BYKdb

Dataset for cluster orphancd of phylum firmicutes

[Download (right click)] [Alignment] [Repertoires]

4116 sequence(s)

>gnl|bykdb|A0A010ZC45 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. ASBs410] (length=232 residues).
MRKVSFRRKDKLDFKANEAFKTLRTNILFSGKDIKVLTLTSSTPNEGKTSISFQLASSFAAADNRVLFVDADIRKSVIAG
RYKVDGNTYGLTHYMTGQRSMEEVICQTDIKNMDIILAGPVSPNPTELLGGPLFAKLLEEQRDNYDYIIVDAPPLGSVID
AALIARYVDGAIIVVESAVISYKMLQRVKEQLEKSECRILGVVLNKIDMEHDAYYGNYYGKYYGKYYGNYGE
>gnl|bykdb|A0A011QU98 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Alkalibacterium sp. AK22] (length=233 residues).
MIFSKKKKADTGERPGLVVVNKPSSVVSEQFRTIRTNIQFSMVDEDLKTVVVTSAGPASGKSTIAANLAATFASKEKKVL
LVDADLRKPTVHKTFKVRNTDGLTTLLTDRNAHLDEMIYRTHTEGLYTLTSGAIPPNPAELLASKRMEEIKQEMLALFDL
IIFDMPPVLAVTDAQVMATKADGVLFVIPQGSANKDEVMKAKDLLEKVQANVLGAVLNRVDKSDDSYYYYYGE
>gnl|bykdb|A0A011RN54 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Alkalibacterium sp. AK22] (length=231 residues).
MSVNSHKHRVDKQTAIIVKTKPGSVVSEQFRTVRTNIQYSMVDKSLKSIVITSAVQGAGKSFVAANLSSTFALENKRVLL
VDADLRKPTVHRTFNFNNHSGLTTLLTHPNEALSDLVYLTDMGNLSVLTSGPIPPNPSELLATKRMEELIEMMESEYDLV
IFDMPPILAVTDAQIMSGRVDGVIFVIPNGKATKDEVMKSKKMLDMIHANVIGAVMNRMVPSKHSHYYYKE
>gnl|bykdb|A0A017RSD4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Fervidicella metallireducens AeB] (length=249 residues).
MEKINLITYNSPKSPITEAYRTLRTNIQFSSFDEKVKVIVITSTGPGEGKSTTSSNLAVTMAQGGNKTLLIDCDLRKSML
HRKFNLSNEIGLTNLLVDELNLDRVIQNTRVENLSILTAGTKPPNPAELLGSEKMSSFVQEMKKIYDYIIIDTPPVIMVT
DAQILSQYADGVLLVVASGEAEKDAVLRSKELLQKVDAKILGVVLNKIDASSKGRYNYYYQYYYGNDVKNIDDKRKNKLL
SIFTNKRSK
>gnl|bykdb|A0A017RXI2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Fervidicella metallireducens AeB] (length=226 residues).
MIMHRKPKSPVAEAYRTLRTNIQFASFDKDIKTVVVTSSGPTEGKSTTAGNLAISMAEMGKKVLLIDCDLRRPSIHKKFK
ISNQEGLSNLLVENAKVEDVAVKFMDNLLILTSGKIPPNPAEMLSSNKMRNFISEMKEEFDFIILDTPPVIAVTDAQILS
TMADGVLLVVSSGQAEREAVERSKTLLVNVGANILGVVLNKVEINSRRGYGYYYYYGNEKEGNKVK
>gnl|bykdb|A0A023CJC1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Parageobacillus genomosp. 1] (length=231 residues).
MAASNRKKFQKMERNLITLDDPKSPISEQYRTIRTNIQFSFIDEKMRSLMVTSSSPSEGKSTTAANLAIVFAQQGKKVLL
IDADLRKPTMHYTFRLNNYTGLTSVLTHSSSLLSACQETNVENLYVLTSGPIPPNPAELLSSKMMDNCLQQLHESFDLII
FDTPPVLAVTDAQILANKCDGTILVVASGKTEIGAAVKAKELLAAANAKLLGVVLNQRKQREGHHYYYEYK
>gnl|bykdb|A0A023DB77 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Parageobacillus caldoxylosilyticus NBRC 107762] (length=231 residues).
MARSNQKQTKKLERSLITIEDPKSPISEQYRTIRTNVQFSFVDAPMRSLMVTSAGAGEGKSTTAANLAVVFAQQGKKVLL
IDADLRKPTVHYTFRLNNYTGLTNILTNSAPLLPSCQETRVENLYVLTSGPIPPNPAELLSSKAMEQCIQQLYNEFDLLI
FDTPPVLAVTDAQILAHQCDGTVLVIESGRTEIEAAVKAKELLEAANAKLLGVVLNKRKHRQGQYYYYQYK
>gnl|bykdb|A0A023PE61 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus bombysepticus str. Wang] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASVLVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A023VJQ8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus iniae] (length=239 residues).
MSQLNLVRSKREHYQHAEEYYNSIRTNIQFSGRDYKAIVLTSVQPGEGKSTTSINLAISFAKAGFKTLLIDADVRNSVMS
GAFKSDDRYEGLSSYLSGNAELSSVISRTDVPNLMLIPSGQVLPNPTTLLQNSNFNFMIDTVKELFDYIIIDTPPIGLLI
DSAIIAQKADATILVTEAGSIKRRFVQKAKEQMEQSGAQFLGVILNKVDQQLGSYGAYGSYGDYGKTKKSSKSKKHSRK
>gnl|bykdb|A0A024DFW7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. VT 162] (length=227 residues).
MPTLEIAHKKLDQARKAEEYYNALRTNIQLSGNNLQVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSQGLCETNVENLFVIQAGSVSPNPTALLQSENFATMIDTLRKYFDYIVVDTAPIGVVI
DAAIITQQCDASVLVTAAGETNRRDVQKAKEQLEQTSKPFLGVVLNKFNTSVEKYGSYGAYGNYGKK
>gnl|bykdb|A0A031IFB9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Exiguobacterium sp. RIT341] (length=231 residues).
MAKKSKMNKDARKLITVTQPKSPVAEQYRTIRTNIEFMAVDREIQAILVTSATQGEGKSTTSSNLAVTYAQQGKKVLIVD
TDMRRPTVHYTFRVANGLGLSSLLTRQAEKEKAILPTKVDNLSILTAGPIPPNPAELLSSRAMEHLVAQLREEFDVIIFD
APPLLQVADSRITSKLTDGVVLVVGCTTSDRQRVLKAKEQLELAEAKILGVVLNRRELTDDSAYQYYYSYE
>gnl|bykdb|A0A037ZBB8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium tetanomorphum DSM 665] (length=245 residues).
MGKVDLISVKDPKSPISEAYRTLRTNIQFSSFDKKIQTIVITSSGPGEGKSTTSSNLAVVMAQGGSKTIIIDCDQRKPRL
HKLFSLSNESGLSDLLAGNTEFSQAVHKTEIENLDILPAGTRPPNPSELLSSKKMGSFIEELRGEYDCIILDTPPVIAVT
DAQLLASKADGCVLVLSSGEVEREAAMKAKELLEKVQAKIIGVVLNKLEVSEKGYYGYYYHYYYGNDGEKIKKKKSKNSK
EDLAV
>gnl|bykdb|A0A059NV95 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Halobacillus karajensis] (length=231 residues).
MARKNKKAANSVGRSLIADINPKSPIAEQFRTIRTNLQFTSVDKELETMLVTSASPSEGKSITTANTAVVFAQQGKKVLL
VDADLRKPTIHYTFRVNNTKGLSNYLVGDQPVYKLVSQTEIENLDTMTCGPIPPNPSELLGSKKMQTFIDEAKETYDMII
FDTPPVLAVTDSQVLSKFVDGCMLVVRSKQTDKEAAAKAKEHLEQTKANLLGVVLNDQDIKSSNYYYYYGH
>gnl|bykdb|A0A060LYA2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus lehensis G1] (length=231 residues).
MVRSTRTKKGQGQKKRQLIADVNKHSPITEQYRNIRTNIEYSAIDTDIHSLLITSAGPGEGKSTTASNLAVVMGQNGQRV
LLIDADMRKPTAHYTFSLMNTHGLTNVLTRQQKLVDVAQETSIENVSLLTCGPVPPNPAELLNSKMMEMVIKEACENFDM
VIIDTPPVMAVADAQILSSKVDGTIIVTSSGKTDRDQLEQTKANLVKAKANILGVVLNNKPIDQNTYYYYQ
>gnl|bykdb|A0A060QT77 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MPTLEIAQKKLEFVKKAEEYYNALCTNIQLSGDKLKVISVTSVNPGEGKTTTSVNIARSFARAGYKTLLIDGDIRNSVMS
GFFKSREKITGLTEFLSGTADLSHGLCDTNIENLFVVQSGTVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTAPIGIVI
DAAIITQKCDASILVTATGEVNKRDVQKAKQQLEQTGKLFLGVVFNKLDISVDKYGVYGFYGNYGKK
>gnl|bykdb|A0A060RGH9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus gallolyticus] (length=246 residues).
MPQLELVRAKAQMVKSMEEYYNSIRTNIQFSGRDLKVITLTSAQPGEGKSTTSVNLAISFARAGFRTLLIDADTRNSVMS
GTFKSNERYQGLTSFLSGNAELSDVICDTSIDNLMIIPAGQVPPNPTSLIQNDNFKAMIETVRGLYDYVIIDTPPLGLVI
DAAILAHHSDASLLVTKAGEDRRRTVTKLKEQLEQSGSVFLGVILNKYDIHLDKYGSYGSYGGYGSYGNYGKSEEKTKIG
RGKRKK
>gnl|bykdb|A0A061CBF2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus delbrueckii subsp. lactis] (length=260 residues).
MALFGRKNHLDNETIKNGAKLITLANPQSVISEQFRNIRTNINFMNVDKEVKTIAFTSAMASAGKSTVSANVSITMAQAG
KKTILIDADLRRPTLHSTFNVSNSNGLTTLLTSRSKEMDANSVIRKSGVENLSILTAGPIPPNPSELLSSKHMLDLIEDL
KQEYDMVVLDLAPILDAAETQQLTSSLDGTILVVRQAYSQKSAVKRAVELLKLTKSPILGYVMNDVDADGDGGYGYGYGY
GYGYGYGEEKEKKGLFGRKK
>gnl|bykdb|A0A061CJK3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus delbrueckii subsp. lactis] (length=258 residues).
MAFGRKKHLNNDTMKNGVKLITLANPQSVISEQFRNIRTNINFMNVDKEVKTIVFTSAMANAGKSTVSANVAITMAQAGK
KTILIDADLRRPTMHATFNVSNSNGLTTLLTSRSMEMDANRVIRKSGVENLSILTAGPIPPNPSELLSSKHMLDLIVEDL
KQEYDMVVLDLAPILEAGETQQLTSSLDGTILVVRQAHSQKSAVKRAVELLKLTKSPILGYVMNDVDADGDDGYGYGYGY
GYGYGEEKEKKGLFGRKK
>gnl|bykdb|A0A063XHQ3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus subtilis] (length=227 residues).
MIFRKKKARRGLAQISVLHNKSVVAEQYRTIRTNIEFSSVQTNLRSILVTSSVPGEGKSFSAANLAAVFAQQQEKKVLLV
DADLRKPTINQTFQVDNVTGLTNVLVGNASLSETVQKTPIDNLYVLTSGPTPPNPAELLSSKAMGDLISEIYEQFSLVIF
DSPPLLAVADAQILANQTDGSVLVVLSGKTKTDTVLKAKDALEQSNAKLLGALLNKKKMKKSEHYSY
>gnl|bykdb|A0A063YHW7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Geobacillus sp. CAMR5420] (length=232 residues).
MARKPATSIRKAERRLITVDNPKSPIAEQYRTIRTNIQFSFIDAPLRSLIVTSTGPGEGKSTTAANLAVVFAQQGKKTLL
IDADLRKPTVHYTFRLNNYMGLTNVLTGSAPLLSTCQATEIDHLSILTSGPIPPNPAELLSSNAMAQCLEQLYETFDLVI
FDTPPVLAVTDAQILANQCDGTVLVIESGGTEIEAAIKAKELLEAANAKLLGVVLNKRKHRDGGYYYYYQYK
>gnl|bykdb|A0A068NE48 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLITHQQPKSPISEQYRNIRTNIEFAAVDKNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSTYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTDKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A069DFE7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. TCA20] (length=229 residues).
MPRSTSNQHNLVTAVNPKAPISEAYRTLRTNIQFSAIDDQIKVLMVASAQSGEGKTTTVSNLAVTYAQEGKKVLLIDTDL
RKPSLHQVFTVSNHAGLSSAIAAQYPVQEVLQKTAVHNLDVLPSGPIPPNPSEMLGSKKMTALLEERKEMYDIILFDTPP
VLAVTDAMIISSLCDGVVLVVNSGKVKKDLVKKAKGHLEHVNARILGVVLNNLQLSKNQSNYYYYYGER
>gnl|bykdb|A0A069RKE1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Peptoclostridium litorale DSM 5388] (length=257 residues).
MNLLNELIVYQKPKSPISEAYRSLRTNIEFANVDNDKKLILITSSKQAEGKSTTVANLAVTMANMGKKVVIVDGDLRRPR
VHKIFGHTKIGGVTEILLSHCSYKGCVKKTEVENLDIITSGQTPPNPSEMLSSNSMKQILEEVRNDYDYVFIDSPPVAAV
ADAVILSGMADGVVLVCACGRVEVDMVRNTLQALENAGAYVIGSVINNIDVHDKKSGYYYYSPSYYGYCEDSNEKRKRKK
RKKKQAQSGLKAASGND
>gnl|bykdb|A0A072NPK6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus azotoformans MEV2011] (length=235 residues).
MNLRRKKKLNTTNSKFRSLITHFDKKSPISEQYRTIRTNIEFSAVDKSYKTIVVTSSGPGEGKSTTTANLAVVFAQQNKK
VLLIDGDLRKPTVHYTFQLDNTIGLTNILTGQSTCDAAVKSSEVEHLSVLTCGPIPPNPAEMLGSDAMKKLLEHVAEQFD
IIIIDSPPVLAVTDAQILANLTDGIVLVTKSGQTEYDMAIRATELLKNSRAKLLGAVLNHKDQKQSNYYYYYGNK
>gnl|bykdb|A0A072XGX5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium botulinum C/D str. BKT12695] (length=234 residues).
MLIVEKEPKSIAAESYRTLRTNIQYSSFDKELKTIIVTSSGPSEGKSTTSGNLALSMAQSDKKVLLIDCDLRKPTVHKKF
HISNEKGLSNYLVGEVSFEEVVVNYNENLYLLPAGTIPPNPSEMVASKKMKKFLESLKENFDYIVIDTPPVIAVTDAQIL
STIVDGVLLVAASGQAEKEAAIRAKELLLKVKANILGVVLTKVPLNEGKGYGYSYYYYYGDEDEKSKKRRKSKK
>gnl|bykdb|A0A074IX11 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus salivarius] (length=246 residues).
MPLLKLVKSKENFAKQTEEYYNAIRTNIQFSGAQMKVIAVSSVEAGEGKSTTSVNLAISFASVGLRTLLIDADTRNSVLS
GTFKSNEPYKGLSNFLSGNADLNETICQTDISGLDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPIGLVI
DAVIIAHQADASLLVTAAGKIKRRFVTKAVEQLEQSGSQFLGVVLNKIDMTVDKYGSYGSYGSYGEYGKKSDQKEGHSRA
HRRRKG
>gnl|bykdb|A0A075JRS9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Virgibacillus sp. SK37] (length=233 residues).
MARRKNQSRPNNKMRHLIAKLNPKSPITEQYRTIRTNLQFASVDEELTSMLVTSSGPSEGKSMTTANLAVVYAQQGKKVL
LIDADLRKPTVHYTFRLDNLRGLSNVLVGEHTVEETVNRTDVDNLDVISSGPIPPNPSELLASRKMQTFLDDAKQSYDLV
IFDTPPVLAVTDSQILANIVDGTLLVIRSKKTELEAAQKAKEALEPAKAKLLGTVLNDREKKGSNYYYYYGTN
>gnl|bykdb|A0A075KI59 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pelosinus sp. UFO1] (length=230 residues).
MTTTRKLIVHEDAKSPVAEAYRTLRTNIQFSKTDGELKSIMFTSTGPGEGKSTTTANTAVALAQSGKQVILVDCDLRKPV
QHKIFGKKNRGLTNILVEEVMADTYIQDTQVENLRLLSSGPIPPNPSELLGSIKMLELIDYLKNQADYVIIDAPPVIAVT
DASVLASRVDGVTLVINSGFVRPEMAQKAKDLLVKANGHLLGVILNRVEIEEEHAYYYYYYGSDSKKIAK
>gnl|bykdb|A0A075LU31 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Terribacillus goriensis] (length=230 residues).
MAKRKKQFKTNVRSLITKFNPKSPISEQYRTIRTNIEFASVDTAMRSLLITSSGPSEGKSSTTANLAVVFAQQGKKVLLI
DADLRKPTVHYTFKLDNRAGLSTVLVGEKPLEEATKETDVPNLDILTCGPIPPNPSELLGSNAMKQLIKKAQETYDMVIF
DTPPVLAVTDAQILANTCDGALIVVRSEKTEYDAIQKAKELLEPAHAKLLGIVLNDVAQKKSNTYYYYGS
>gnl|bykdb|A0A075SHU0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis 6407] (length=228 residues).
MATLEIARKKKELVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLALAYARSGYKTVLVDADIRNSVVS
GFFKPMTKITGLTDYLAGTTDLSQGLCDTDIPNLTAIESGKVSPNPTALLQSKNFENLLATLRRYYDCVIVDCPPLGLVI
DAAIIAQKCDAMVLVAEAGNVKRSSLKKVKEQLDQTGTPFLGVILNKYDIATEKYGEYGNYGNYGKKA
>gnl|bykdb|A0A077J9G2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. X] (length=233 residues).
MVRKNKKKLVQNNKRSLVTMFNPKSPISEQFRTIRTNIQFSSIDQEVRTLMITSSGPGEGKSTTAANMAVVFAQQGRRVL
LVDADMRKPTVHYTFNQLNTYGLTSVLTRQMTLEKAVKETNEKDLFVLTSGPVPPNPAELLSSMAMERFFREAQEQFDMI
VFDTPPLLAVTDAQILANKCDGTILVVASGKTDKDQLVKARDLLDSVQSKLLGAVLNNKEMKNTNYYYYYGTK
>gnl|bykdb|A0A077UJH7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=230 residues).
MTNTRRSTSSLIVHEQPKSPISEKFRGIRSNIMFANPDSAVQSVVITSEAPGAGKSTIAANLAVAYAQAGYKTLIVDGDM
RKPTQHYIFNLPNNEGLSSLLLNWSSYQESIISTEIEDLDVLTSGPIPPNPSELITSLAFANLYDTLLMNYNFIIIDTPP
VNTVTDAQLFSKFTGNVVYVINSENNNKDEVKKGKELIEATGAKLLGVVLNRMPKDKSASYYAYYGTDES
>gnl|bykdb|A0A077UW86 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=228 residues).
MSKKENTTTTLFVYEKPKSTISEKFRGIRSNIMFSKANGEVKRLLVTSEKPGAGKSTVVSNVAITYAQAGYKTLVIDGDM
RKPTQNYIFNEQNNNGLSSLIIGRTTMSEAIIPTEIDNLDLLTAGPVPPNPSELIASERFKELVDFFNKRYDIIIVDTPP
VNTVTDAQLYARAIKDSLLVIDSEKNDKNEVKKAKALMEKAGSNILGVILNKTKVDKSSSYYHYYGDE
>gnl|bykdb|A0A078M2N2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Jeotgalicoccus saudimassiliensis] (length=235 residues).
MFGKKNHRKFQSGPRELVVDRKPKSPVSEHFRTIRTNITYSNIDNPVKSVLFTSATPNAGKSTVAANVAVAYAQAGKNTL
LIDGDLRRPTTHYTFEMQNVRGLSTAIINELPLNEVTRESGIENLDVITSGPIPPNPSELLSSKKMNLFMKMVTDHYDMV
IIDSPPALAVTDSQVLSQLTDATILVTNVDDNNRDSILQAKELMEKADANIIGVVLNNKKMDNKKDSYYYYYGSE
>gnl|bykdb|A0A080UG06 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus atrophaeus] (length=231 residues).
