNALYTNMLNNIQQLR
VVRAGEVGNVRIVDFAQIEPIQSKPKKLNILICSMAASFMLGVLLVFLLRMMKNGVRSSQELEHATDVSVFAKIPVSKNK
VVRNKHNAMTLVESSPNEPASEAFRTLQTAIDFSLSEGQKVIMICGLVPGVGKSFVSKNLAAVYAMNGKRVLLIDADMRK
GVIHSSKHVGLTEVLSGKVDWHEAVSDNRCQNLFVMGGGKRLMSPSELLRRDTFKNLLEEMKSEFDMILVDTPPVSMVTD
AELIFPLVDFTLMVVHYGTDSLAQVKESLANLRRYADKPCAFVMNHCEYEPGHYYGYGYYGGGYYGKGYYSK
>gnl|bykdb|A0A380S6W7 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter succinogenes] (length=698 residues).
MAASSKKEETDLFDLLKDLAKNWKIMIPCLIVSGIIGVFVALWIRPIYQVDALLQIESKNNKSMGMTGGLGNLFATTSPA
ETEIELIKSRQIIGEAVEKMRLQYVATPINKLDRLLHHEGRMELNNFDFPWETLPKEEKIKPWIAEVTDSLTYDLYDHHN
KKILSGQIGQTYRVPYANDTLIFSVLNMKATAGQRFELGKMERLDAIDKFKGAFDVKEKGKKTGILEFSYQDIYPDRATK
ILNEIATSYLRQNVEQRNAEAQKTLEFLEKQLPDIKAQMDSSLLKFNTYRNKVGSVDIGAETQIILEKRNKLQQSLLDLQ
QRKQSAIRLFQPEHPTIKTLEDQENNIKRELASNYAATKKLPNTQQEVLKLTNEVEMSKHLYTTMLNNIQQLKLVSAGEV
GSVRIIDFAEEVSRPFKPKKGMVVFISLFLGLIFGAVIISIKSKLNSGVRDANLIERETGFSVYAKVPKGNPNGTKGTRP
LAVVEPDDVAVESLRALRSSLEFSMDEGVHTIIGVSGLIPGVGKSFISVNLAALFAGLGKKVLLIDADLRKGRLHKEFGI
KRGKGLSQILLHTATLEDVISSTEVNNLDVIQCGNVPSNPSELLGSKHYSTLIENLKNQYDLIIVDTPPIMLVTDAAQAC
RVASQIVMVIEYNRHSIEAIKDGMKQLLKGNEEAHASFVINKYEHGHNDGYGYKYGKY
>gnl|bykdb|A0A380S7L2 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter succinogenes] (length=706 residues).
MNEKMTQNASNASADDEIDILEILVYLKGKWKFLLIFLFLGVVFGGLVSMWLRPSYRSDILLQVNVKGNKQGLALGEMGA
LLDVSTPSAAEMELIKSRVVLDHVVNEEKLCFSAIPLNKQDRLLHHEGRMDLELLVIPRAFQEAKGKLVARVTADSSAYE
VIGLEGEVVLSGSVGETYRKPFAGDTLVICVRSLTATVGQTFLLSAVHPQIAAASLLKGLSISEEGKNSGIIRVSLENRY
ADRVAAILNTIANTYLKQNIEMRSAEAKKTLAFLEEQLPGVKAKLDSAEQKLTSFRNSKGTIDLTGETRVHLEKDVSLQQ
RLIELEQKKQEALRLFRAEHPTVRTIEEQQSRLRRELAKQQRSAATLPVVQQEVLSLQEEVEVNNKLYTNLLNNIQQLRV
VQAGEVGNVRVVDKAYEPLKPSKPNRKLIFLGVVAAFLLLGCFIVYIRRMLANGVCSSSEVEQATGVGVYGKLPMLDGKT
QNDVMKPCVSVKPDDPFAEGIRALRTALEFSVFSDGKKVLMVSGLVQGVGKSFVSTNLAASFAMSGKKVLLVDMDLRRGH
LFKHSQKGLCEMLEKEDYSDEYVVKVTDNFYVLGSGARVVNPGGLLNSSRFSAFLDAFKDKYDLIVLDTPPVFQCSDALL
VEKHADYLLCVLKHAAHTIESIQDALNTFDRSTETPLQKAFVFNKCERHAGYGYGSYGYYGYHKKY
>gnl|bykdb|A0A3C0PHK7 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacteres bacterium] (length=755 residues).