MARKKTLRSLMSIRNIITMTEPKSLNSEQYRTIRTNIEYSSIDSQVKSLIITSAGPGEGKSTTAANLAVVFAQQGKKVLL
VDADLRKPTVHFTFRLDNADGLTSILLKQISFEQAVHPSEENNLDILTSGPIPPNPAELLSSKGMEDLLENIYECYDMVI
FDTPPLLAVADPQILGNYVDGSIMVVSSGKTDKEKAAKAKEVLATCKSKLLGAVMNGKKITKNSYYAYYGN
>gnl|bykdb|A0A080UMB5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus atrophaeus] (length=226 residues).
MGFRKKKAKRGLAQISVLQNKSLVAEQYRTIRTNIAFSSVQTNLRSILVTSSVPGEGKSFSAANLAAVFAQQEKKVLLVD
ADLRKPTIHETFQLENVTGLTNVLVGTCSLSETVQQTPIDNLYILTSGPTPPNPAELLSSKAMGDLILDIYDQYSLVIFD
SPPLLAVADGQILANQTDGSVLVVLSGKTKIDTVQKAKDALEQSKAKLLGALLNKKKLKKPDLYSY
>gnl|bykdb|A0A081BI99 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus oryzae JCM 18671] (length=247 residues).
MPLFRRKRKINNDSLKNGVGLVAIDDSKSIVAEQFRTVRTNIQFSSVDEQVQTLLITSSDPSEGKSTVSMNLAAVWAQQG
QKVLVLDADLRRPTVHRTFSLSNRAGLSTYLSHLASYEDIIQESGMENLSVITSGPIPPNPAELLNSKGLSDLLEQLKAN
FDVVILDAPPVNTVTDAQLLAHKTDGVILVVPQGIAEKSSVAHAVDMLKKVHANILGTVMNRFQSSKAAGYYGGYYGGYY
GVDEKND
>gnl|bykdb|A0A081LFN7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus zhangzhouensis] (length=227 residues).
MIFKRKKREKRDLSCISVLNPHSVIAEQFRTIRTNIEFTSIQTRLKSILVTSSLPKEGKSFTAANLAAVFAQQKKRVLLM
DADLRKPAVHEYFDLSHHTGLTNVLLNNCSLEEAILPTPIEHLELLPSGTIPPNPAELLSSSVMKQLFYEIEQQYDMVIV
DSAPLLPVADAKILANRTDGSILVVLSGKTKIAAVKKSKEVLEGTTGKLLGAMLNGKKEKKGRLYMY
>gnl|bykdb|A0A081NSB4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus reuteri] (length=250 residues).
MSLFHRTQQQSTDTIDNGAKLITVAHPKSPISEQFRTIRTNINFMAIDKPIKTLAMTSANVSEGKSTVTDNVAVVWAQTG
QRVLLIDSDLRRPTLHATFSKSNQHGLTTILTSGTNSVDLREIIQPSGVDNLDILTAGPIPPNPAELLNSQRMKTLLDTV
KGIYDMVIVDVPPMLEVTDTQILSRHLDAVVLVVKQGQTQKLAVKRAVELLNLAHANLLGYVMNDVNADGDAAYGYGYGY
GYGYGEDNGK
>gnl|bykdb|A0A081NZL5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus tyrfis] (length=226 residues).
MSKSAKRRPVIAHSHPKSPVSESYRTLRTNIQFSSVDRLCRTLMVTSSSPMEGKSTTINNLAVVYAQSNRKVLLIDADLR
KPTAHHTFHLSNRYGLTDVLTSQCTLEMAVKVTDIPNLEVMTSGSIPPNPSEILASQKMTGLLEELQQRYDIVLLDTPPV
LAVSDAQIIATKCDGVILVVDSGKVKRDLVQKAKNSLEFVQANLLGVVLNRIARPSGNAYYYYGNE
>gnl|bykdb|A0A081PNQ5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus mitis] (length=227 residues).
MPTLEIAQKKLDLAKKAEEYYNALRTNIQLSGNNLQVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLVDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSHGLCDTNVENLFVVQAGSISPNPTALLQSENFSTMIDTLRKYFDYIIVDTAPIGIVI
DAAIITQKCDASVLVTAAGETNRKDVQKAKGQLEQTNKPFLGVVLNKFNTSAEKYGSYGEYGSYGKK
>gnl|bykdb|A0A081PWY1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus mitis] (length=236 residues).
MPTLAIAQKRLDFAKKAEEHYNALRTNIQLSGDNLKVLSISSVKPGEGKSTTSINIAWTFARAGYKTLLVDADIRNSVMS
GVFKSREKITGLTDFLAGTTDLSNGLCDTNIENLFVIQSGPISPNPTALLQSENFHTMIDTLRKYFDYVIVDTPPIGVVI
DAAIITQKCDASILVTAAGETKRRDVLKAKEQLEQTGTPFLGVVLNKFNTEVEKYGVYGGYGAYGSYGNYGNYGKK
>gnl|bykdb|A0A081PYH2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus mitis] (length=227 residues).
MAKLELSQQKLNSVKKAEEYYNALRTNVQLSGNDLKVIVVTSVDSSEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSRERITGLTDYLAGTQDLSNGLCETNVDNLFVIESGVFSPNPTALLQSDNFGIMIETLRKYFDYIIVDTAPIGVVI
DAAIIVQKCDASILVVESGAAKRREVQKAKSQLEQAGKPFLGVVLNKFDVQREKYGSYGGYGNYGKK
>gnl|bykdb|A0A081Q1Y0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus mitis] (length=217 residues).
MYIEVIHNSKSLVAESFRTLRSNLQFSEFGKNIKLIVITSANPNEGKSEVSINLAASLAQQGKKVIIIDADMRKPTQHKL
TELNNTEGLSTFLLKRSGVDSINHLTINDVNLDVLTSGPVPPNPSEMLASSSMEETLRAFEDFYDYVIIDTPPLLAATDA
QVLASIADATLLVVDIKSSKRRQVVEAKRRLDHVGARLLGVVMNKIDSHKDTYYYYY
>gnl|bykdb|A0A081Q9T1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus mitis] (length=234 residues).
MPTLEIAQKRLDFAKKAEEHYNALRTNIQLSGDNLKVLAISSVKPGEGKSTTSTNIAWAFARAGYKTLLVDADIRNSVMS
GVFKSREKITGLTDFLAGTTDLSHGLCDTNVENLFVIQAGPVSPNPTALLQSENFHTMIDTLRKYFDYVIVDTAPIGMVI
DAAIITQKCDASILVTAAGETKRRDVLKAKEQLEQTGTPFLGVVLNKFNTEVEKYGAYGGYGAYGSYGNYGKKK
>gnl|bykdb|A0A081QKT4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus mitis] (length=227 residues).
MPTLEIAQKKLDLAKKAEEYYNALRTNIQLSGNNLQVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLVDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSHGLCDTNVENLFVVQAGSISPNPTALLQSENFSTMIDTLRKYFDYIIVDTAPIGIVI
DAAIITQKCDASVLVTAAGEANRKDVQKAKGQLEQTNKPFLGVVLNKFNTSAEKYGSYGEYGSYGKK
>gnl|bykdb|A0A081QSB1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus mitis] (length=234 residues).
MPTLVIAQKRLDFAKKAEEHYNALRTNIQLSGDNLKVLAISSVKPGEGKSTTSTNIAWAFARAGYKTLLVDADIRNSIMS
GVFKSREKITGLTDFLAGTTDLSHGLCDTNVENLFVIQAGPVSPNPTALLQSENFATMIDTLRKYFDYVIVDTAPIGMVI
DAAIIAQKCDASILVTAAGETKRRDILKAKEQLEQTGTSFLGVVLNKFNTEVEKYGAYGGYGAYGSYGNYGKKK
>gnl|bykdb|A0A081S992 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus mitis] (length=234 residues).
MPTLEISKKRLDFAKKAEEHYNALRTNIQLSGDNLKVLAISSVKPGEGKSTTSTNIAWAFARAGYKTLLVDADIRNSVMS
GVFKSREKITGLTDFLAGTTDLSNGLCDTNIDNLFVIQAGPISPNPTALLQSENFHTNIDTLRKYFDYVIVDTAPIGMVI
DAAIITQKCDASILVTAAGETKRRDILKAKEQLEQTGTPFLGVVLNKFNTEVEKYGAYGGYGAYGSYGNYGKKK
>gnl|bykdb|A0A084A7R4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactococcus lactis subsp. cremoris GE214] (length=231 residues).
MAKNKRSIDNNRYIITSVNPQSPISEQYRTIRTTIDFKMADQGIKSFLVTSSEAAAGKSTVSANIAVAFAQQGKKVLLID
GDLRKPTVNITFKVQNRVGLTNILMHQSSIEDAIQGTRLSENLTIITSGPIPPNPSELLASSAMKNLIDSVSDFFDVVLI
DTPPLSAVTDAQILSSYVGGAVIVVRAYETKKESLAKTKKMLEQVNTNILGVVLHGVNSSESPSYYYYGVE
>gnl|bykdb|A0A084GXZ3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus indicus] (length=232 residues).
MARKDRKQLFQTQSRSLISMTAPKSPIAEQYRTIRTNIQFSTVDEEITSIIVTSAGPGDGKSTTAANVAVVFAQQGKKVL
LVDADLRKPTAHYTFKIDNHSGLTNVLTKQISVTQAAKYTDQENLYLLTSGPIPPNPSELLASKGMKQLIEDAKRDFDLI
IFDTPPVLVVTDAQILSNLVDGAILVVSSGKTDLEGAKKAKDALLQSQAKILGTVLNNKKQQDSQYYYYATK
>gnl|bykdb|A0A084JIG0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sulfidigenes] (length=217 residues).
MHIVEKEPKSIVAESYRTLRTNLQYSSFDGEYKVIVITSPNPTEGKSTVAGNLAISLSKGDKKVILIDCDLRKPVLHKRF
KLSNATGLSDIILAKETRVIVGQRYNENLIVITGGTVPPNPSEMLGSKYMTNLIAALRELYDYVILDTPPIQLVTDAQIL
SAKADGTILVVKAEETKKSSVHNAIDLLRKVNANIIGIVLNGVENKGNSYYYEDGKV
>gnl|bykdb|A0A084JQH5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Clostridium] celerecrescens] (length=233 residues).
MRKVTFRRKDKLDFKANEAFKTLRSNILFSGKDIKVLTLTSSTPNEGKTSISFQLASSFAAADNRVLFVDADIRKSVIAG
RYKVDGNTYGLTHYMTGQRTMEEVICQTDIKNMDIILAGPVSPNPTELLGGPLFAQLLEEQRDNYDYIIIDAPPLGSVID
AALIARYVDGAIIVVESAVISYKMLQRVKEQLEKSECRILGVVLNKVDMEHDAYYGNYYGKYYGKYYGSYGES
>gnl|bykdb|A0A087END6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus kunkeei] (length=239 residues).
MGLFNKSPKKKLNDDSSKFGVNLVAELYPTSSVSEQFRTVMTNISFANINGDLKSIMVTSSDPSEGKSTFSANLAVTYAK
QGRNVVLVDADMRRPTVHKSFNISNQKGLSTILSGNSTIEDTIKYTSIDNLNVITSGPIPPNASALLGNRKIVDIINKFN
KPNDLVIVDVPPVNTMTDASIVSTTVDGTIFVLPQGVAEKKRAKMAVEQLKKVNANILGAVMNMSKDNMTNDYYYYYSK
>gnl|bykdb|A0A087LB64 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Geobacillus stearothermophilus] (length=232 residues).
MARSNRQQFKRLERSLITAEDPKSPIAEQYRTIRTNIQFSFIDRPLRSLIVTSTGPGEGKSTTVANLAVAFAQQGKKTLL
IDADLRKPTVHYTFRLNNYMGLTNVLTGSAPLLPTCQVTEIDHLSILTSGPIPPNPAELLSSNAMAQCLEQLYETFDLVI
FDTPPVLAVTDAQVLANQCDGTVLVIESGGTEIEAAVKAKELLEAANAKLLGVVLNKRKHRDGGHYYYYQYK
>gnl|bykdb|A0A089I9N8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. FSL H7-0357] (length=229 residues).
MSQQPNKQQRHLITVTNPRSPVSEAFRALRTNIDFSSVDEQIQVIMVTSSGPEEGKSTVSANLAAAYAQSDKKVLLIDSD
LRKPTAHKTFSLSNRLGLSSLLSQQANLDEVIQESGVDNLYLMTSGPIPPNPAEMLSSNRMSSVLQELRQRFDIVLIDTP
PLLAVTDAQIVSSKSDGVIMVVSYGKVKRDIAAKAKANLDRVGAKMLGVVLNNVKRKASEGYYYYYYGN
>gnl|bykdb|A0A089IMT7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. FSL H7-0737] (length=228 residues).
MSQLPNKQRHLITVTNPRSPVSEAFRALRTNIDFSSVDETIQVIMVTSSGPEEGKSTVSANLAAAYAQADKKVLLIDGDL
RKPTAHKTFSLSNRFGLSSLLSQQAVLEDTVQDSGVSNLSIMTSGPIPPNPAEMMASNRMSTLLQDLRQRYDVILIDTPP
LLAVTDAQIMASKSDGVIMVVSYGKVKRDIAVKAKANLDRVGAKMLGVVLNNVKRKASEGYYYYYYGN
>gnl|bykdb|A0A089K8S8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. FSL R5-0912] (length=228 residues).
MSQQPNKQRHLITVTNPRSPVSEAFRALRTNIDFSSVDERIQIIMVTSSGPEEGKSTVTANLAAAYAQADKKVLLIDGDL
RKPTAHKTFSLSNRYGLSSLLSQQADLSEVIQESGVNNLALMTSGPIPPNPAEMMASNRMSAVLQELRQLYDVILIDTPP
LLAVTDAQIVASKSDGVIMVVSYGKVKRDIAVKAKAGLDRVGARMLGVVLNNVKRKASEGYYYYYYGN
>gnl|bykdb|A0A089KIQ7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. FSL R7-0273] (length=228 residues).
MSQQPNKQRHLITVTNPRSPVSEAFRALRTNIDFSSIDERIQIIMVTSSGPEEGKSTVTANLAAAYAQADKKVLLIDGDM
RKPTAHKTFSLSNRHGLSSLLSQQSNLNEVIQESGVPNLFIMTSGPIPPNPAEMMASNRMSMVLQELRQQFDVIMFDTPP
LLAVTDAQIVASKSDGVIMVVSYGKVKRDIAAKAKANLDRVGAKMLGVVLNNVKRKASEGYYYYYYGN
>gnl|bykdb|A0A089L5M6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. FSL R7-0331] (length=228 residues).
MSQQPNKQRHLITVTNPRSPVSEAFRALRTNIDFSSIDERIQIIMVTSSGPEEGKSTVTANLAAAYAQADKKVLLIDGDM
RKPTAHKTFSLSNRHGLSSLLSQQTNLNEAIQESGVPNLSIMTSGPIPPNPAEMMASNRMSMVLQELRQQFDVIMFDTPP
LLAVTDAQIVASKSDGVIMVVSYGKVKREIAAKAKANLDRVGAKMLGVVLNNVKRKASEGYYYYYYGN
>gnl|bykdb|A0A089MVS2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus borealis] (length=228 residues).
MSQQPSKQRHLITVTNPRSPVSEAFRALRTNIDFSSVDERIQVIMVTSSGPEEGKSTVTANLAAAYAQADKKVLLIDGDL
RKPTAHKTFSLSNRYGLSSLLSQQAELSEVIQESGVHNLSLMTSGPIPPNPAEMMASNRMSAVLQELRHLFDVILIDTPP
LLAVTDAQIVASKSDGVIMVVSYGKVKRDIAIKAKAGLDRVGARMLGVVLNNVKRKASEGYYYYYYGN
>gnl|bykdb|A0A089NNP5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus graminis] (length=228 residues).
MSQQPSKQRHLITVTNPRSPVSEAFRALRTNIDFSSVDKQIQIIMVTSSGPEEGKSTVTANLAAAYAQADKKVLLIDGDL
RKPTAHKTFSLSNRAGLSSLLSQQAELEDVVQDSGVTNLSIMTSGPIPPNPAEMMASNRMSAVLQELRQRYDMILFDTPP
LLAVTDAQIVASKSDGVIMVVSYGKVKRDIAAKAKANLDRVGAKMLGVVLNNVKRKASEGYYYYYYGN
>gnl|bykdb|A0A091BU30 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus equinus JB1] (length=237 residues).
MPQLELVRAKAQMIKNLEEYYNTIRTNIQFSGRNLKVIALTSAQPGEGKSTTSTNLAISFAKAGFRTLLIDADTRNSVMS
GTFKSKERYDGLTSYLSGNAELSDVICDTTIDNLMVIPAGQVPPNPTSLIQNDNYDKMIETVRGLYDYVIIDTPPLGRVV
DAVIIAHSSDASLLVTKPGADKRRTITKLKEQLEQSGAVFLGVILNQFDIRRDYYGSYGSYGSYGEYGKSSKKEDKK
>gnl|bykdb|A0A091C8N8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Tetragenococcus muriaticus 3MR10-3] (length=231 residues).
MKKERTNTKTQPVSLISLVDPSSSVAEQYRTIRTNLQFASSADQQVQTLVVTSSGPREGKSLTSANLAVVFAQTGQKVLL
VDADMRKPTIHKTFQLSNEAGLSTVLSTGVSLEETAQKTTIENLSILTSGPKPPNPSELLGSEKMNQIMEEARHLFDMVI
FDMPPVVTVTDAQVMSSKADGTLLVARENWTRKDALSQAKESLDLVQARILGVIYNGAKQDKDKAYYYYSD
>gnl|bykdb|A0A091CF20 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Tetragenococcus muriaticus PMC-11-5] (length=231 residues).
MKKERTNTKTQPVSLISLVDPSSPVAEQYRTIRTNLQFASSADQQVQTLVVTSSGPSEGKSLTSANLAVVFAQTGQKVLL
VDADMRKPTIHKTFQLSNEAGLSTVLSTGVSPEETAQKIVVENLSILTSGPKPPNPSELLGSEKMNQIMGEARDLFDIVI
FDMPPVVTVTDAQIMSSKVDGTLLIARENWTRKDALSQAKESLDLVQARILGVIYNGAKQDKDKAYYYYSD
>gnl|bykdb|A0A094WDF5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus alcalophilus ATCC 27647 = CGMCC 1.3604] (length=230 residues).
MARRELKSTGKKRALIAHERKKSPISEQFRTIRTNIEFSSVDKQIKTLLVTSPGPGEGKTTTAANLAIVLAQNGNSVLLI
DADLRKPTVHHTFGVLNTRGLTSLLTKKEDLEHTVQASEIEGLSLLPSGPNPPNPAELLSSKTMEHLLQSLGEKYDMIVL
DTPPVMAVTDAQVLGNRVDASVLVVSNGKTDRNQAVKTKELLTQTSSKLLGVVFNNKEVKKGHYYYYYGE
>gnl|bykdb|A0A096BIK4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Peptoniphilus lacrimalis DNF00528] (length=230 residues).
MAKLELSEQRLHSVKKAEEYYNALRTNIQLSGDGLKVIALSSVRPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTDYLSGTKDLSHGLCETNVENLFVIQSGAVSPNPTALLQSDKFEAMIETLRKYFDYIIVDTAPIGVVI
DAAIIVQKCDASILVTEASATKRREVQKAKDQLEQTGTPFLGVILNKFNIQLEKYGSYGSYGNYGSYGKK
>gnl|bykdb|A0A097APZ5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Thermoanaerobacter kivui] (length=236 residues).
MVAARNLIVADPKSPFAEAFRALRTNLQFTSVDKKVKSILITSSLPNEGKSTVVKNLAYSVALTGSKVIVIDADLRNPTV
HKLLYLPNSRGLTNLLIDEGDYEAYLNIDNSYSNLHILTSGPIPPNPAELLGSNKMKKLLSNIQKDYDYVFIDSPPVVTV
TDAVVLAPVVDGIILVIQAGKTEIEAVSRAKEILESVKANILGVVLNRVKESHKGYYYYYYYYDDNNPQHKKRRKR
>gnl|bykdb|A0A097RAE6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus subtilis] (length=226 residues).
MGFRKKKSRRGLAQISVLHHKSLVAEQYRTIRTNIEFSSVQTHLRSILVTSSVPGEGKSFSAANLAAVFAQQEKKVLLVD
ADLRKPTIHETYQLENVQGLTNVLVGNASLGETVQKTLIDNLYVLTSGPTPPNPAELLSSKAMGELIQEMYSRYSLVIFD
SPPLLAVADGQILANQTDGSVLVVLSGKTKMDTVQKAKDALQQSKAKLLGALLNKKKIKKTEHYSY
>gnl|bykdb|A0A098D0V9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactococcus garvieae] (length=231 residues).
MAKNKRSIDNNRYIITSVNPQSPISEQYRTIRTTIDFKMADQGIKSFLVTSSEAAAGKSTVSANIAVAFAQQGKKVLLID
SDLRKPTVNITFKVQNRVGLTNILMHQSSIEDAIQGTRLSENLTIITSGPIPPNPSELLASSAMKNLIDSVSDFFDVVLI
DTPPLSAVTDAQILSSYVGGAVIVVRAYETKKESLAKTKKMLEQVNTNILGVVLHGVDSSESPSYYYYGVE
>gnl|bykdb|A0A098EIC2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planococcus massiliensis] (length=235 residues).
MARKRQKKVLQETARKVISFTNPRSYVAEQFRTLRTNINFSSPDSDIRSLLVTSAAPSEGKSTASANLAVVFAQEGKRVL
LVDADMRKPTTHYTFHMGNTQGLSSVLTRQIEAEAAIRETEIERLDLLTCGPIPPNPAELLASKSMDALIEQLKETYDII
IFDAPPVLSVTDGQILASKCEGTILVVNSGTTEKEMALKAKEAIASSNSRLIGAVLNNFILPKDNYYYQYYGAEK
>gnl|bykdb|A0A098EJV4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planococcus massiliensis] (length=228 residues).
MSKSKKKIDRTGRKLVAYTMPKSFVSEQFRNVRTNIHFSTPDKEIRSLAITSAAPGEGKSTAAANLAVVFAQEGKKVLLI
DGDMRKPTMHHTFEIRNTVGLSSVLTRRLPVEAAIKKGPISGLHLLTCGPIPPNPAELLASETMAQLIQHLGKSYDLVIF
DSPPILSVADGKLIADHCEGTVLIINSGTTEKRGALKAKEMIEMTSSKLLGIVLNNFTSTKETYYYQY
>gnl|bykdb|A0A098FGJ8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus simplex] (length=225 residues).
MRSKDEKQVNLIAQTNPKSPITEQYRLIRTNIQFSSVDKEIKTIVVTSSEPNDGKSTTAANLAIVLAQEEKKVLLVDADL
RKPSVHYAFNLSNIHGLTSVLTKKMDFRKTILNSNVLNLDILTSGPIPPNPSELLNSKAIETAIDELKEIYDYIIFDTPP
VLVVPDSQIVANKCDGVIMVVASGKTNKQSAVKAKELLVKANTSLLGVILNGVETDNSNYYYYQS
>gnl|bykdb|A0A098L087 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Geobacillus thermoleovorans B23] (length=235 residues).
MKPLARKPATSIRKAERRLITVDNPKSPIAEQYRTIRTNIQFSFIDAPLRSLIVTSTGPGEGKSTTAANLAVVFAQQGKK
TLLIDADLRKPTVHYTFRLNNYKGLTNVLTGSAPLLPTCQATEIDHLSILTSGPIPPNPAELLSSNAMAQCLEQLYETFD
LVIFDTPPVLAVTDAQILANQCDGTVLVIESGGTEIEAAVKAKELLEAANAKLLGVVLNKRKHRDGGYYYYYQYK
>gnl|bykdb|A0A098M8F8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus wynnii] (length=228 residues).
MSQQLSKQRQLITLTNPRSPVSEAFRALRTNIDFSSVDERIQVIMVTSSGPEEGKSTVSGNLAASYALSDKKVLLIDADL
RKPTAHKTFTLSNRYGLSSLLSQQVDIEDAIQDSNVPNLSIMTSGPIPPNPAEMMASNRMTAVIQELRQRYDVIIIDTPP
LLAVTDAQIVASKSDGVIMVVSYGKVKRDIAIKAKANLDRVGARMLGVVLNNVKRKASEGYYYYYYGN
>gnl|bykdb|A0A099DJJ6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Exiguobacterium mexicanum] (length=238 residues).
MFKFGKKKSKHIKYDKTGRELITVHKPKSPISEQYRTIRTNLEFTAVDDDLQTMVITSASSGEGKSTTSSNLAVVYAQQG
KRVLLVDCDMRRPTAHFTFRLSNGIGLSTVLAKKTTVEKATHSTQVENLDLIAAGPIPPNPSELLSSKMMDRVLEELKTN
YDIIILDAPPMMQVADTRLLARKVDGVVLVVGCDKSDRQMVVKAKEQLTLAEAHILGVVLNKREPQGSDDYYYYYAYE
>gnl|bykdb|A0A099DKC0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Exiguobacterium mexicanum] (length=231 residues).
MSKRQDKHRDSGRSLITLANPKSPIAEQYRTIRTNLQFTALGATLQTIVVTSASPGEGKSTTASNLAIVYAQLGKKVLLM
DCDMRKPTVHFTFQLAGQTGLSTVLAKRTTFDRSVQMTKVPKLHLLAAGPIPPNPSELLASPMMKQLLDEVKEKYDLIIL
DAPPLMHVADSRLLASETDGTILVVGCDNSNRDLVLKAKEQLILSGAHMLGIVMNKRERAGKDAYYAYTYE
>gnl|bykdb|A0A099HWI3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. NCR] (length=237 residues).
MINITAFNDPKSPIAEAYRSIRTNIQFSRVDNEMKTIVVTSSKQDEGKTTVTSNLAVSFASLEGKRVLLIDADLRNPSVH
KMFSKPNALGLTDVLAGKKELKQCVQNTELENLQILTAGTIPPNPGEMLESKKMREFIDVLRDYYDYIFIDTPPIGIIMD
AGVLANYADGTILVVGAKDVETERAKISKERLEKVKANIIGAVLNKYIEKNGSYGYYSYYYEQSDGSRVSKKKKKKR
>gnl|bykdb|A0A099I0N3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium innocuum] (length=238 residues).
MERKIAPKRSDPKKHTKKSQFDNMEVYRQLRTNIEYSSFNKDIQVICVTSSNPAEGKSSVASNLATVAIAKYEKVLLIDC
DLRKPVQHKIFKVSNKLGISNLMKEKSEIDLEIGGYFQKFKDNSTDGKLYVLTSGKSVPNPQEMLESERFKELIEKFREM
FDYIIIDCPPLNAVADAIPVSSIVDGTLFVVSAMDTDKSEAKNALTMLQRNGANVLGCVLTKVDITSKSYYSYYGNYS
>gnl|bykdb|A0A099SBU7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. HMP27] (length=245 residues).
MNESYLISIKNPMNPISEAYRTLRTNIKFSSFDKEIKSLVITSSGPNEGKSTTACNLAIVMAQTGSKTILIDCDQRKPSI
HKVFGLSNECGLSNILADEVEFKDAVYKTQIENLEMLPSGTKPPNPSEILSSEKMKRFLQRLKEKYDSIIIDTPPIVAVT
DAQLLSTYVDGCILVVASGQTDRGAAMKAKGLLDKVGAKILGVVLNKVDTSNKGYYGARYYNYYSEDYECKKRKRLFNIG
VRHFG
>gnl|bykdb|A0A099SCK1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. HMP27] (length=233 residues).
MKVSELITIRKPLSPISESYRTLRTNIKFSSVDKEIRVIVVTSSGPGEGKSTTASNLAAVMAQAGNKTVIIDCDQRKPRL
HKVFGLSNERGISDILAKEIKFDDAVQSTEQENLDIITSGTKPPNPAELLASATMKEFLESLKEKYDTIIIDTPPIVAVT
DAQLLSRHADGCILVIASQQADRDAAIKAKELLEKVDANMLGVVLNKVDTTHKGYYGAYYSYYAEEDGSDKNK
>gnl|bykdb|A0A099SE90 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Desulfosporosinus sp. HMP52] (length=232 residues).
MAFSLITHEQTKSPISEAYRTLRTNVQFTGVDTKTKKIMITSSGPREGKSTTVANLAVSIAQSGKTVLVIDADLRNPTQH
KLFELGNFEGLSTFLVQDEQNKDFIKETEVPGVKVLTGGPIPPNPAELVGSQRMKRLIEEVSEQFDMVLIDTPPIIAVTD
AAVLAQEVDGVILVLASGEVNKEYAQRAKDQLDKVGAKILGAVINKADMKTSEYYYYYYYHGSDDHKKKKRS
>gnl|bykdb|A0A099VVN6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeria booriae] (length=216 residues).
MRTKEMLNENLFFQEQMAHIRTTIELSGQRDTQAISVTSSLSSEGKSSIAIGIARSFAEAGKKVLLIDSDFRRPSVHKKL
GLSNAVGFCDVLKEDYTLTECMKDIGVQGLDILTSGLVEDSPSILFDATTLKKFILEVKKEYDLVIIDTPPVLLVPEVKT
ILNHSDATLLVVKYDEVRKEEVERTYRVLNQVSATCLGIVFNRVKVKVKDRYRYYY
>gnl|bykdb|A0A099VXM5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeria booriae] (length=225 residues).
MSRPKITKRKLITAVNPSSPISEQFKTLRAGIHFSSVDKEYRSILVTSPEPESGKSTVSANLAICYAKQGNKTLLIDADM
RKPTSHRTFGIPYNVGLSNMLTDSKTEFKDVCHPTEIENLMVLTSGTMVPNPNELLGSNRMEQLLKHLSEQFDQIIIDTP
PILASSDALVLTPYVEGAIVVLCSDKTLKERAKIAVQQLQKTHIPIIGTVLNRVTNNSDNYYYYQ
>gnl|bykdb|A0A099VYT7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeriaceae bacterium FSL A5-0209] (length=227 residues).
MVIQKKAKQRTLITNEKGTIPEQFRNIRASIQYVADKKKIKTIMATSCRQGEGKSSLIANLAMFMSKSGKRVLLIDGDLR
LPTIHRIFKLKNYVGLSDLLKDDQFHRYEGIQKIDDYLDVMASGASPYNPSELLSDSLLPEILKEYETVYDFIFIDAPPI
GLSDTIITANYCDATILVLENGKTTKTQLKECIEKCKMQNIDVLGIIRNKVKRRRHESSYYYDYVKK
>gnl|bykdb|A0A099W1Z2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeria booriae] (length=231 residues).
MMRRKVKKVQRDDRKLIVQNKPLSPLSEQFRMLVENIELMSIDKKIKSLLVTSADPSSGKSLISSNLAIAFAQKGKKTLL
VDADLRKPTIQKYFRNGVNLGLMGLIKKESDLHGAIFESESPNLFILQTGIIPINPASILASDRLKEIFAELEAAFDYII
VDTPPILAVADAQVLSGMTDASLLVIRNDYTVTERARKASQRLEQSSRLFLGAVFNNQKQKEDHYYYKERN
>gnl|bykdb|A0A099W967 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeriaceae bacterium FSL A5-0209] (length=238 residues).
MKKSKKKSKAETRHRRQKSTEPQKLVAKLSPKSPHSELFRSIRTNIEFSSVDKVMKSILITSSEPDSGKSIICANLAVVF
AQQGKKTLLIDADLRKPTVKKIFPGAASHGLTGILTNKITVSEAICETDVEDLYVLPAGIVPPNPSELLGSEKMKQVYAE
LYELFDQIIFDTPPIQLVVDAQLLCSFVDGSILLVRSDHSSRENSKKALEKLRSGSAHVIGSIFNNQKMKMEGYYYAN
>gnl|bykdb|A0A099WC17 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeria booriae] (length=227 residues).
MSHRRQKTDEPQKLIAKINPKSPHSELFRSIRTNIEFSSVDKPMRSILITSSEPDSGKSLICANLAVVFAQQGKKTLLID
GDLRKPTVKKIFPEAVSHGLTGILTNRVTIDEAIRETEVENLYVLPAGVVPPNPSELLGSEKMKQVYAELYEIFDQIIFD
TPPIQLVVDAQLLCSLVDGSILLVRSNHSSKENSKKALQKLQTANAHVIGSIFNNNKMKMDGYYYAD
>gnl|bykdb|A0A099WC93 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeria booriae] (length=231 residues).
MIRRKPKDSQRDDQKLIVQNKPLSPLAEQFRMIVENIELMSIDKKIKSLLITSADPSSGKSIISSNLAVAFAQKGKKTLL
IDADLRKPTIHKYFRNEVSLGLMGLVKKESTIEGAIFESDSPNLYILQAGIIPANPTSILASERLKEVFAELEELFDQII
VDTPPILAVADAQILSGMTDASVLVIRNDYTVTERARKASTRLEQSSKLFLGAVFNNQKQKQDHYYYQEKE
>gnl|bykdb|A0A099WCP7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeria booriae] (length=226 residues).
MVIKKQYSERQLIKKEKGVIPEQIRNIRTNIQYLADKRNLKVIMVTSCRQGEGKSSAIVNLAYFMAKNNKKVLVIDSDLR
LPTIHKPFQLQNFSGLTDFLNELMDEKETIQQVAENLDVVTSGPLPYNPTELLSKKRFKTFIDTQRVDYDFIFVDAPPSG
LADSKIIGSVCDSTIIVVENGKTTKNQLKTCIDTCKMQNIDIIGVIRNKIRKKKHDSNYYYNYVKE
>gnl|bykdb|A0A099WD98 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeriaceae bacterium FSL A5-0209] (length=225 residues).
MMRKAKNKEDKKLTVFTQRNTQIAEQFRMIRTGLQFLAEKRSAKHFMVTSSASGEGKSVVIANLAAFFAQQDKRVLIIDG
DLRRPTQHDIFQVENYYGFADILKEETNVKKAIQKTAVENLDVLVSGMLPYNPAELLASFDFDAFFAELDAAYDFIFIDA
PPAIVADTPIIASKVDGVIVVVGLRTVKRSKLEQTIREVKTAGANVVGIICNKAKPTKKTAYYYK
>gnl|bykdb|A0A099WF84 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeria booriae] (length=231 residues).
MRNKNKQKKNNRKKLVTYFDPRSPISEEFTSVKTNIEFTTISQASQVLMITSAEPDAGKSIMASNLAVVFAQQGKKTLLI
DLDLRKPTQHRVFFSNNEIGLTGLLVKSECRTKAIQDTEIDKLQVLASGHIPPNPTEILNAPKLAELIETLREEYDQIIL
DAPPVLVASDARLIARLADGIIFIIKSGASEYKKIAKSIELLQQTQTKILGTVLNNPNAQAARMYYTYSDK
>gnl|bykdb|A0A099WGM2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeria booriae] (length=234 residues).
MMRFKIKPKKKPNISIMQKESNSISSEQLRTIRTSIQFASTEKLSTMVVTSPEPGAGKSFISMNLAISFAEQGNKVLLID
ADLRRPTVHTTLRLSNELGLSNYLAGQGKLEDCLQEITMHENLFVITSGIIPPNPAELLSSTKMKEFTKIVSDMFDIVIF
DAPPVLPVVDPLIIGNIVDGLILVLRSEHTDQSDAVQTLDKIKQSKIKMIGAVLNGRKNRGDSYKTVYYTKNQK
>gnl|bykdb|A0A099WGS4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeria booriae] (length=216 residues).
MRTKEMLNENLFFQEQMAHIRTTIELSEHQAIQAISVTSSLSSEGKSSIAIGMARSFAEAGKRVLLIDSDFRRPSVHKKL
GLSNAVGFCDVLKEEYRLADCLKDIGIQGLAVLTSGLVEDAPGTLFDAARLKKFMLQVKQEYDLIIVDTPPVLLVPEVKT
ILNHSDATLLVVKYDEVRKEEMDRAQRVLNQVSATCLGIVFNRVQVKVRDRYRYYY
>gnl|bykdb|A0A099WHQ4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeria booriae] (length=225 residues).
MNKQDFSKRKLIAATNPSSPIAEQFKTLRAGIHFSSVDKDYQTILVTSPEPESGKSTVSANLAICYAKQGKKTLLIDADM
RKPTSHRTFGIHYNVGLSHLLADSGIELEDVCHQTEIDNLMVLTSGALVPNPNELLASKKMEQLIQQFAEQFDQIIIDTP
PILASSDALVLTPYVEGAIVVLRSEKTLKDRAKTAVKLLQKTHVPIIGTVLNRVKNHSNSYYYYQ
>gnl|bykdb|A0A099WIC1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeria booriae] (length=222 residues).
MQKERSKLLIRHQKGSRIAEQFRIIRTNIEFISKKRALKTIMITSTKPQEGKSTIIANLADVMGRQELKVLIIDADLRLP
SQHYILGVDNSLGLTDILKEKATIETVIQNTSLFNVDIIAAGQSPNNPSELLSKTVLKDLLETVKKYYDYILIDAPPVIV
ADTTIVAQKIDGVIMVAEENKTPKQKFQKALNTLKSTNTPILGIILNKTKQEKSSKYYYYNK
>gnl|bykdb|A0A099WLQ3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeriaceae bacterium FSL A5-0209] (length=228 residues).
MLSLSRKKNKPPVNRLAQLGGNKSVNEQFRIIRTNIEFVSMGQNNVYLITSSIPGEGKSTITSNIAMTFGQQNKKVLLID
GDMRRPTQDKLFRRLNNVGLSTLLANQHTLEEAIQPIEEYNIDFLPSGPVPPNPAELLSSTKLEKLLEECKQKYDLIFID
SPPLIDIADGPILASKVDGTFLIVRAYKTYKAEIQKSVQILEQSNSKVMGYILNDVKKQGQGKNYYVY
>gnl|bykdb|A0A099WNP1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeriaceae bacterium FSL A5-0209] (length=222 residues).
MQKERSKLLIKHQKGSKIAEQFRMIRTNIEFISKKRSLKTIMITSTKPQEGKSTIIANLADVMGRQDLHVLIIDADLRLP
SQHYILGADNSVGLTDILEETVDLEAVIQNTVLVNVDIIPAGQSPNNPSELLSKAALPALLETVKKQYDFILVDAPPVIV
ADTTIIAQEIDGIIMVAEENKTPKQKFQKALTTLKSTHTPILGIILNKTKQDKSSKYYYYNK
>gnl|bykdb|A0A099YA02 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus mucosae] (length=252 residues).
MGIFKRKSRVDNNTMKNGAKLITVAKPKSVAAEQFRTVRTNIHFMAVDRRLKTIAFTSANISEGKSTVAANLAIVWAQEG
KSVLLIDADMRRPTLYSTFDLAGQEGLSTVLSSNQSEVNLNDVIQESGIEGLDLLPCGAVPPNPAELLSSQRMKVLLEAV
QAQYDLVVLDVPPMLEVTDTQTIAGSVDGVVLVVRQGVTQKAGVRRAIELLKMSHAHLLGYVMNDVVPEDDAGYGYGYGY
GYGYGYEKESEN
>gnl|bykdb|A0A0A0DE45 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sinensis] (length=236 residues).
MPRLELSRSRKASIEKTEEYYNALRTNIQLSGDNLKIIALTSVQPNEGKSTTSTNLAIAFARAGYKTILIDADIRNSVMS
GVFKSKEKITGLTDYLAGKTDLSQGLCETDVENLFVIESGQTSPNPTALLQGKNFDSMMNVLRKYYDYIIVDTPPIGLVI
DAAIIAQKCDASLLVTEAGAVKRKLVQKAKEQLEQTDTPFLGVILNKYNVAMDKYGSYGIYGAYGNYGNYGTKKEK
>gnl|bykdb|A0A0A0E6N1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus niacini] (length=226 residues).