MVRLENRTYDDQQCAYASGYHSGVERGFQMIGNNTTDSQLKGEIGVKDYLNIMMRRKWIIIASLLSVAFSTFFYVSKIKD
VYESFSTIVIEEKNIAISQATNTMNTGGRSVDFYQGILESRTFQEMLADSIGLNVLKANNPKLTREQAIKNLHSSLTLKS
TEYASFLRLNARSETQELAFLTASIGTDVFRKRCEEVESEESRRSMIEIDNQLKLVRDKLEQAERDYQTYKERTGNIAGG
TTPELKTLQEASATNIAQLGLKEADLTAEKKQLALMEATITPAEEERSPEFLKLRSRLHELEQEKMRLENLGINMVGSST
VDREIQEVERQLLQYKKSKEPVAIDPRVVVQWQELRKSVLNKENDLELFKRRLESYNNAIKKYKNKNPDILTNSLELLRL
QRSSEVYQNVYNVLLEKAEEERMLNTSSSAGIKIVDIARKPDNPMPKNENRYYAVGIILGLFLGIALAMILEFNDTTIKS
NEDVERYLGESILGTIPHIAHNKKDDIQIKRRSAKSKHAMSVVQYPRQILNFSGDDSVITESYRSLRTNLSFVSPDSPIH
AVLVTSAGPGEGKSLTTANLAMAYAQMGKKTLLVDTDLRRPVIHHFFNMKREPGFSDLFIENPDYEHVIRSSKKENLDVV
TAGVFTPNPAELIGSNKMGQHIEYFKKNYDMVFFDTPPIVAVTDATLLGKKVDGVLLVVKSHHSDREFVSRALATFTNVG
IKVWGVILNDIDLTHRYSSYGYYKYYYHYYKSKKD
>gnl|bykdb|C9RP30 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter succinogenes] (length=718 residues).
MSEKEEQKVISQPTAIQVPQNANTITLLEALEILWDKKFILALFLIVGGAVGYCVANWLRPQYTSDVLLQIDVKGGKSGK
AIGDMGALLDVASPADAEIELLKSRMILSYVVDVEHLCFQATPIGAADRFLHHEGRMDLDSLYIPQIARAEKWMARVTGD
DTYEVISPEEQVILEGKVGEMHRAAYAGDTFDIQVSRMLAQPEQMFILSQISDLGAMGALKASLKVAEKGKQTGIIEASY
NHRYPDRAAAILNTIAKTYLRQNVEMRSAEAAKTLEFLEKQLPGVKAKLDSVEKILADYRYSIGSVDMTGETHAHLNKES
EIQRQILDLEQQKQAAMRLFKEEHPSVQTLIRQQNRLRAELAKLKKTAEKMPLTQQEVARLKEDVAVNNEIYTTMLNNIQ
QLRVVRAGEVGNVRIVDFAQINGAPSKPKKMNIIICSVAASFMLGVLLVFLLRMMHNGVRSVTEIERETNTSVLAKVPQN
PDTGLNLKFRKTRKTHVQTDPDDPLSESIRSILTAIDFSFNMNKEHQVIMVSGIMPGVGKSFISTNLAATFAMVGKKTLF
IDADMRKATCRFTKVGLVDVLMGKVAFDNAKITSPNLPNLDILESGKFTLSAFELLRGDMLKKLIDEIRPQYDAIIIDTP
PTNLVTDAYMICPLIDFALVVLHYGRHSMDSIKESLHTLERYCDKPKAFVLNHCEHRHGYGYGYGYGYYGSKSKKHKN
>gnl|bykdb|C9RRK0 [Bacteria] Bacterial tyrosine kinase [Fibrobacteres][Fibrobacter succinogenes] (length=706 residues).
MNEKMTQNGSNASADDEIDILEILVYLKGKWKFLFIFLILGVVFGGLAAMWLRPSFRSDILLQVNVKGNKQGLALGEMGA
LLDVSTPSAAEMELIKSRVVLDHVVKEERLCYSAIPLDKADRLMHREGRMDLELLEIPRAFQEAKGKLIARVTADSSAYE
VIGLEGEVVLAGAVGETYRKPFAGDTLVICVKSLTATVGQTFLLSAVHPQTAAAGLLKGLGISEEGKNSGIIRVSLEDRY
ADRVAAILNTIANTYLKQNIEMRSAEAKKTLSFLEEQLPGVKAKLDSAEQKLTSFRNSKGTIDLTGETRVHLEKDVSLQQ
RLIELEQKKQEALRLFRAEHPTVRTIEEQQSRLRRELAKQQRSAANLPVVQQEVLSLQEEVEVNNKLYTNLLNNIQQLRV
VQAGEVGNVRIVDQAYVPLKPSKPNRKLVFVGVVFAFLLLGCLIVYVRRMLSNGVCSSSEVEQATGVGVYGKLPMLDRKT
QNDVTKPCVVTNPDDPFAEGVRALRTALEFSVFCDGKKILMVSGLVQGVGKSFVSTNLAASFAMSGKKVLLVDMDLRRGH
LFKHSQKGLCEMLEKEDYSDEYVVKISDNFYVLGSGARVVNPGGLLNSSRFSAFLDAFRDKYDLIVLDTPPVFQCSDALL
VEKHADYLLCVLKHAAHTIESIQDALNTFDRSTETPLQKAFVFNKCERHAGYGYGSYGYYGYHKKY
© 1998-2019