MKTTDPSRKLIASLDPKSPISEQYRTIRTNIQYSSVDEELKTIMVSSSGPGEGKSTTAANLAVVFSQLGKKVLLVDADLR
KPTVHRSFAVNNLFGFTTVLTKQATLANTVVETEEKDLFILTSGPIPPNPAELLSSKSMEQFMEEAKEQFDYVVFDTLPL
LAVADPQIIANKVDGSILVVFSGKTEIDQVKKAKELLVNAQSKLVGVVLNHKEMKDNDYYYYYGAK
>gnl|bykdb|A0A0A0I9D9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium novyi A str. 4552] (length=234 residues).
MLIVEKEPKSIAAESYRTLRTNIQYSSFDKELKTIIVTSSGPSEGKSTTSGNLALSMAQSDKKVLLIDCDLRKPTVHKKF
HISNEKGLSNYLVGEVSFEEVVVNYNENLYLLPAGTIPPNPSEMVASKKMKKFLESLKENFDYIVIDTPPVIAVTDAQIL
STIVDGVLLVAASGQAEKEAAIRAKELLLKVKANILGVVLTKVPLNEGKGYGYSYYYYYGDEDEKSKKRRKSKK
>gnl|bykdb|A0A0A0U203 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus subtilis] (length=229 residues).
MLTRKKDKFAKRSVITMSEPKSINSEQYRTIRTNIEFSSVDTEVKSLLITSAGPEEGKSTTAANLAVVFAQQGKKVLLID
ADLRKPTVHFTFKLDNGTGLTSLLLKQIPFQKAVLPADEANLDILTSGPIPPNPAELLSTDAMKDLLSEATDVYDKVILD
TPPVLAVADTKILGSYTDGAIMVISSGKTDKEKAAKAKEALDYCPCKLLGAVMNGKRQTKHSDYAYYGQ
>gnl|bykdb|A0A0A0WSD5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus mycoides] (length=234 residues).
MALNSLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNVEFASVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKK
VLLIDADMRKPAMHQMFQVDNIVGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSMYD
LVIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREHGLYYYYGAN
>gnl|bykdb|A0A0A0Y931 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus iniae] (length=239 residues).
MSQLNLVRSKREHYQHAEEYYNSIRTNIQFSGRDYKAIVLTSVQPGEGKSTTSINLAISFAKAGFKTLLIDADVRNSVMS
GAFKSDDRYEGLSSYLSGNAELSSVISRTDVPNLMLIPSGQVPPNPTTVLQNSNFNFMIDTVKELFDYIIIDTPPIGLLI
DSAIIAQKADATILVTEAGSIKRRFVQKAKEQMEQSGAQFLGVILHKVDQQLGSYGAYGSYGDYGKTKKSSKSKKHSRK
>gnl|bykdb|A0A0A1E060 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus salivarius] (length=246 residues).
MPLLKLVKSKVNFAKQTEEYYNAIRTNIQFSGTQMKVIAISSVEAGEGKSTTSVNLAISFASVGLRTLLIDADTRNSVLS
GTFKSNEPYKGLSNFLSGNADLNETICQTDISGLDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPIGLVI
DAVIIAHQADASLLVTAAGKIKRRFVAKAVEQLEQSGSQFLGVVLNKVDMTVDKYGSYGSYGSYGEYGKKSDQKEGHSRA
HRRRKG
>gnl|bykdb|A0A0A1GUU8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus hokkaidonensis JCM 18461] (length=243 residues).
MGLFSRTKKLSTDTIDNGVKLIAAAKPKDVISEQFRTIRTNIDFSSVDKQLKTLLFTSSNVSEGKSTVSANTAVTWAQQG
KRVLFIDADLRRPTLHTTFGLNNTQGLSTILTQSLDFHDHVNDSGIENLTVITSGPVPPNPAELLNSKRMKELLAQVEQE
YDVVMLDVPPLLSVTDTQVLAASVDGVILVVRQGVAQQAAVKRSVELLEMVHAKLLGYVLNDVAPKNGYGYGYGYGYGYG
YEQ
>gnl|bykdb|A0A0A2HID6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium botulinum] (length=236 residues).
MDRNLNLITIKEPKSPISEAYRTLRTNIQFSSFDEKISVIFVTSSTPGEGKSTTSANLAITMAQNGSETILVDCDLRKPN
VHKLFKLSNTRGLSNLLIEDNSIDKVIQQSGIDNLHILTSGIKPPNPSELLSSKKMKKFIDMSKEHYDYIILDTPPVGVV
TDAQLVSQYSDGGILVTAFGQVERELAIRAKQLLQKVNAKILGVVLNKVDINSGNGYRYYNYYYEEDGKKKKRSKK
>gnl|bykdb|A0A0A2TSP8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Desulfosporosinus sp. Tol-M] (length=242 residues).
MAYSLVTFEQTKSPIAEAYRTLRTNVQFTCVDSDTRKIMITSPGPREGKTTTVANLAVSMAQAGKTVLIIDADLRNPTQH
KLFGLDNAQGLSVALVQDKDYRQYIRETAVPCVRVLTGGPIPPNPAELIGSKRMKRLLQEVSEQYDMVLIDTPPIVAVTD
AAILAQEVDGVILVLASGEVNKEFAQRAKELLDKVGAKILGAVLNKADTKTSEYYYYYYYHGSDDTKKKHKRRKDRSAPS
EG
>gnl|bykdb|A0A0A2TXU8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. MAEPY2] (length=227 residues).
MPRLTNEKGSLVTMANPKSTSSEAYRKLRTNIQFSSIDSQIQTIMIASALSGEGKTTTIGNLAVTYAQEGKKVLLMDTDL
RKPAVHRMFNVPNHVGLTSVLSSQYKVTEVLRETGVEGLHVLSSGPIPPNPSEMIGSRKMTALLEDLKEVYDVILFDTPP
VLAVTDALIISSLCDGVILVVSAGKVKKDLVKKAKAHLEHVNARILGAVLNNVQVPKRRNAYYGENA
>gnl|bykdb|A0A0A2TZ57 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pontibacillus yanchengensis Y32] (length=231 residues).
MARKKNLLMKARTLITNFNPKSPISEQYRTIRTNLQFASVDRDLRTMIVTSPGPGEGKSMTAANIATVFAQQGKKVLLID
ADLRKPTMHYTFRVDNSKGLSNYLVGSDALFETAAASGIENLHVMPCGPIPPNPAELLGSKAMNGLIEEAQQEYDLVIFD
TPPVLAVTDSQILANMCDGALLVVRSKQTENDSAQKAKELLENAHAKILGVVLNGKQIKKSNYYYYYGTNA
>gnl|bykdb|A0A0A2U1F1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Desulfosporosinus sp. Tol-M] (length=242 residues).
MAYSLVTFEQTKSPIAEAYRTLRTNVQFTCVDSDTRKIMITSPGPREGKTTTVANLAVSMAQAGKTVLIIDADLRNPTQH
KLFGLDNAQGLSVALVQDKDYRQYIRETAVPCVRVLTGGPIPPNPAELIGSKRMKRLLQEVSEQYDMVLIDTPPIVAVTD
AAILAQEVDGVILVLASGEVNKDFAQRAKELLDKVGAKILGAVLNKVDAKTSEYYYYYYYHGSDNTKKKHKRRKDRSAPS
EG
>gnl|bykdb|A0A0A3HN53 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lysinibacillus sinduriensis BLB-1 = JCM 15800] (length=236 residues).
MFNKKNKKNKKQAKKPRKLVTMSDDNAFISEQFRTIRANINFSLPGQESKTILITSSLAGEGKSTIAANIAVVFAQEGKK
VLLIDADLRKPTLQFTFNIRDHIGLTHVLIGKNYYFNAIQETPIPGLDVLPCGAIPPNPTELLSSKNMDTLLIDLKEKYD
LIILDGPPLITISDSQILGNKCDGTLFIISSGISKKEDLLKSEEILSTSKAKIIGIVLNNYKLSKNDYQNYYTYTN
>gnl|bykdb|A0A0A3HUS9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lysinibacillus manganicus DSM 26584] (length=236 residues).
MAKKKSSKPNSSTSTAPKTLISFTEPKSYIAEQFKTLRTNINFTLPGDDAKKLLVTSTIPGEGKSTITANLGFVFAQEGK
RVLIIDADLRKPTLHATFNLPNKIGLSNMFTKQVSFVHAIKETFIYDLYVLPSGPVPLNPSELLSSKTMDQFLKTIEDYF
DVIIFDAPPILTVTDAQILSNKCDGTVLVINSGTVNRKELLKAKSALLSSHANILGVVLNNFNSKTNNYYEKLYKS
>gnl|bykdb|A0A0A3HYW9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lysinibacillus manganicus DSM 26584] (length=230 residues).
MLRRKEVDPLRRKPKNLITLSEKNSYIAEQFRTIRANIKFIQEEQKFKTAVITSSIPGEGKSTNAANIAVVFAQEGKKVL
LIDADLRKPTMHYTFRLQNEFGLSNILSGLSKSNFGIQETLIDGLDILTSGPIPHNPAELLASTYLDILLEEVRSNYHII
IFDTPPILAASDAQILANKCDGTILIANIGYVKKWELEKTNASIHASKANLLGIILNNYKLAKSSYYYYE
>gnl|bykdb|A0A0A3I189 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lysinibacillus manganicus DSM 26584] (length=234 residues).
MFKKKNKIGNAMARKLIVQAAPKSYISEQYRSIRTNIKFSMPDQDLKTLLVTSSGPSEGKSTTSANIAGVFSQEGKRVLL
IDADMRKPTAHYTFKLRNSHGLSNLLTKQCEIHEAIQQTNVEGLWVLPSGVIPPNPAELLASNQMEFVLEQLKQDFDLII
LDAPPILSVTDAQIISHKSDATILVVNSGATGKEEVAKAKDILDKSKANVIGVVMNNFALQKDHYYYQYYGNEG
>gnl|bykdb|A0A0A3ID23 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lysinibacillus boronitolerans JCM 21713 = 10a = NBRC 103108] (length=233 residues).
MFWKKKKKKKLVKMARKLVTIANGQSFISEQFRTIRTNITFSMPDKEIKTILVTSATPGEGKSTNAANIGVVFAQEGKRV
IIVDADLRKPTMHYTFLLQNARGLSNLLTRHFTMSEVINSTDIANLFVLTSGPIPPNPAELLASNVMESVIENLKKEFDI
IIFDAPPILSVTDAQILSNKCDGTLLIVNSGVAENESVLKAKSNLEASKANILGVILNNYKMPLHQYYEQYYY
>gnl|bykdb|A0A0A3IGK6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lysinibacillus sinduriensis BLB-1 = JCM 15800] (length=233 residues).
MLKRKRKKSNTMSRKIVAATHPKSINAEQYRTIRTNINFSMPDQELRTLLVTSASPAEGKSTTASNISVVFAQEGKKVLL
IDADMRKPTSHHTFKLTNMYGLSTVLTRQGEVEEAIQKTDVENLWVMTSGPIPPNPAELLASKNMDFLYSRLQEDFDLLV
FDTPPILSVSDAQIVSNKVDGTVLVINTGQSEKESSLKAKELLLSAKANILGVILNNFNLEKNQYYYQYYGEG
>gnl|bykdb|A0A0A3INZ8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lysinibacillus odysseyi 34hs-1 = NBRC 100172] (length=241 residues).
MFGRKNRDRKKQIKLLKAGRKLITLLDGSSIISEQFRTIRTNITFAMPDCEVKTILVTSTIPGEGKSTTTANLGVVFAQE
GKRVLIIDADLRKPTLHYAFGLFNTVGLSNVLVRKRAFYESIQETSVSGLAILPSGPIPSNPAELLSSKTMDALLDELKN
LYDIIIIDAPPVLPVTDAQVLANKCDGTLLVANAGVITKELIIKAKSILATSQANMIGVVLNNCKMPRDHKRYYGYYGAG
H
>gnl|bykdb|A0A0A3J677 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lysinibacillus massiliensis 4400831 = CIP 108448 = CCUG 49529] (length=222 residues).
MSVPLARKLITSTSPKSIISEQFRTIRTNIEFSSPDQTIKTILVTSSVPGEGKTTTAANLAVVFAQEGKKVLIVDSDMRK
PALHYTFDILNEKGLSNVLTRHQNHFLALSNTNIENLFIIPSGPIPPNPSELLSTQKFEIFLEEVKELYDLIIFDAPPLL
SVTDAQILSHKCDGTILVVKSGFVDKVDVLKAKTSLNTVHAKILGVVLNNYNTTNSNYYEYY
>gnl|bykdb|A0A0A5G2V2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pontibacillus litoralis JSM 072002] (length=231 residues).
MWKKQRKPSRHQARTLITDLNPKSPIAEQFRTIRTNINFSFVDTDMETLMVTSSGPSEGKSSITANLAVVFAQQGKSVLL
IDADLRKPTLHYTLRTNNTVGLSSCLVGTQTLEETVQTTAIDNLYAMTSGPIPPNPSELLGSRAMRKLIHDARAKYDVVI
FDTPPVLAVTDAQILSNLCDGTILVVRHKQTDIEQAKRAKELLDKAEGKLIGTVLNDMNKQKQNYYYYYGD
>gnl|bykdb|A0A0A5GCT0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pontibacillus marinus BH030004 = DSM 16465] (length=233 residues).
MARSKKKSLLNKARTLITNTNPKSPISEQYRTIRTNLQFASVDSELRTMLVTSAGPSEGKSMTASNVATVFAQQGKRVLL
IDADLRKPTVHYTFRVDNMKGLSTYLVGQGSLSETVSESHIENLDILPSGPIPPNPAEILGSQAMSTLIQEAQQSYDLVI
FDTPPVLAVTDSQILANACDGVLLVVRSKQTENEAAEKAKELLEKAQAKLLGVVLNGKEIKNSNYYYYYGNSS
>gnl|bykdb|A0A0A5GPK9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pontibacillus halophilus JSM 076056 = DSM 19796] (length=232 residues).
MARRKKNVTQKARNLITNLNPKSPISEQYRTIRTNLQFASVDNELRSLLITSTGPSEGKSLTSGNLATTFAQQGKKVLLI
DADLRKPTAQYTFRVPNVKGLSNYLVTKDSTLTDLVHQTEIEHLDVLPSGPIPPNPSEILGSKAMVRLLEEALELYDQVV
VDAPPVLAVTDAQILANLVDGVLMVVRSKQTDNEAAIKAKKLLDAGNSKLLGVVLNDKEAKSSNYYYYYGQS
>gnl|bykdb|A0A0A6S102 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus uberis] (length=240 residues).
MVQLELVKSKKNLYDIAEEYYNSIRTNIQFSGRHLKVITLTSVQPAEGKSTTSTNLAISFAKAGFKTLLIDADIRNSVMS
GTFKANEKYEGLSSYLSGNAELSAVISYTNIPNMMLIPSGQVPPNPTTLLQNSNFNFMIDTVKELFDYVIIDTPPIGLVI
DSAIISQKADATILVTEAGVIKRRFIQKAKDQMEQSGVQFLGVILNKVEDTIDSYGGYGSYGSYGDYGKSKRKKKSSRKK
>gnl|bykdb|A0A0A7FX28 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium baratii str. Sullivan] (length=215 residues).
MFVLEKQPKSVEAESYRILRTNIMYSSFDKKIKRILVTSSEPGEGKSTTSGNLSLAFAQDEKKVILIDCDLRKPSLHKKF
RISNNRGLSDVIIDRDKLNKCIQKRTEYLDILTSGKIPPNPSEMLGSQAMTSLLDELSNIYDVIILDSPPVLAVTDAQIL
STKVDGTVLVVRAEKTKKDTVLATKGVLDKVNANILGTVLNAGDKNKDNYYYYYG
>gnl|bykdb|A0A0A7FZ06 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium baratii str. Sullivan] (length=217 residues).
MFIVSKDPKSIAAENYRILRTNIQYSSFDKEIRRVLVTSSEPGEGKSTTAGNLALTFAQDGKKTIIIDCDLRKPSLHKKF
NVSNSIGLSDVIIDKKNIEKSVKKIEGNLDILTAGKIPPNPSELLGSKALNNLLEALEEVYDVIVIDSPPVLAVTDAQIL
SKKVDGTVLVVRSNYTKKDTVMAAKDVLIKVKANILGTVLTRTDSNKHGYYYYYGRE
>gnl|bykdb|A0A0A7M6J2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=227 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMS
GFFKPVTKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLIATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGNVRRSAVKKVKEQLEQTGTPFLGVILNKYDVVTEKYGEYGNYRNYGRK
>gnl|bykdb|A0A0A7P9W0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGHVKRSSLKKVKEQLDQTGTPFLGVILNKYDIANEKYSEYGNYGHYGKKA
>gnl|bykdb|A0A0A7U4K9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus brevis BSO 464] (length=256 residues).
MTTMAWFKRNKKKLDDTSLKYGVGLVSYTEPNGMIAEQFKTIRTNIQFSSVDKQLQSILFTSSEPSEGKSTISNNMAVTW
ADQGTKVVLVDADLRRPTVHCSFDVSNRMGLTNYLSGNADLSAVVRETMVKDLSVITSGPVPPNPAELLGSKRIENLLSE
LTAEFDLVIVDAPPVNTVTDAQLLASRIDGTVLVVPQGIADKNGVRRAKQLLETVHANILGTVMNRVTAQKSVGYYGGNY
YGGSYYGGYYGTDDKK
>gnl|bykdb|A0A0A8HNH3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus hyicus] (length=235 residues).
MFKSKKHKKTTTNKKKLIVDHTPKSPVSEQFRGIRTNISFSNVNDDLTSVVITSARPSSGKSTVSANLAITYAQSNYRTL
IIDADMRKPTQHFIFELSNKEGLSSLLSGQSSGDIAIKQTHIDNLDVLTSGPVPPNPSEMLNSKAFRNVFESALDVYDFI
VIDTPPVNSVTDSQLVAKISKQVVLVIDVNNNNRKEIQRAKDLLEKSGANLLGVVLNKLKGKSDEYYAYYGAEER
>gnl|bykdb|A0A0A8VVA9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paeniclostridium sordellii] (length=237 residues).
MNIVAFKEPKSPISEAYRSIRTNIQFSNIDKNIQTILFTSSKQDEGKTTVVANMGVSFAALEGKKVLIIDADLRNPSIHR
KFNLTNTYGLTEVLSGQKDLKKAIQNTEVNNLQILTTGKMPPNPSEMLESKKMKEFAQTLQESYDYIFIDSPPIGVITDA
GSIANYSDATVLVVGSGETDIEMAKITKLRLEKVKANIIGVVLNKYVGEDSNYGYYSYCYEQNDGSRSARHKKKNKK
>gnl|bykdb|A0A0A8VWV1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paeniclostridium sordellii] (length=237 residues).
MNIVAFKEPKSPISEAYRSIRTNIQFSNIDKNIQTILFTSSKQDEGKTTVVANMGVSFAALEGKKVLIIDADLRNPSIHR
KFNLTNTYGLTEVLSGQKDFKKAIQNTEINNLQILTTGKMPPNPSEMLESKKMKEFAQTLEESYDYIFIDSPPIGVITDA
GSIANYSDATVLVVGSGETDIEMAKITKERLEKVKANIIGVVLNKYVGEDSAYGYYSYCYEQNDGSRRARHKKKNKK
>gnl|bykdb|A0A0A8X8D4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus selenatarsenatis SF-1] (length=234 residues).
MVNKKSTKKKLMDNKRKLVTKLDPKSPISEQYRTIRTNIHFSSIDKEITTLMVTSTGPGEGKSTTAANLAVTFAQQGKQV
LIVDADMRKPTVHYTFNQTNSVGLTSVLTNQTPLLDAVKLTDVANLMVLSSGPIPPNPSELLSSRAMKQFIEDASKNFSV
ILFDTPPVLAVTDAQILANQCDGTILVVSSGVTEQDQALRAKEMLTSAKGKLLGVVLNNKKMDGKEQYYYYGAN
>gnl|bykdb|A0A0B0D0Q7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Halobacillus sp. BBL2006] (length=231 residues).
MARKPKKTMQTRGRSLIANDNPKSPISEQFRTIRTNLQFTSIDKDLETMLVTSASPSEGKSITTANTAVVFAQQGKKVLL
IDADLRKPTIHYTFRTDNTYGLSNYLVGNRSIFDLVRESEIENLDILPCGPIPPNPSELLGSRKMEKFIREAKQSYDMVI
FDTPPVLAVTDSQVLSRFVDGVMLVVRSKQTEQEAAHKAKELLLKSKANILGAVLNDKDIKSSNYYYYYGS
>gnl|bykdb|A0A0B0D234 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Halobacillus sp. BBL2006] (length=223 residues).
MQTSARSLIANDNPKSPIAEQFRTIRTNLQFSSVDKELETMLVTSASPSEGKSITTANTAVVFAQQGKKVLLVDADLRKP
TIHYTFRTDNTYGLSNYLVSERPLSDLVRESHIDNLDLLPCGPIPPNPSELLGSKKMKKFINEAHQKYDMIIFDTPPVLA
VTDSQVLSAFVDGVLLVVRSKQTEQEAAIKAKEQLLQSKATILGVVLNDKDVKSSSYYYYYGK
>gnl|bykdb|A0A0B0HRS4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. P1XP2] (length=229 residues).
MRRSINDRSLIVSANPMSPISEVYRLLRTKIHYLSKDHESSVVMVTSSQAGEGKTTTICNLAVTYALEGKRVLLIDADLR
KPSLHRIFSLSNDHGLSTLLTGNANMEDAIQETMVACLSLLPSGPVPANPSELIASATLQELLESVKQEYDMILVDTPPV
LTATDPVITSTLCDGVVMVVAVGRVKKDHLKKAKEQLDHVNARMLGIVLNRINRDDQQLFYMKHYGAKG
>gnl|bykdb|A0A0B0HS13 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. P1XP2] (length=231 residues).
MSRSQNNRRHLIVLTNPRSPISESYRTLRTNIDFSSVDQVTQVIMVTSAGPEEGKSTVVGNLAVTYAQDNRNVLLIDADM
RKPTVHRTFQLSNIAGLSSVLSRQFSLDEAIQATEIPNFYVMTAGAIPPNPAEMLNSKSMAQLMAELREQFDVILIDTPP
VLAVTDAQLLASQSDGVLMVINTGKVKKEIALKAKETLQRVNARMLGVVLNNVKRKASEEYYYYYYASNDN
>gnl|bykdb|A0A0B0IBL7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus okhensis] (length=231 residues).
MSRKAKVTQARQRRNLITDTGKSSPISEQYRTIRTNIEFSAVDKDIRSILVTSAGPAEGKSTTAANLAVVMAQNGQSVLL
LDADLRKPTAHYTFGVSNMSGLTNVLSKQQTLEETIQQTKIDNLSVLTCGPIPPNPAELLNSRRMSLVLERAQEIFDTVI
LDSPPVMAVADAQILASKCDGTVLVISSGKTEKEEVKKAKEQLQNAKATILGAVLNNKKIESGSYYYYSNN
>gnl|bykdb|A0A0B0QDM1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus altitudinis] (length=227 residues).
MIFKRKKREKRDLSCISVLNPHSVIAEQFRTIRTNIEFTSIQTRLKSILVTSSLPKEGKSFTAANLAAVFAQQKKRVLLM
DADLRKPAIHEYFDLSPHTGLTNVLLNNCSLEEAILPTPIEHLELLPSGTIPPNPAELLSSSVMKQLFYEIEQQYDMVIV
DSTPLLPVADAKILANRTDGSILVVLSGKTKIAAVKKSKEVLEGTTGKLLGAMLNGKKVKKGRHYMY
>gnl|bykdb|A0A0B1Y2E3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lysinibacillus sp. A1] (length=232 residues).
MLFKRKTKRIPMARKLITVSDMMSIPSEQYRTIRANIKFSQPNQDVKTILVTSSIAGEGKSTNAANIGVVFSQEGKRVLI
IDADMRKPTLHHTFYLDNIFGLSSVLSRQATLQEVIQETFVEGVDIISSGAIPPNPTELLASETMSFLLHEVKEQYDIVM
IDAPPLLFLSDAQILSNKCDGTLLVVNTGTVGKAAVVKSKSILTISKANILGVILNNYKMKGSTYEQYYGKE
>gnl|bykdb|A0A0B2FA58 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. IHB B 3415] (length=228 residues).
MSQQPNKQRHLITVTNPRSPVSEAFRALRTNIDFSSVDERIQIIMVTSSGPEEGKSTVTANLAAAYAQADKKVLLIDGDL
RKPTAHKTFSLSNRYGLSSLLSQQADLSEVIQESGVNNLSLMTSGPIPPNPAEMMASNRMSAVLQELRQLYDVVLIDTPP
LLAVTDAQIVASKSDGVIMVVSYGKVKRDIAVKAKAGLDRVGARMLGVVLNNVKRKASEGYYYYYYGN
>gnl|bykdb|A0A0B2XEX4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus curvatus] (length=243 residues).
MGLFKKEKSLDQASMKEGVGLITLTEPTSVIAEQFRTVRTNIQFSSIDQKLRSVVFTSAGPSQGKSTVSANVAVTWADQG
VDVLLVDADMRRPTVHQTFQVPNKRGLTSLLTDETFDLTNTIQKTPVDHLFVLPCGVVPPNPSELLNTKKMDKLIQELTK
HFDLVIFDVPPVISVTDAQILASKVDGTILVVPQGIVEKGSVAKAKELLEVVNARILGTIMNRVKAENTGGYYGGYYGAE
EIK
>gnl|bykdb|A0A0B3VM38 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Terrisporobacter othiniensis] (length=230 residues).
MLGLYDSGSFEINEAYREIRTNISLNTDIKTIVFTSAEMDEGKTTTVCSIAKCFSDLENHRILLIDCDFRKKSVAKTLEI
ENKKGIADMTMNDMDRKECIKKVEGFDVLTCGVSPSNSSVLLESKKFRDIIESLKGDYDYIFIDSPPLGRLNDAAILARY
LDGTIIVNASEYIDQQMAKVTRDKLEKVNANVIGVILNKFKAGDHKYYKYYGYYKEEKGKKSFFKKRKRR
>gnl|bykdb|A0A0B4RE03 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planococcus sp. PAMC 21323] (length=236 residues).
MVKKKNKPEAHGRKLVAFTNPKSRVSEQFRTLRTNIHFTAPNRDIRSLVVTSASHSEGKSTTSSNLAIVFAQEGKRVLLI
DADMRKPTMHQTFKISNSKGLSNVLIRRVSLKMAIQTSGIENLDLLPSGPIPPNPAELLSSSNMDLLFEDALDTYDLLIF
DTPPVLSVTDSVILANKCEGTILVLNSGKTERAHALKAKAAITAASKSRLLGTVLNNVQVQKDFDYAQYYTQTTTN
>gnl|bykdb|A0A0B4RE18 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planococcus sp. PAMC 21323] (length=221 residues).
MPRKLVVRTNPHSIAAEQYRTIRTNINFSIPELGSKIILFTSASKEEGKSTTAANMAIVFAETGKRVLLIDADMRRPTLY
RTFQLSNNTGLSNLLLGKGNLKQSVKASGIPNLDLLMSGQIPPNPAELLESGILDELMAEMREVYDYVLFDSPPILSVTD
AKILANRCDGTVLVVNTGKSEKVSVEKARDSLATAKSFILGVVLNNYPLTSENYYYHNYSE
>gnl|bykdb|A0A0B4RE70 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planococcus sp. PAMC 21323] (length=233 residues).
MARKKKVLQETARKLIAFTTPRSFVSEQFRTLRTNINFSSPDSEIHTMVITSAAPSEGKSTTAANLAVVFAQEGKKVLLI
DGDMRKPTTHYTFRMGNTIGLSSVLTRQSSLQEVIRTTSVDRLDLMTCGPIPPNPAELLASKSMDTLIGQLKNMYDLIIF
DAPPVLSVADGQILANKCEGTILVLSSGNTEKDMAIKAKEAIESSNSRLIGAVLNNFELPKDNYYYQYYGNTE
>gnl|bykdb|A0A0B4SBN9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. WP8] (length=227 residues).
MIFKRKKREKRDLSCISVLNPHSVIAEQFRTIRTNIEFTSIQTRLKSILVTSSLPKEGKSFTAANLAAVFAQQNKRVLLM
DADLRKPAVHEYFDLSHHTGLTNVLLNNCSLEEAILPTPIEHLELLPSGTIPPNPAELLSSSVMKQLFYEIEQQYDMVIV
DSTPLLPVADAKILANRTDGSILVVLSGKTKIAAVKKSKEVLEGTTSKLLGAMLNGKKEKKGRLYMY
>gnl|bykdb|A0A0B4WAQ8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium botulinum Prevot_594] (length=236 residues).
MNRKLELITIKDPKSPISEAYRTLRTNIQFSSFDEKISVIFVTSSTPGEGKSTTSANLAITMAQNGAKTILVDCDLRKPN
VHKLFKLSNTRGLSNLLIEDNSIDGVIQQSSVENLHILTSGVKPPNPSELLSSQKMKKFIEMSKEHYDYIMLDTPPVGVV
TDAQLVSQYSDGGILVTASGQVERELAIRAKQLLQKVNAKILGVVLNKVDTESGSGYRYYNYYYEENGEKKKRSKK
>gnl|bykdb|A0A0B5APV7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Jeotgalibacillus malaysiensis] (length=233 residues).
MAAKKKQGSNNHSRNLIAKVNPKAVASEQYRTIRTNIQFSAVDNAIQTMIVTSSGPGEGKSTTASNMAIVFAQSGKRTLL
IDADMRKPTAHYTFNVMNTRGLTNVLTKQNDLSEAIQEVDVNKLHVLTSGPIPPNPSELLGSRGMDYFLEQAKEAYDIII
FDTPPVLAVTDAQILANRCDGAILVVRSQVADKEKALKAKELLESANARILGAVLNDKKMDTGDDYYYYYGNE
>gnl|bykdb|A0A0B5NEV1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSLYDL
VIFDMPPILAVTDAQIMANQCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A0B5Q6G6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium beijerinckii] (length=238 residues).
MFSARKLHKAVENQEYRGFVVEKKPKSIVSEAYRTLRTNIQYSSFDKTIKTIVVTSAEAAEGKSTVSGNLALSFAQNEKK
VIIVDCDLRKPSVHKNFKLSNLSGLSEVLIGKEDLDKVIQNRNENLDILTSGKIPPNPSEMLSSTAMTNLIQKLGEKYDI
VILDSAPLQAVTDAQILSTKADGTILVVRAQRTSRESVIDAKNLLTKVGANILGTVLHAVENTRGKYYYYYGSSEEGK
>gnl|bykdb|A0A0B5QHH3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium beijerinckii] (length=240 residues).
MKSYKLEKTVVDNRIHAGFIVEDKPKSIVAEAYRTLRTNIQYSSFDKEIRTIAVTSAEMAEGKSTVAGNIAASFAQNEKK
VILVDCDLRKPSVHKNFKVSNLIGLSEVLLGKAAIEEAVQKRNDNFYFLTSGKIPPNPSEMLSSSAMSNLIERLKVEFNI
VVLDTAPLKAVTDAQILSTKVDGTILVIRAGETKRDIVMDAKNLLDKVGANIIGTVLHAVENTRGKYSYYYGNDEDKDNL
>gnl|bykdb|A0A0B5QHR5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium beijerinckii] (length=242 residues).
MLMVRGLRKGIASQQYNGFIVEKKPRSMVSEAYKKLRTNIQYSSFDKEIKTIVVTSAQASEGKSTVSGNLALSFAQIDKK
VVIVDCDLRKPSVHKNFKISNLVGLSEVITGQVNLGDTVQKYNDNLYILPSGKIPPNPSEMLSSSAMAELIENLRDKYDI
VILDSAPLGAVADAQILSAKVDGTILVIKAQRTNKESVIEAKNFLNKVGANIIGVVLNSVETIKEKNYYYYETSEEPRQV
TE
>gnl|bykdb|A0A0B5S7Y2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus mycoides] (length=229 residues).
MVLKKKILRARRQLIAYEQPKSSVSEQYRNIRTNIEFASVDKKIRSLIVTSANQSEGKTTTAANIAVVFAQQGKKVLLID
ADLRKPALHQMMQVDNIFGLTSVLTRSNTLETCVTQTKIGNLTFLPCGPIPPNPAELLGASSMKDLLSEAFGTYDLVIFD
TSPILPVTDAQIMANQCDASVLVIRSGVTEKEAALKAKQSLDSAKGTLLGVVLNDKEQNGSEYYYYGSN
>gnl|bykdb|A0A0B6A6P9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus megaterium] (length=236 residues).
MARKNKAQKNDKMLTLKRRLLAHNSPKDPVAEQYRTIRTNIQFSNVDQDIKTIVVTSSGAEEGKSTTASNLATVYAQQGL
KVLLIDADLRKPTGHYTFRLENHIGLTNVLTRQSTLAQAVQESEIPHLSVLTSGPIPPNPSELLASAQMAELLKEMKEQF
DMIIFDTPPILAVADAQILANQVDGTILVVSSGKTEKDAALKSKELLSNAQGKLLGVVLNNRKVEEGNYYYYYGTN
>gnl|bykdb|A0A0B7GNH4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sanguinis] (length=232 residues).
MATLELVRKKRNLVKLTEEYYNALSTNVQLSGANIKMVEISSVTANEGKSTTSVNLAAAFARAGHKTLMIDADIRNSVMS
GVFSSQRKVSGLTDYLSGQAALHEVINDTDMDNLDVILSGPVSPNPTGLLQSKQFEALLTDLRVRYDYIIVDTSPIGLVI
DAAIIAQKCDASFLVTQAGHIKRKAVMKAKEQLEQTGTPFLGVVLNKYNIDLERYGAYGTYGGYGSYGNYGK
>gnl|bykdb|A0A0C1KET2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus constellatus] (length=230 residues).
MPRLELAKNKEKALKKSEEYYNALRTNIQLSGENIKVIAVTSVQSGEGKSTTSTNLAIAFARSGYNTLLIDADIRNSVMS
GVFKTRDKITGLTDYLAGAADLSNGLCDTNVENLFVIEAGQISPNPTALLQSKNFGMMIDILRNHYDYIIIDTPPIGIVI
DAAIIAQKCDASALVVESGNVKRKALQKAKEQLEQTGTPFLGVILNKYDTQLEKYGSYGNYGDYGNYGKK
>gnl|bykdb|A0A0C1PL30 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus brevis] (length=256 residues).
MTTMAWFKRNKKKLDDTSLKYGVGLVSYTEPNGMIAEQFKTIRTNIQFSSVDKQLQSILFTSSEPSEGKSTISNNMAVTW
ADQGTKVVLVDADLRRPTVHRSFDVSNRMGLTNYLSGNADLSAVVRETMVKDLSVITSGPVPPNPAELLGSKRIENLLSE
LTAEFDLVIVDAPPVNTVTDAQLLASRIDGTVLVVPQGIADKNGVRRAKQLLETVHANILGTVMNRVTAQKSVGYYGGNY
YGGSYYGGYYGTDDKK
>gnl|bykdb|A0A0C2E807 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Salinicoccus roseus] (length=235 residues).
MFGKNKARNYVSGPRELIVEKKPKSPVSEQFRTVRTNIMYSNIDTEIKTVLVTSATPGAGKSTTAANLAVAYAQSGKKTL
LMDADLRRPTTHYTFEVTNQRGLSTVIVNDVPVENIVRETEIENLDIVSSGPIPPNPSELLSSKKMTHLLKTFSMHYDMV
IIDSPPLLAVTDAQVLSKITDGTVLVTNVAENNRDKLREAKDLLNKADANILGVVMNNKKMNTKKDDYYYYYGSE
>gnl|bykdb|A0A0C2Q590 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus pumilus] (length=227 residues).
MIFKRKKREKRDLSCISVLNPHSVIAEQFRTIRTNIEFTSIQTRLKSILVTSSLPKEGKSFTAANLAAVFAQQNKRVLLM
DADLRKPAVHEYFDLSHHTGLTNVLLNNCSLEEAILPTPIEHLELLPSGTIPPNPAELLSSSVMKQLFYEIEQQYDMVIV
DSTPLLPVADAKILANRTDGSILVVLSGKTKIAAVKKSKEVLEGTTSKLLGAMLNGKKEKKGRLYMY
>gnl|bykdb|A0A0C2UF46 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Cohnella kolymensis] (length=230 residues).
MSKPILRTKKRHIIVHNNPKSPVSEAYRSLRTNIQFSSVDTRIQTIMVTSASPGEGKSTTAINLAATYAQAEHKVLLIDA
DLRKPSIHHTFLCSNRFGLTNWLTNSRPVSEVVVKTFVPNLYLLPSGAIAPNPSELLSSKKMSKLLEELKQEFDIIILDS
PPVLAVTDAQIIASISDGVVMVADSGKVKIATAQKAKEKLEHVNAKILGVAINNIKRSSHDDYYYYYGET
>gnl|bykdb|A0A0C2UFI4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus badius] (length=234 residues).
MVLKKQKHKSLGQTKRKLITNVDPKSPISEQYRTIRTNILFSAVDRDIQSLLITSAGPGEGKSTTAANLAIVFAQQGKNV
LLVDADMRKPTMHYTFNFTNTIGLTNVLAKQKSISAAVKETDMQNLSVLLSGPIPPNPAELLGSRVMAEFLEEARRLYDL
VIFDTPPVLAVTDAQVLANQCDGTVFVVNSGQTEVDNAVKAKELLQAAKAKLLGVVLNNRKAKETNHYYYYGNK
>gnl|bykdb|A0A0C2UT93 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. VKM B-2647] (length=236 residues).
MSSSRRNERWPLITNTNTKSPISEAYRILRTNIEFSNVDRNLKCIMFASSQFGEGKSTTASNLAVTYAQTNRKVLLIDCD
MRRPSQHHIFMLSNRYGLSSYLSHQVDLDEIIVDSTIPNLSVIVAGPIPPNPSELLASKRMSAMLEQLREQFDMIIIDTP
PIMAVADAQIAATLCDGVLLVMDSGRVKREIAMKSKQKLEHVKARILGVVLNKISRKNANSYYYYYYGDRDQGEEA
>gnl|bykdb|A0A0C2VGB9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Jeotgalibacillus campisalis] (length=233 residues).
MAAKPKKSNMDSKKRNLIAEYNPKSVASEQYRTIRTNIQFSAIDEDIRTITVSSSSPGEGKSTTAANLAIVFAQQGKKVL
LVDADMRKPTVHFTFNMMNTIGLTTVLTRQSELDKTANQTDIENLDILSSGPIPPNPSELLSSRVMNRFFDTAKNMYDLI
IFDTPPVLAVTDAQVLSHQCDGTILVVRAGIADKDKVTKAKEAIVSAKAKILGVVLNDKKMKSNDEYYYYGNN
>gnl|bykdb|A0A0C2W152 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Jeotgalibacillus soli] (length=232 residues).
MANKGRKNNSQVQSRNLITKYNPKSVASEQYRTIRTNIQFSAIEDDIRTLSITSSGPGEGKSTTAANLAVVFAQQGKRTL
LVDADMRKPTVHYTFNMMNTSGLTNVLTRQIELVDAAKKTDVEKLDILTSGPIPPNPSELLSSRIMERFFETALEHYDLI
IFDTPPVLAVTDAQILSNQCDGSILVVRSRVADKDQTLKAKELMVAAQAKILGVILNDKKMENGEDYYYYGN
>gnl|bykdb|A0A0C3ADP2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus kunkeei] (length=239 residues).
MGLFNKSPKKKLNDDSSKFGVNLVAELYPTSSVSEQFRTVMTNISFANINGDLKSVMVTSSDPSEGKSTFSANLAVTYAK
QGRNVVLVDADMRRPTVHKSFNVSNQKGLSTILSGNSTIEDTIKYTSIDNLNVITSGPIPPNASALLGNRKIVDIINKFN
KPNDLVIVDVPPVNTMTDASIVSTTVDGTIFVLPQGVAEKKRAKMAVEQLKKVNANILGGVMNMSKDNITNDYYYYYSK
>gnl|bykdb|A0A0C5CFM3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus coagulans] (length=210 residues).
MSPISEQFRTIRTNISFSSVDNDLQLLMVTSSGPGEGKSTIVGNLAVVFAQQGKRVLLVDADLRRPTVHYTFGMTNTFGL
TTVLTKQGTLLETVSKCDVENLHLLPSGPIPPNPAELLSSRAMKEFLKEAKEQYDIILLDTPPVLAVTDAQVLTNQCDGT
ILVVSSGKAEVEAVKKAKELLESANANLLGVVLNNKKTQNTHYYYYYGKD
>gnl|bykdb|A0A0C7E9T9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paeniclostridium sordellii] (length=237 residues).
MNIVAFKEPKSPISEAYRSIRTNIQFSNIDKNIKTILFTSSKQDEGKTTVVANMGVSFAALEGKKVLIIDADLRNPSIHR
KFNLTNTYGLTEVLSGQKDFKKAIQNTEINNLQILTTGKMPPNPSEMLESKRMKEFAQTLEESYDYIFIDSPPIGVITDA
GSIANYSDATVLVVGSGETDIEMAKITKLKLEKVKANIIGVVLNKYVGEDSAYGYYSYCYEQNDGSRSARHKKKNKK
>gnl|bykdb|A0A0C9NVR6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus paracasei NRIC 0644] (length=248 residues).
MNFSLKEILPHHKVDQETQKNGVMLVTFAEPKHVVAEQFRTVRTNIEFAGAALDVCKVIMFTSSAMSEGKSTVSANVAVT
WAQAGKKVLLIDADLRRPTVHATFRTLNLDGVTTVLTGKNTPEQVVETTFVDHLSIITSGPVPPNPSELLNSKRMGKLLD
WARNNFDIIVLDAPPVLAVSDVQVLVPKTDGVVVVANMGKTLKGDLERTVEVLKFANAKILGSVERVKAKHGDRGYGYGY
GYGYGNEK
>gnl|bykdb|A0A0D0FE92 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thermoamylovorans] (length=231 residues).
MARNKTTSRSKRHLIAKKDPKSPITEQYRTIRTNIQYASVDQAIRSIVVTSTGPMEGKSTTTANLAVVFAQQGKKTLLID
ADLRKPTAHYTFQLPNTFGLTSVLTKQAELMDAVHMTDVENLFVLTSGPIPPNPAELLASVSMEYLLKEAYNLYDFILFD
TPPVLTVTDAQVLANLADGSILVTSSGTTDRDGAIKAKEILTSAHAKLLGAVLNNKKADKDTHYYYYYAEH
>gnl|bykdb|A0A0D0FFR1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thermoamylovorans] (length=231 residues).
MARNKTTSRSKRHLIAKKDPKSPITEQYRTIRTNIQYASVDQAIRSIVVTSTGPMEGKSTTTANLAVVFAQQGKKTLLID
ADLRKPTAHYTFQLPNTFGLTSVLTKQAELMDAVHMTDVENLFVLTSGPIPPNPAELLASVSMEYLLKEAYNLYDFILFD
TPPVLTVTDAQVLANLADGSILVTSSGTTDRDGAIKAKEILTSAQAKLLGAVLNNKKADKDTHYYYYYAEH
>gnl|bykdb|A0A0D0FWQ9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thermoamylovorans] (length=231 residues).
MARNKTTSRSKRHLIAKKDPKSPITEQYRTIRTNIQYASVDQAIRSIVVTSSGPMEGKSTTTANLAVVFAQQGKKTLLID
ADLRKPTAHYTFQLPNTVGLTSVLTKQVELMDAVYMTDVENLFVLTSGPIPPNPAELLASVSMEYLLKEAYNLYDFILFD
TPPVLTVTDAQVLANLADGSILVTSSGTTDRDGAIKAKEILTSAQAKLLGAVLNNKKADKDTHYYYYYAEH
>gnl|bykdb|A0A0D0HRJ1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anoxybacillus ayderensis] (length=233 residues).
MVLKKKKQVFERTMRSLITKTNPKSPISEQYRTIRTNIQFSVADRPLRSIMVTSSAPAEGKSTTVANLAVVFAQQGKKVL
LIDADLRKPTVHYTFRKDNYIGLTNVLTKQATLQTAVKETDVENLFVLTSGPIPPNPAELLGSATMEELLAEAYDQFNVV
LFDTPPVLAVTDAQILANQCDGTILVVHSGKTDIEAAQKAKELLLAAKGKLLGVVLNQKKQKESSYYYYYGNK
>gnl|bykdb|A0A0D0Q3J4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. L_1B0_8] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTQSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSRSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANICDASILVVRSESTEKETAVKAKGLLDSAKGKLLGVVLNDRERENGLYYYYGAN
>gnl|bykdb|A0A0D0QHU4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. L_1B0_5] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTQSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSRSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANICDASILVVRSESTEKETAVKAKGLLDSAKGKLLGVVLNDRERENGLYYYYGAN
>gnl|bykdb|A0A0D0SIP0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus gallinarum] (length=234 residues).
MAKKNKGASKISPLFTYDKPKSIISEKFRGIRSNIMFSNADKEISSILITSEKASSGKSTISANIAITYAQAGYRTLIID
GDMRRATQHYVFNLTNNSGLSNLIIGKTLEIDAIKETHIENLDVLTSGPVPPNPSELITTRKFRELYQKLATEYDFIIID
TPPVNTVTDAQLYAQIVRDCILVIDSEKSDKNEVKKAKELIEQSNGKVIGAVLNKAAKDNSSSYYNYYGDGNDD
>gnl|bykdb|A0A0D1A945 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus wasatchensis] (length=240 residues).
MGLFRRNKKLSTDTSANGVKLITAMKPKDVISEQFRTIRTNIDFSSVDRQLKTILFTSSDVSEGKSTISANTAVTWAQQG
KKVLFVDADLRRPTLHTTFGLNNTQGLSTILTQNLDFHDHVYDSGVENLSIITSGPVPPNPAELLNSNRMKALVTQMQEE
YDLVVLDVPPLLSVTDTQVLASSADGVILVVRQGAAQQAAVKRSVELLEMVHANLLGYVLNDVAPKNGYGYGYGYGYGYE
>gnl|bykdb|A0A0D1C0F8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium botulinum B2 450] (length=236 residues).
MNKKLELITIKDPKSPISESYRILRTNIQFSSFDEKISVIFVTSSTPGEGKSTTSANLAITMAQNGAKTILVDCDLRKPN
VHKLFKLSNIRGLSNLLIEDNSIDGVIQQSSVENLHILTSGVKPPNPSELLSSRKMNNFIETSKKHYDYIILDTPPVGVV
TDAQLVSQYSDGGILVTASGQVERELAIRAKQLLEKVNAKIIGVVLNKVDTEFGNGYRYYNYYYEEDGEKKKRNKK
>gnl|bykdb|A0A0D1GF85 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus subsp. aureus] (length=228 residues).
MSKKENTTTTLFVYEKPKSTISEKFRGIRSNIMFSKANGEVKRLLVTSEKPGAGKSTVVSNVAITYAQAGYKTLVIDGDM
RKPTQNYIFNEQNNNGLSSLIIGRTTMSEAITSTEIDNLDLLTAGPVPPNPSELIGSERFKELVDMFNKRYDIIIVDTPP
VNTVTDAQLYARAIKDSLLVIDSEKNDKNEVKKAKTLMEKAGSNILGVILNKAKVDKSSSYYHYYGDE
>gnl|bykdb|A0A0D1J0C4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus subtilis] (length=227 residues).
MIFRKKKARRGLAQISVLHNKSVVAEQYRTIRINIEFSSVQTNLRSILVTSSVPGEGKSFSAANLAAVFAQQQEKKVLLV
DADLRKPTINQTFQVDNVTGLTNVLVGNASLSETVQKTPIDNLYVLTSGPTPPNPAELLSSKAMGDLISEIYEQFSLVIF
DSPPLLAVADAQILANQTDGSVLVVLSGKTKTDTVLKAKDALEQSNAKLLGALLNKKKMKKSEHYSY
>gnl|bykdb|A0A0D1J9K9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus subsp. aureus] (length=230 residues).
MTNTRRSTSSLIVHEQPKSPISEKFRGIRSNIMFANPDSAVQSIVITSEAPGAGKSTIAANLAVAYAQAGYKTLIVDGDM
RKPTQHYIFNLPNNEGLSSLLLNWSTYQDSIISTEIQDLDVLTSGPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPP
VNTVTDAQLFSKFTGNVVYVVNSENNNKDEVKKGKELIEATGAKLLGVVLNRMPKDKSASYYAYYGTDES
>gnl|bykdb|A0A0D1KC27 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus subtilis] (length=221 residues).
MTEPKSLNSEQYRTIRTNIEFASVDRQMKSVMITSACPGEGKSTTAANLAVVFAQQGKKVLLIDADLRKPTVHTAFFLEN
TVGLTSVLLKKSSMEQAVQASNEKHLDVLTSGPIPPNPAELLSSKWMKELAYEACAAYDMVIFDTPPILAVADAQILGNV
ADGSVLVISSGKTEKEQAAKAKEALETCKSKLLGAIMNGKKLSKHSEYGYYGNKDNFMQNK
>gnl|bykdb|A0A0D1R2D1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis Sbt003] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNVEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A0D1RD30 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis Sbt003] (length=229 residues).
MVLKKNKVRQHRQLITHAQSNSVIAEQYRTIRTNIEFAAVDKPIQSLLIASPTSEAGKTTTAANIAVVFAQQGKKVLIVD
TDLRRPVLHELFQVDNKFGLTSTLTGAQILEDCIKRTEVNGLYLLPCGPIPPNPAELLGSETMKETILHLHKIYDFIIFD
TPPILSVSDAQILANQCDSSLLIIRCGVTEKADALKAKHILGNAPGKLLGVVLNDKEQEKGEAYYYSQN
>gnl|bykdb|A0A0D3VC93 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. IHBB 10380] (length=229 residues).
MRRSINDSSLIVSMNPESPISEVYRLLRTNIHYSSIDQALKTIMVTSAQAGEGKTTTISNLAITYAQEGKNVLLIDMDMR
KPSLHHIFSQSNRQGLSTVLTGHTSVQDAIQETMVSHLSLLSSGPIPGNPSDLIDSTAMREMLEQLEQEYDVILMDSPPV
LSVTDSVIASTLCDGVIMVVAAGKVKKVHLKKAKGQLDHVNARLLGIVLNRMNRDNQSNFYMNYYGMKG
>gnl|bykdb|A0A0D3VD82 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. IHBB 10380] (length=228 residues).
MPRSINENHNLVTSINPKSPISEAYRTLRTNILFSSIDEQIRTIMVASAQAGEGKTITVSNLAVAYAQEGKKVLLIDVDF
RKPSLHKVFTVSNQTGLTSVLSNQCELQDVVRETFVEHLDVITSGPIPPNPSEMLSSRKMKTVLEETKDLYDVILFDTPP
VLAVTDALIVSSFCDGVILVVNSSKVKKEVVKKAKANLEHVNARFLGVVLNNINVGKDNPYYYYYGEK
>gnl|bykdb|A0A0D4CMJ0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus mucosae LM1] (length=252 residues).
MGIFKRKSRIDNNTMKNGAKLITVAKPKSVAAEQFRTVRTNIHFMAVDRRLKTIAFTSANISEGKSTVAANLAIVWAQEG
KSVLLIDADMRRPTLNSTFDLTGQSGLSTVLSSDQSEVNLNDVIQESGIEGLDLLPSGAVPPNPAELLSSQRMKVLLEAV
QAQYDLVVLDVPPMLEVTDTQTIAGSVDGVVLVVRQGITQKAGVRRAVELLKMSHAHLLGYVMNDVVPEDDAGYGYGYGY
GYGYGYEKESEN
>gnl|bykdb|A0A0D5NGD5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus beijingensis] (length=229 residues).
MPRQINNSNLITFYVPKSPISEAYRTLRTNIQFSSIDKKIRVLMVASAQSGEGKSTTVSNLAVTYAQEGKKVLLIDADLR
KPTIHRIFGLSNRTGLTSVITGQFHSSEAIQSTEVENLSILPSGAVPPNPAELLASQKMKAFINEMKDTYDIIIFDTPPV
LAVADSLIVSSVCDGVVIVIQEGKVKRELVKRAKESLERVNAKLIGVVLNNVKKSKKNGYYYYYHETAE
>gnl|bykdb|A0A0D5NL38 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus beijingensis] (length=228 residues).
MPRLISNSNLVTLHTPKSPISEAYRTLRTNIQFSSIDNKINVLMVASAQSGEGKSTTVSNLAVTYAQEGKKVLLIDADLR
KPTMHRIFGLSNRVGLTSVITGQIRPSDAIQSTEVINLSLLPSGTIPPNPAELLASQKMKAFVNEMKGAYDMVIFDTPPV
LAVADSLIVSSVCDGVVIVVQEGRVKRELVRKAKESLERVNAKLIGVVLNNVKKSKDGYYYYYRETAE
>gnl|bykdb|A0A0D6A0S2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus acetotolerans] (length=262 residues).
MSLFKKKRGIDETIKKGAKLITVADPKSPVTEQFRTIRTNIKFMAVDHDIKSVAFTSANISEGKSTVAANVAVTYAQAGR
KVLLIDADLRRPTVHRTFNLSNHVGLSTVISSTAKKVDLDEVVQDSGIADLAILPAGPTPPNPSELIGSKRMQDFISLVE
DHYDMVIIDLAPVLEVSDTQELARRLDGIILVVRQGKTQKAAIKRAVEILNFSKAKVLGFIMNDISPDNAGYGYGYGYGY
GYGYGYGEEDKKKKGFFSGRKK
>gnl|bykdb|A0A0D6DUY5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactococcus piscium MKFS47] (length=230 residues).
MSKKEKKINGNRYLITSLNPKSPISEQYRTIRTTIDFKMLDQGLKSFLVASSEAAAGKSTTIANLAVVFAQQGKKVLLID
ADVRKPSVHLTFKLQNRIGLTNVLTRLISVNDAIQGTRISENLSIISSGPIPPNPSELLSSSAMQNLIDSASKNFDIVLI
DTAPLSAVTDAQILSRYVGGAVIVAHANQTKKESLSKTKKLLEQVNANILGVVLHGIELSDTAYYYYGTE
>gnl|bykdb|A0A0D6J4Y4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=221 residues).
MPTLEIAQKKLEFIKKAEEYYNTLCTNIQLSGDKLKVISVTSVNPGEGKTTTSVNIAMSFARAGYKTLLFDGDIRNSVMS
GFFKSREKITGLTEFLSGTADLSHGLCDTNIENLFVVQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTPPIGIVI
DAAIITQKCDASILITATGEANKRDVQKAKQQLEQTGKLFLGVVLNKLDISVDKYGVYGRK
>gnl|bykdb|A0A0D6Z6K9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus subterraneus] (length=228 residues).
MKKAMASTKRMLVTFLDPKSPISEQYRTIRTNIEFSSIDEDMQAIMVTSSGPSEGKSTTAANLAVVFAQQEKQVLLVDAD
LRKPTVHYTFNLTNTFGLTSVLSKQMQLVEAVDESEIDNLGILTSGPIPPNPAELLGSKAMNQFLLEAREHFDVILFDTP
PVLAVTDAQVLANKCDGSILVVYSGRTEMDGAAKAKELLENAKSKLLGVVLNHKKLQSSDYYYYYGNK
>gnl|bykdb|A0A0D6ZHJ2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus delbrueckii subsp. bulgaricus] (length=257 residues).
MAFGRKKHLDKDTMKNGVKLITLANPQSVISEQFRNIRTNINFMNVDKEVKTIVFTSAMASAGKSTVSANVAITMAQAGK
KTILIDADLRRPTMHATFNVSNSNGLTTLLTSRSMEMDANSVIRESGVENLSILTAGPIPPNPSELLSSKHMLDLIEDLK
QEYDMVVLDLAPILDAGETQQLTSSLDGTILVVRQAYSQKSAVKRAVELLKLTKSPILGYVMNDVDADGDDGYGYGYGYG
YGYGEEEEKKGLFGRKK
>gnl|bykdb|A0A0D7XCU3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus amyloliquefaciens] (length=233 residues).
MSRLAIRKKRSRKYQSALVALHQPNAPIVEQYRTIRTNIEFSSFEKPFKSLLITSGLPGEGKSFSASNLAVVFSQQEKKV
LLIDADLRKPTIHKIFELDNHSGVTNVLMKKTTLENVVQQSPAENLHVLTSGPIPPNPSELLSSQAMEDLLAEAYNQYDL
VILDSPPLLPVADAQILANQVDGSILVILSGKTKLDNAIKSRDALNSSKSELLGAVLNGRKVKKARQYNYATM
>gnl|bykdb|A0A0D7XMP7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus amyloliquefaciens] (length=229 residues).
MLTRKKDKLGKRSVIAMSEPKSINSEQYRTIRTNIEFSSVDTEVKSLLITSAGPEEGKSTTAANLAVVFAQQGKKVLLID
ADLRKPTVHFTFKLDNGTGLTSLLLKQMPFQKAVLPADEANLDILTSGPIPPNPAELLSTGAMKDLLSEAAAVYDKVILD
TPPVLAVADTKILGSYTDGAIMVISSGKTDKEKAAKAKEALDYCPCKLLGAVMNGKKQTKHSDYAYYGQ
>gnl|bykdb|A0A0D7XT59 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus amyloliquefaciens] (length=226 residues).
MGFRKKKSRRGLAQISVLHHKSLVAEQYRTIRTNIEFSSVQTHLRSILVTSSVPGEGKSFSAANLAAVFAQQEKKVLLVD
ADLRKPTIHETYQLENVQGLTNVLVGNASLGETVQKTLIDNLYVLTSGPTPPNPAELLSSKAMGELIQEMYSRYSLVIFD
SPPLLAVADGQILANQTDGSVLVVLSGKTKMDTVQKARDALQQSKAKLLGALLNKKKIKKTEHYSY
>gnl|bykdb|A0A0D8BUQ6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Geobacillus kaustophilus] (length=232 residues).
MAVSNRKKFQKAERSLIAFDDPKSSISEQYRTIRTNIEFSFIDEPLRSLMVTSSAPSEGKSTTAANLAVVFAQQGKKVLL
VDADLRKPTVHYTFRLNNYAGLTSVLTSASSLSSTLQGTAVENLTVLTAGPIPPNPAELLSSRIMDRLLHELQEMYDLVL
FDTPPVLAVTDAQILANKCDGTVLVVASGKTEIAAAAKAKELLEAANAKLVGVVLNQRKQRGGSGYYYYQYK
>gnl|bykdb|A0A0D8J3F4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruthenibacterium lactatiformans] (length=226 residues).
MNKNAPFQYQEAYKSLRTNLNFMAMGKACKKLIFTSAIPGEGKSSVALNLAVSLAETGSRVLVIDCDLRKPVIHRYLKID
NSAYKGIISALADGSLAESIINVKGLGLHVMVADAIPPNPVELLGSPRMKNLIDELDKHYEYIIFDTPPVSVVTDAAVLS
QYADGVILVVRQNYATFDEVGLAKKNLDAVNANILGAVLNGFDTKSTEKKNGYYYSYNYSYENADR
>gnl|bykdb|A0A0E0VM88 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus subsp. aureus 71193] (length=231 residues).
MLLMSKKENTTTTLFVYEKPKSTISEKFRGIRSNIMFSKANGEVKRLLVTSEKPGAGKSTVVSNVAITYAQAGYKTLVID
GDMRKPTQNYIFNEQNNNGLSSLIIGRTTMSEAITSTEIENLDLLTAGPVPPNPSELIGSERFKELVDLFNKRYDIIIVD
TPPVNTVTDAQLYARAIKDSLLVIDSEKNDKNEVKKAKALMEKAGSNILGVILNKAKVDKSSSYYHYYGDE
>gnl|bykdb|A0A0E0VTK5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus subsp. aureus 71193] (length=230 residues).
MTNTRRSTSSLIVHEQPKSPISEKFRGIRSNIMFANPDSAVQSIVITSEAPGAGKSTIAANLAVAYAQAGYKTLIVDGDM
RKPTQHYIFNLPNNEGLSSLLLNWSTYQDSIISTEIEDLDVLTSGPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPP
VNTVTDAQLFSKFTGNVVYVVNSENNNKDEVKKGKELIEATGAKLLGVVLNRMPKDKSASYYAYYGTDES
>gnl|bykdb|A0A0E1AEK6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus subsp. aureus Z172] (length=228 residues).
MSKKENTTTTLFVYEKPKSTISEKFRGIRSNIMFSKANGEVKRLLVTSEKPGAGKSTVVSNVAITYAQAGYKTLIIDGDM
RKPTQNYIFNEQNNNGLSNLIIGRTTMSEAITTTEIDNLDLLTAGPVPPNPTELIGSERFKELVNLFNERYDIIIVDTPP
VNTVTDAQLYARAIKDSLLVIDSEKNDKNEVKKAKTLMEKAGSNILGVILNKAKVDKSSSYYHYYGDE
>gnl|bykdb|A0A0E1AK49 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus subsp. aureus Z172] (length=229 residues).
MTNTRRSTSSLIVHEQPKSPISEKFRGIRSNIMFANPDSAVQSIVITSEAPGAGKSTIAANLAVAYAQAGYKTLIVDGDM
RKPTQHYIFNLPNNEGLSSLLLNWSTYQDSIISTEIEDLDVLTSGPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPP
VNTVTDAQLFSKFTGNVVYVVNSENNKDEVKKGKELIEATGAKLLGVVLNRMPKDKSASYYAYYGTDES
>gnl|bykdb|A0A0E1L3M4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium botulinum CDC_1436] (length=236 residues).
MDRNLNLITIKEPKSPISEAYRTLRTNIQFSSFDEKISVIFVTSSTPGEGKSTTSANLAITMAQNGSETILVDCDLRKPN
VHKLFKLSNTKGLSNLLIEDNGIDKVIQQSGIENLHILTSGIKPPNPSELLSSKKMKKFIDMSKEHYDYIILDTPPVGVV
TDAQLVSQYSDGGILVTASGQVERELAIRAKQLLQKVNAKILGVVLNKVDTDSENGYRYYNYYYEEDEKKKKRSKK
>gnl|bykdb|A0A0E1VNZ1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus subsp. aureus USA300_TCH959] (length=228 residues).
MSKKENTTTTLFVYEKPKSTISEKFRGIRSNIMFSKANGEVKRLLVTSEKPGAGKSTVVSNVAITYAQAGYKTLVIDGDM
RKPTQNYIFNEQNNNGLSSLIIGRTTMSEAITSTEIENLDLLTAGPVPPNPSELIASERFKELVDLFNKRYDIIIVDTPP
VNTVTDAQLYARAIKDSLLVIDSEKNDKNEVKKAKALMEKAGSNILGVILNKTKVDKSSSYYHYYGDE
>gnl|bykdb|A0A0E1VPM9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus subsp. aureus USA300_TCH959] (length=230 residues).
MTNTRRSTSSLIVHEQPKSPISEKFRGIRSNIMFANPDSAVQSIVITSEAPGAGKSTIAANLAVAYAQAGYKTLIVDGDM
RKPTQHYIFNLPNNEGLSSLLLNWSTYQDSIISTEIQDLDVLTSGPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPP
VNTVTDAQLFSKFTGNVVYVVNSENNNRDEVKKGKELIEATGAKLLGVVLNRMPKDKSASYYAYYGTDES
>gnl|bykdb|A0A0E1XAG4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus subsp. aureus MN8] (length=228 residues).
MSKKENTTTTLFVYEKPKSTISEKFRGIRSNIMFSKANGEVKRLLVTSEKPGAGKSTVVSNVAITYAQAGYKSLIIDGDM
RKPTQNYIFNEQNNNGLSNLIIGRTTMSEAITTTEIDNLDLLTAGPVPPNPTELIGSERFKELVNLFNERYDIIIVDTPP
VNTVTDAQLYARAIKDSLLVIDSEKNDKNEVKKAKTLMEKAGSNILGVILNKAKVDKSSSYYHYYGDE
>gnl|bykdb|A0A0E1XD26 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus subsp. aureus MN8] (length=230 residues).
MTNTRRSTSSLIVHEQPKSPISEKFRGIRSNIMFANPDSAVQSIVITSEAPGAGKSTIAANLAVAYAQAGYKTLIVDGDM
RKPTQHYIFNLPNNEGLSSLLLNWSTYQDSIISTEIEDLDVLTSGPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPP
VNTVTDAQLFSKFTGNVVYVVNSENNNKDEVKKGKELIEATGAKLLGVVLNRMHKDKSASYYAYYGTDES
>gnl|bykdb|A0A0E1XI08 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus gallolyticus subsp. gallolyticus TX20005] (length=246 residues).
MPQLELVRAKAQMVKSMEEYYNSIRTNIQFSGRDLKVITLTSAQPGEGKSTTSVNLAISFARAGFRTLLIDADTRNSVMS
GTFKSNERYQGLTSFLSGNAELSDVICDTSIDNLMIIPAGQVPPNPTSLIQNDNFKAMIETVRGLYDYVIIDTPPLGLVI
DAAILAHHSDASLLVTKAGEDRRRTVTKLKEQLEQSGSVFLGVILNKYDIHLDKYGSYGSYGGYGSYGNYGKSEEKTKIG
RGKRKK
>gnl|bykdb|A0A0E2BPF2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus casei A2-362] (length=246 residues).
MAWFKRKNKKALADRSLKQGVALVTNYAPDSRISEEYRTLRTNISFSQADGDIKTLVITSAAAAEGKSTVSSNVAVTFAK
QGLNTILVDLDMRRPMVNATFGQQNIGGLVKLLTTDGEKLEEQLPLYAKPTQIENLTVLVAGPTPPNPSELLGSKSMLAL
LKYLREHYDRVVLDTPPVLSVTDAQIVAAHADATVLVVPYGLAQKKFVLQAKDLLTKVDANIIGVVMNRMPAQGGAGYYY
YGGYYK
>gnl|bykdb|A0A0E2H9X6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Clostridium] clostridioforme 90A8] (length=243 residues).
MSQFVTLNRIMKDDYHYNEAIKTLRTNIQFCGSGIKTIMLTSSLPDEGKSDITFAMASSLAQIGKKVVMIDADIRKSVLV
SRYQLEREVSGLSQYLSGQRSLENVIYDTNIENFSMIFAGPYSPNPAELLEESLFGDMISKLKERYDYIIVDTPPMGNLI
DGAIVARQCDGAVMVIESGSISYRLEQRVKGQLEKSGCRILGVVLNKVNMERNGYYSKYYGKYGKYSKYGHYGKYDRYGK
AEA
>gnl|bykdb|A0A0E2HSZ0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Clostridium] clostridioforme 90A8] (length=235 residues).
MEQILNLQNTGGKDYHFEEAIKTLRTNLQFCGSSLKTIMFTSSLPDEGKSEIAFSVGASFGSIGKKVLLIDADIRKSVFI
KRYEIKGSPSGLSQYLSGQKTMEDICYATDIENFYMILAGPYSPNPAELLEDQLFKELLEKAKEKYDYIIIDTPPMANLI
DGAIIAGQCDGAVIVIESDTISYHLAQKVKVQLEKSGCRILGAVLNRVGEDYENGYYKKYYGKYYGKYVVGGGEK
>gnl|bykdb|A0A0E2HUR2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus hirae] (length=232 residues).
MARTQKQKATQTHAVSLVTLTNPSSLIAEQYRTIRTNIQFASAAGQQIKTIVVTSSGPEEGKSTTAANIAVVFAKSGQRV
LLVDADLRKPVIYKTFKLNNASGLSTVLSSSGSVADEIQRTPVDNLSILPSGPKPPNPSELLSSPRMDQILAEARQLFDV
VIFDIPPVVAVTDAQIMSSKTDGTLLVVRENTSRKESLTKAKELLDMVQARVLGVVYNGAEHSKDAGYYYGN
>gnl|bykdb|A0A0E2I0A8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus hirae] (length=226 residues).
MKNNMKKKGVPLISASKQSSMISEQYRTVRSNIQFSSFDQDIKTIVVTSAGPEEGKSTVSANLAIVFANSGKKTLLIDAD
LRKPSVESTFRSTSNSDGLTNLLKKRNESAFVFIHETNIAHLWTMTSGPKPPNPSELLESSRMNEIIDELSVNFDLIIFD
LPPVVPVTDAQILASKTDGTIIVVRERKTLKQELFKAKELLTIAQANILGIVYNGVKKSKDINYYY
>gnl|bykdb|A0A0E2J4N3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus intermedius SK54 = ATCC 27335] (length=230 residues).
MPSLELVKSKIRELRKSEEYYNALRTNVQLSGDNIKVIAITSVQPGEGKSTTSTNLAIAFARSGYNTLLIDADIRNSTMS
GAFKARNKITGLTDYLAGAADLSNGLCETNIEKLFVIEAGQNSPNPTALLQSKNFEMMIDILRNHYDYIIIDTPPIGLVI
DAAIIAQKCDASLLVVEAGNVKRKALQKAKEQLEQTATPFLGVVLNKYDVQLDKYGSYGNYGDYGNYGKK
>gnl|bykdb|A0A0E2LW59 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus paracasei] (length=248 residues).
MNLSITNLLHRHEEDQETQKNGVMLVTFAEPKHVVSEQFRTVRTNIEFAGAALDNCQVIMFTSSAMSEGKSTVSANVAVT
WAQAGKRVLLIDADLRRPTVHASFRKLNVEGVTTVLTAKRQAEEVVEATFVDNLSVITSGPIPPNPSELLNSKRMVQLLE
WARKNFDIIVLDAPPVLAVSDVQVLVPKTDGVVVVSKMGKTLKSDLKRTVEVLHLAKAKILGSVERIKNPRGDRGYGYGY
GYGYGNEK
>gnl|bykdb|A0A0E2Q2B9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus thermophilus M17PTZA496] (length=246 residues).
MPLLKLVKSKVNFNKQTEEYYNAIRTNIQFSGAQMKVIAISSVEAGEGKSTTSVNLAISFASVGLRTLLIDADTRNSVLS
GTFKSNEPYKGLSNFLSGNADLNETICQTNISGLDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPIGLVI
DAVIIAHQADASLLVTAAGKIKRRFVTKAVEQLEQSGSQFLGVVLNKVDMTVDKYGSYGSYGSYGEYGKKSDQKEGHSRA
HRRRKG
>gnl|bykdb|A0A0E2RH33 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus thermophilus TH1477] (length=246 residues).
MPLLKLVKSKVDFNKQTEEYYNAIRTNIQFSGAQMKVIAISSVEAGEGKSTTSVNLAISFASVGLRTLLIDADTRNSVLS
GTFKSNEPYKGLSNFLSGNADLNETICQTDISGLDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPVGLVI
DAVIIAHQADASLLVTAAGKIKRRFVTKAVEQLEQSGSQFLGVVLNKVDMTVDKYGSYGSYGSYGEYGKKYDQKEGHSRA
HRRRKG
>gnl|bykdb|A0A0E2URZ9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus parauberis] (length=239 residues).
MARLELVKSKKELYDIAEEYYNSIRTNIQFSGRDLKVITLTSVQPGEGKSTTSANIAISFAKAGLKTLLIDADIRNSVMS
GTFKADEKYEGLSSYLSGNAELSAVISHTNIENLMLIPAGHVPPNPTTLLQNSNFNFMIDTVKELFDYVIIDTPPIGLVI
DSAIISQKADANILVTEAGAIKRRFIQKAKEQMEQSGALFLGVILNKVEETLDSYGGYGSYGANGNYGKPAKKKSRKRR
>gnl|bykdb|A0A0E3STS0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDRERENGLYYYYGAN
>gnl|bykdb|A0A0E4CSD9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus varani] (length=238 residues).
MSQFILGRAKAQMVKAMEEYYNAIQVNIQFSGSNIKVIAVTSVQPGEGKSTTSTSLAISFATSGYKTLLIDADIRNSVMS
GTFKAESAYHGLTSYLSGHVDLSQVVHDTSIDNLSIIPAGQVPPNPTTFLQNARFDNMIERVRNGFDYIIIDTPPIGLVV
DAAIVAQKADGSLLVTESGAVSRRFVKKAVEQMEQSGAQFLGVILNKVDTTKDRYGSYGSYGAYGNYGNYGKKTDKDL
>gnl|bykdb|A0A0E4CYT6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus riograndensis SBR5] (length=228 residues).
MSQQPSKQRHLITVTNPRSPVSEAFRALRTNIDFSSVDEQIQIIMVTSSGPEEGKSTVTANLAAAYAQADKKVLLIDGDL
RKPTAHKTFSLSNRAGLSSLLSQQADLEDVVQDSGVANLSIMTSGPIPPNPAEMMASNRMSAVLQELRQRYDMILFDTPP
LLAVTDAQIIASKSDGVIMVVSYGKVKRDIAAKAKANLDRVGAKMLGVVLNNVKRKASEGYYYYYYGN
>gnl|bykdb|A0A0E8T7I3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASVLVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDRERENGLYYYYGAN
>gnl|bykdb|A0A0E9GXU7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MPTLEIAQKKLEFIKKAEEYYNALCTNIQLSGDKLKVISVTSVNPGEGKTTTSVNIARSFARAGYKTLLIDGDTRNSVIS
GVFKSREKITGLTEFLSGTADLSYGLCDTNIENLFVVQSGSVSPNPIALLQSKNFNDMIETLRKYFDYIIVDTPPVGIVI
DAVIITQKCDASILVTATGEANKRDVQKAKQQLEQTGKLFLGVVLNKLDISVDKYGVYASYGNYGKK
>gnl|bykdb|A0A0F0CCY4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. FS41] (length=247 residues).
MGQTLSLKNTGRKDYHYEEAVKTLRTNIQFCGNNLKTIMFTSSLPSEGKSDTTFAVAASFGSIGKKVLLIDGDIRKSVIV
KRHEIQGNPCGLSQYLSGQKTAEEICYGTDVENLDIILAGPYSPNPSELLEDPLFKELLDRARLKYDYIIIDTPPMANLI
DGAIIASLCDGAVIVINSGTISYHLVQKVKSQLEKSGCRILGAVLNRVGTDYDNGYYKKYYGKYYGRYYGKTYGGGGEKY
QILDEAR
>gnl|bykdb|A0A0F0CD69 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. FS41] (length=239 residues).
MDQILNLKNTGEKNYHFEESIKTLRTNMQFCGSSLKTIMFTSSLPNEGKSEITFSVAASLGSIGKKVLMIDADIRKSVLI
KRYEIKGNPNGLSQYLSGQKSLDEICYATDVENLDIILAGPYSPNPAELLEDSLFRELLEKAKERYDYIIIDTPPMANLI
DGAIIANQCDGAVIVIESGTISYHLVQKVKGQLEKSGCRILGAVLNRVDKEYENGYYKKYYGKYYGKYYRNTGGGGIEA
>gnl|bykdb|A0A0F0CFD2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. FS41] (length=249 residues).
MKQIITLNRDMKDDYHYNEAIKTLRTNIQFCGNGIRTIMLTSSLPDEGKSDITFAMAASLAQIGKKVVMIDADIRKSVLV
SRYQLETEVYGLSQYLSGQKTLADVLYDTNVENLSMVFAGPYSPNPAELLEEDLFEQMVQELKKTYDYVIIDTPPMANLI
DGAIVARQCDGAVMVVESGCISYRLEQRVKGQLEKSGCRILGVVLNKVSMERNGYYSKYYSRYGKYGKYSKYGKYGKYGK
YEKYEKAEA
>gnl|bykdb|A0A0F2CIN0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus cristatus] (length=232 residues).
MPILELAKKKKLSISRVEEYYNALRTNIQLSGEDIKVIAVSSTFPGEGKTTTSTNLALTFAKAGHKTLLIDADIRNSKML
GGVFKSGEKVSGLTEYLARNTDLSQGLCETDEENLFVITSGQASPNPTALLQSERFTTMMSVLRRHYDYIIVDTPPIGMV
VDATLIAKVCDASLLVVSTNEVKRKMVQKSKMQLEQSSTPFLGVVLNKYNVQADKYGFYGSYGHYGDNLSKE
>gnl|bykdb|A0A0F2CWA3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis subsp. oralis] (length=230 residues).
MPTLEIAHKKLDQARKAEEYYNALRTNIQLSGNNLKVIAITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEYLSGTTDLSQGLCETNVENLFVIQAGSVSPNPTALIQSENFANMIDTLRKYFDYIVVDTAPIGVVI
DAAIITQQCDASVLVTAAGETNRRDVQKAKEQLEQTSKPFLGIVLNKLNTSVEKYGSYGAYGNYGNYGKK
>gnl|bykdb|A0A0F2DFW5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus mitis] (length=217 residues).
MHIEVIHNSKSIVAESFRTLRSNLQFSEFGKNIKIIVVTSANPNEGKSEVSINLAASLAQQGKRVIIIDADMRKPTQHKL
TELNNTEGLSTFLLKKSGVDSINHLTINDVNLDVLTSGPVPPNPSEMLASSSMDETLKAFEDFYDYVIIDTPPLLAATDA
QVLASISDATLLVVDIKKSKRRQIIEAKRRLDHVGARLLGVIMNKIDSHKDTYYYYY
>gnl|bykdb|A0A0F2DRS0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus mitis] (length=217 residues).
MHIEVIHNSKSIVAESFRTLRSNLQFSEFGKNIKLIVITSANPNEGKSEVSINLAASLAQQGKKVIIIDADMRKPTQHKL
TELNNTEGLSTFLLKRSGVDSINHLTINDVNLDVLTSGPVPPNPSEMLASSSMEETLRAFEDFYDYVIIDTPPLLAATDA
QVLASISDATLLVVDIKKSKRRQVTEAKRRLDHVGARLLGVIMNKIDSHKDTYYYYY
>gnl|bykdb|A0A0F2DXP0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus mitis] (length=237 residues).
MPILEIGQKRLDFAKKAEEHYNALRTNIQLSGDNLKVLAISSVKPGEGKSTTSTNIAWAFARAGYKTLLVDADIRNSVMS
GVFKSREKITGLTDFLAGTTDLSHGLCDTNVENLFVIQAGPVSPNPTALLQSENFHTMIDTLRKYFDYVIVDTAPIGMVI
DAAIITQKCDASILVTAAGETKRRDVIKAKEQLEQTGVPFLGVVLNKFNTEVEKYGAYGGYGAYGAYGSYGNYGKKK
>gnl|bykdb|A0A0F2E2R2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis subsp. tigurinus] (length=227 residues).
MPTLEIAQKKLDLARKAEEYYNALRTNIQLSGNNLKVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSQGLCDTNVENLFVIQAGSVSPNPTALLQSENFKTMLDTLRKYFDYIIVDTAPIGVVI
DAAIITQKCDASILVTAAGETNRRDIQKAKEQLEQTSKPFLGIVLNKLNTSVEKYGSYGAYGSYGKK
>gnl|bykdb|A0A0F2E7J6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus infantis] (length=233 residues).
MAKLELSEKRQAFVKKAEEYYNALRTNIQLSGDKLKVIAISSVRPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFISREKITGLTDYLSGTKDLSQGLCETNVENLFVVQSGAISPNPTALLQSEKFEVMIETLRKYFDYIIVDTAPIGVVI
DAAIIAQKCDASILVTEASATKRREVQKAKTQLEQTGTPFLGVILNKFNIHLEKYGTYGTYGGYGNYGSYGKK
>gnl|bykdb|A0A0F2JBL3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Desulfosporosinus sp. I2] (length=199 residues).
MITSAGPREGKSTTVANLAVSMAQSGKSVLVLDADLRNPTQHKLFGLDNREGLSVALVQEQDYRSYIRETAVSGVMVLTG
GPIPPNPAELVGSKRMKRLLEEVSEQFDIILIDTPPIVAVTDPAILAQDVDGVILVMASGEVHKDYAQSAKELLDKVGAK
ILGVVLNKADMKTSDYYYYYYYYHGSDNPKKKPKRHKNR
>gnl|bykdb|A0A0F2N5U0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Peptococcaceae bacterium BRH_c4a] (length=248 residues).
MLKKNGGIKFFDTDQKNELRELYALDNPKAPVVEAFRTLRTNVSFASVDKTFKTLLITSPTLGDGKSTITANLGMVMAQA
GKKVLVMDADLRKPMQHHIFSVSNLRGLTNILVQGEPLAEVAHEVSANGLFFVPSGPIPPNPSELLASNRMLKLLEEAQK
DYDIVLIDSPPMIAVTDSSILSTRMDGVMLVVRAGVTRVDLINDAIGQLKKASANFIGLVLNQVRVPSHDYQYYYYYGHK
NKEAEMRF
>gnl|bykdb|A0A0F2PBH4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Peptococcaceae bacterium BRH_c8a] (length=251 residues).
MRNSKNLSKMLFAQNNPMAPVSETFRTLRTNIYFSIEARSKGTILITSALSGEGKSTVAANLGVVMAQAGKRVVIIDCDL
RNPVMHKYFNIINNQGLSNLLSHDLVLGDTIHTTGTEGPSLITSGPIPPNPSELLASQKMMDLLQHLSAHFDTVLIDTPP
VIAVTDAVVLATRVDGVLLVLKSESTALDKAKRAKQQLEMANAKIIGVVLNDVKIKRSDCNYYYYNRDYKQAQREADVLL
KQAAATKDDNS
>gnl|bykdb|A0A0F2QB88 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridiaceae bacterium BRH_c20a] (length=218 residues).
MITYSDPKSPEAEAFRTIRTNLYYYNLDHRFKKVMLTSTGPAEGKSTIIANLAIVLAQTGKKVLLVDADLRRPTLHSIFD
AGNLVGLSSCLEKKLSLMEVVQKTKIENLYIITSGFFPLKPSELNSSKIDELFEDVEAYDYILFDTPPAGTFTDALVLSE
KVDAVLVVINSKKVPIDLAQQTIEKLRNAKTEIIGVIFNNVQYEKDFYKNYYYYGDKK
>gnl|bykdb|A0A0F2S779 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Peptococcaceae bacterium BRH_c23] (length=236 residues).
MAYSLITLEQTKSPISEAYRALRTNVQFTRVDSESQKIMVTSSGPREGKSHTVANLGVSMAQSGKSVLIIDADLRNPTQH
KLFGLDNGEGLSVSLVQDQDYHKYIRETTVPGVMVLPAGPVPPNPAELVGSKRMKRLIEEVSEQFDMVLIDTPPIIAVTD
AAILAQEVDGVILVLASGEVNKGYAQKAKEQLDKLGVKILGAVLNKVDLNTNEYYHYYYYNASDDTEKKHNRHKAR
>gnl|bykdb|A0A0F2SLH4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Peptococcaceae bacterium BRH_c23] (length=236 residues).
MTFSLITLEQSKSPISEAYRTLRTNVQFTSVDSKTKKIMITSSGPREGKSTTVANLAVSIAQTGKSVLVIDADLRNPTQH
KLFGLDNGQGLSISLVQDQDGHTNIRETAVPGLMLLTGGPIPPNPAELVGSKRMKRLIKEVSEQFDVVLIDTPPIIAVTD
AAIIAQEVDGVILVLASGEVNKEYAQRAKDQLDKVGAKILGAVLNKADMKTSEYYYYYYYHGSEDSKKKHKGHKKR
>gnl|bykdb|A0A0F3FR10 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium baratii] (length=217 residues).
MFIVSKDPKSIAAENYRILRTNIQYSSFDKEIRRVLITSSEPGEGKSTTAGNLALTFAQDDKKTIIIDCDLRKPSLHKKF
NVSNSIGLSDVIIDKKNIEKSVKKIDENLDILTAGKIPPNPSELLGSKALNTLLEALEEVYDVIVIDSPPVLAVTDAQIL
SKKVDGTVLVVRSNFTKKDTVMAAKDVLIKVKANILGTVLTRTDSNKHGYYYYYGKE
>gnl|bykdb|A0A0F3HAI0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus parasanguinis] (length=230 residues).
MNTLEISKNKLQEVRKAEEYFNALATNIQLSGVDLKVIAISSVQENEGKSTTSTNLAVAFARAGYKTLLVDCDIRNSVMT
GIFRSRTKIQGLTDFLSGRSQLDHILYATDFPNLDIIESGQVAPNPTGLLQSKNFTVMMDALREHFDYIIVDTPPIGVVI
DAAIIAQRCDGTVLITESGANGRKAVQKAKDQLEQTGTPFLGVVLNKFNIKAAEYGSYGGYGSYGEYGKK
>gnl|bykdb|A0A0F3HHE8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus salivarius] (length=248 residues).
MPLLKLVKSKADFAKKTEEYYNAIRTNIQFSGANFKVIAVSSVQPGEGKSTTSVNLAISFASVGLRTLLIDADTRNSVLS
GTFKSNEPYKGLSNFLSGNASLGEVICETDVPGLHVLSSGPVPPNPTSLLQNDNFVQLLEIVRAQYDYVIIDTPPIGLVI
DAVIIAHQADASLLVTAAGRIKRRFVTKAVEQLQQSGSEFLGVVLNKVDLAIDKYGSYGSYGSYGSYGEYGGDKHTENKS
RKHRRKRG
>gnl|bykdb|A0A0F3HK81 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus infantis] (length=227 residues).
MVKLELAQQKLNSLKKAEEYYNALRTNIQLSGNNLKVIAVTSVDPSEGKSTTSTNIAWAFAHAGYKTLLIDADIRNSVMS
GVFKSREKITGLTDYLAGTQDLSHGLCETDVENLFVVQSGAVSPNPTALLQSANFERMIETLRKYFDYIIVDTAPIGVVI
DAAIIVQKCDASVLVAEAGVAKRREVQKAKSQLEHTGKPFLGVVLNKFDVQREKYGSYGGYGNYEKR
>gnl|bykdb|A0A0F3RS81 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus spicheri] (length=251 residues).
MAWFKRKSKKLDNNSLKYGVGLVTYNDPTGMVSEQFKTVRTNIQFSSIDNKLHSIMFTSSEPSEGKSTVSNNVAVTYADQ
GTQVILMDADFRRPTVHKTFNVSNQKGLSNYLSGNATLEEIVQPTMLEGLSVITSGPVPPNPSELLTSQKMAQLLDKLAE
QSDLLIVDAPPVNTVTDAQLLGARVDGVILVVPQGIALKAGVRHAKQALETVHANILGAVMNRVTAQKSGGYYGGYYGGS
YEGYYGTDDKK
>gnl|bykdb|A0A0F4LRK2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus mellifer] (length=237 residues).
MFKKKSKTQLASQKTAAVSLISLLNSRSTIAEQYRTIRTNIQFAASSDHPVKSIVITSSGPSEGKSLTAANLAIVFAKSG
KKTLLLDGDMRKPTVWKTFRLSNQKGLSTLLVSPDDIADSIQKTTIDNLSVLTSGPQPPNPSELLGSTREEVIMDQLTRL
FDVIIVDMPPVVTVTDAQIVASKADGTILVAREGVSEKAALLKAKQLLEIAHARILGVVYNGVDSANDAGYYYYSDK
>gnl|bykdb|A0A0F4VQE0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. IBUN125C] (length=215 residues).
MLIVESRPKSAEAEAYKTLRTNVQYSSISKKIKTLLVTSADSKDGKSTVCSNLGVTFSQNGQSVIILDCDFRKPSIHKFF
NISNSAGITDILLGEEKLEETIQHYNSNTDILTAGNIPPNPSEILGSQSMINLLSFLSERYDIVIIDSPPVGVVTDAQII
SASVDGTLVVIRAEETKAKRVTEAVNLLKKVDANIIGMVLNEAQTINKSYSDYYA
>gnl|bykdb|A0A0F4WIN2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. IBUN22A] (length=215 residues).
MLIVESRPKSAEAEAYKTLRTNVQYSSISKKIKTLLVTSADSKDGKSTVCSNLGVTFSQNGQSVIILDCDFRKPSIHKFF
NISNSAGITDILLGEEKLEETIQHYNSNTDILTAGNIPPNPSEILGSQSMINLLSFLSERYDIVIIDSPPVGVVTDAQII
SASVDGTLVVIRAEETKAKRVTEAVNLLKKVDANIIGMVLNEAQTINKSYSDYYA
>gnl|bykdb|A0A0F4WPP9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. IBUN13A] (length=215 residues).
MLIVESRPKSAEAEAYKTLRTNVQYSSISKKIKTLLVTSADSKDGKSTVCSNLGVTFSQNGQSVIILDCDFRKPSIHKFF
NISNSAGITDILLGEEKLEETIQHYNSNTDILTAGNIPPNPSEILGSQSMINLLSFLSERYDIVIIDSPPVGVVTDAQII
SASVDGTLVVIRAEETKAKRVTEAVNLLKKVDANIIGMVLNEAQTINKSYSDYYA
>gnl|bykdb|A0A0F5I5I3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Quasibacillus thermotolerans] (length=235 residues).
MALRRGKKKQAPGQAQRKLVTKTNPKSPISEQYRTIRTNITFSTVDETIRSLMITSASPAEGKSTTTANLAITFAQQGMR
VLLVDSDMRKPTMQYTFNVPNNIGLTNVLAKQKTIKEAVSRTDVSGLEMLSSGPIPPNPAELLGSRAMKEFFKEAYMLYD
MVIFDTPPVLAVTDAQVLANQCDGAVLVVNSGKTEVDAAAKAKELLEAANARLLGVVLNNRSLKESNYYYYYGNK
>gnl|bykdb|A0A0F5R3J7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. D9] (length=231 residues).
MSRLTRNWTLITASNPKSPISESYRMLRTGVDYAGVDDPVDLLMVTSCRAGEGKSTTSANMAVTFAQAGQKVLLIDADMR
KPSQHHIFSLSNRGGLTGVLQGRSTLEQGVQAAEVDNLDILTAGPTPPNPSEMLGSRAMAALLELAKEQYDQVIVDTPPI
LAVTDAHIVAGKCDGVVLVIDSGKVKSDTARKAKETLENAGSRMLGVVLNNVDRDGNSGYYYYYYGGEEQA
>gnl|bykdb|A0A0F5R7R3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. D9] (length=231 residues).
MPRSTSESSLITYYEPKSPISEAYRTLRTNIQFSSFDEPIQVIMVASANPGEGKSTTASNLAVTYAQEGKKTLLIDADLR
KPSVFQVFSVSNRVGLSTVVSGQCRWADAIQDTHVEQLDVLPSGPIPPNPSELLASHSMKSLLQELQAQYDIIIFDTPPV
LAVTDSLIISSLCQGVILVVQAGKVKSELVRKAKSNLEHVQARILGVVLNNMKSRKGDKYTYYYYGTKEAK
>gnl|bykdb|A0A0F5RRC7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. UMTAT18] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDKSIHSLMITSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVENLHFLACGPIPPNPAELLGSKSMQELLAQAYSMYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSEATEKETALKAKGLLESAKGKLLGVVLNDREREHGLYYYYGAK
>gnl|bykdb|A0A0F6FSG1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis subsp. kurstaki] (length=233 residues).
MALKLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A0F6J796 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis T01-328] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTNSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A0F6S2G1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKKELVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTSDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGHVKRSSLKKVKEQLDQTGTPFLGVILNKYDIVAEKYSEYGNYGNYGQKA
>gnl|bykdb|A0A0F6S2G4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGSVKRSSLKKVKEQLDQTGTPFLGVILNKYDIATERYSEYGNYGNYGQKA
>gnl|bykdb|A0A0F6S2U6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIALTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTSDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLIATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGSVKRSSLKKVKEQLDQTGTPFLGVILNKYDIVAEKYSEYGNYGNYGQKA
>gnl|bykdb|A0A0F6S316 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGHVKRSSLKKVKEQLDQTGTPFLGVILNKYDIVAEKYSEYGNYGNYGQKA
>gnl|bykdb|A0A0F6UW27 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTSDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGHVKRSSLKKVKEQLDQTGTPFSGVILNKYDIANEKYSEYGNYGHYGKKA
>gnl|bykdb|A0A0F6UW46 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIALTKRERVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTSDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLIATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGSVKRSSLKKVKEQLDQTGTPFLGVILNKYDIVAEKYSEYGNYGNYGQKA
>gnl|bykdb|A0A0F6UW57 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGSVKRSSLKKVKEQLDQTGTPFSGVILNKYDIANEKYSEYGNYGHYGKKA
>gnl|bykdb|A0A0F6UW75 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSIMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGSVKRSSLKKVKEQLDQTGTPFSGVILNKYDIANEKYSEYGNYGHYGKKA
>gnl|bykdb|A0A0F6UWI3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKKELVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFRPITKITGLTDYLAGTSDLSQGLCDTDIPNLTVIESGKISPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGHVKRSSLKKVKEQLDQTGTPFLGVILNKYDIVAEKYSEYGNYGNYGQKA
>gnl|bykdb|A0A0F6UWJ2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=225 residues).
MATLEIARTKKELVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVLVAEAGNVKRSSLKKVKEQLDQTGTPFLGVILNKYDIATERYSEYGNYGKKA
>gnl|bykdb|A0A0F6UWT8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKKELVNKTEEYFNAIRTNIQLSGEDIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMS
GFFKPITKITGLTDYLAGTTDLSRGLCETNIPNLTVIESGKISPNPTALLQSKNFENLLATLRRYFDYVVVDCPPLGMVI
DAAIIAQKCDAMVLVAEAGHVKRSAVKKVKGQLEQTGTPFLGVILNKYDIANEKYSEYGNYGHYGKKA
>gnl|bykdb|A0A0F6UWV9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=234 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGHVKRSSLKKVKEQLDQTGTPFLGVILNKYDIANEKYSEYGKLRTLRQKSLISQII
>gnl|bykdb|A0A0F6UX04 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIALTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTSDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLIATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGSVKRPSLKKVKEQLDQTGTPFLGVILNKYDIVAEKYSEYGNYGNYGQKA
>gnl|bykdb|A0A0F6UXU3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGHVKRSSLKKVKEQLDQTGTPFSGVILNKYDIANEKYSEYGNYGHYGKKA
>gnl|bykdb|A0A0F6UXZ0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKKELVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLALAYARSGYKTVLVDADIRNSVMS
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVLVAEAGNVKRSSLKKIKEQLDQTGTPFLGVILNKYDIATEKYGEYGNYGNYGKKA
>gnl|bykdb|A0A0F6UXZ7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKREIVNKTEEYFNAIHTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGSVKRSSLKKVKEQLDQTGTPFLGVILNKYDIANEKYSEYGNYGHYGKKA
>gnl|bykdb|A0A0F6UY94 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKKELVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGSVKRSSLKKVKEQLDQTGTPFLGVILNKYDIANEKYSEYGNYGHYGKKA
>gnl|bykdb|A0A0F6UYB7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGSVKCSSLKKVKEQLDQTGTPFLGVILNKYDIANEKYSEYGNYGHYGKKA
>gnl|bykdb|A0A0F6UYB8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=225 residues).
MATLEIARTKKELVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVLVAEAGSVKRSSLKKVKEQLDQTGTPFLGVILNKYDIATERYSEYGNYGKKA
>gnl|bykdb|A0A0F6UYI3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGSVKCSSLKKVKEQLDQTGTPFSGVILNKYDIANEKYSEYGNYGHYGKKA
>gnl|bykdb|A0A0F6UYK3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKKELVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTSDLSQGLCDTDIPNLTVIESGKISPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGHVKRSSLKKVKEQLDQTGTPFLGVILNKYDIVAEKYSEYGNYGNYGQKA
>gnl|bykdb|A0A0F6UYK6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIGYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGHVKRSSLKKVKEQLDQTGTPFLGVILNKYDIANEKYSEYGNYGHYGKKA
>gnl|bykdb|A0A0F6UZ84 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=230 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMS
GFFKPVTKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLIATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGNVRRSAVKKVKEQLEQTGTPFLGVILNKYDVVTEKYGEYGNYGNYGNYGRK
>gnl|bykdb|A0A0F7HJC4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Salinicoccus halodurans] (length=237 residues).
MFGKKNKHLDYTSGPRDLIVAKEPKSPISEQYRTIRTNITYSSVDTPIKSVLFTSSLPSAGKSTTAANVAIAYAQAGKKT
LLLDADLRRPTTHYTFEMNNQKGLSTAIVNEMPLENVIKETEIENLDIVTSGPVPPNPSELIASNKMEHFFKTVTMQYDM
VIVDSPPILAVTDGQLLSKLVDGTILVTNVESNNKDSLTHAKDLLHKADSNLIGVVLNNKKQKSSKDSYYYYYGNEK
>gnl|bykdb|A0A0F7HK70 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Salinicoccus halodurans] (length=237 residues).
MRDRKMNNEVASAKKIIVATKPHSPVSEQFRTIRTNIMYSSIDRPIRSVLFTSAVAGAGKSTIAANVAIAYAQAGKKTLL
LDGDLRRPTCHYTFKVSNQKGLSTAIVNDIALEDLVNQTEFDDLDLITSGPIPPNPSELLSSKKLTQFIDHLKFQYEMII
VDSPPLLSVTDAQLLSKSADGVILITDVENNNRNHLLEAKDLLNKADANIIGLVLNNRTIKDKSKDDYYYYQASHDV
>gnl|bykdb|A0A0F7PWI3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus salivarius str. Ren] (length=220 residues).
MQKFELRLDDIDFQSQESFKTLRFNVEFSGEKNQVFYITSTYPNEGKSTVSLELALAFSDNGKKALLIDADLRKSVSRQL
IRTGSIEMGLSDYLVGRAQFDDVIAQSNIENFSMIFSGPVPPNPSEILDGERFKHLIETVKEKFDIVIIDTPPMGSVIDA
AVIAKNCDGGIIVINSGQASYRQIRKTKEQLERADSKIIGCVLNKVDASNNDYYYGYYHK
>gnl|bykdb|A0A0G3Y412 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Geobacillus sp. 12AMOR1] (length=232 residues).
MARSNRQQFKRLERSLITAEDPKSPIAEQYRTIRTNIQFSFIDRPLRSLIVTSTGPGEGKSTTVANLAVAFAQQGKKTLL
IDADLRKPTVHYTFRLNNYMGLTNVLTGSAPLLPTCQATEIDHLSVLTSGPIPPNPAELLSSKAMAQCLEQLYETFDLVV
FDTPPVLAVTDAQILANQCDGTVLVIESGGTEIEAAVKAKELLEAANAKLLGVVLNKRKHRDGGHYYYYQYK
>gnl|bykdb|A0A0G4CTU8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis subsp. tolworthi] (length=233 residues).
MALNLFKKKQNYRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSIDNLSFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANICDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A0G8EEC6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNILGLTNVLTNSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A0G8EWK2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTAVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSLYDL
VVFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQSLYYYYGAN
>gnl|bykdb|A0A0G9F8V6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus plantarum] (length=235 residues).
MKLRRRVANMHTGIQLTTLTAPMSVVTEQVKTIRTNLNYAMVGKPLKTLMITSAIQGEGKSTVGSNLAVEYAKKGLQVLL
VDADLRRPTIHQTFAISNQRGVSSWLSGQLTDVNEAIYPVLDHLFVMPSGPKPPNPAELLASDRMTEFLTVATRKLDLVI
VDAPPILPVTDARILAGQVDGTVLVVRQNFVEKVAVRQAVSALKNARAQLLGTILNDVDIKTHGYGYGYYGTETN
>gnl|bykdb|A0A0G9GUB6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus plantarum] (length=219 residues).
MSVITEQIKTIRTNINFAATDHKLRTLMVTSAMLGEGKSTVSGNLAVEYAKEGMQVLLVDADLRRPTIHKTFGLKNHKGL
SSWLANQMDDVNDAIHPVIGNLFVMTSGPKPPNPAELLGSNKMTEFLTSATRKLDLVIVDAPPILPVTDSQLLANKVDGT
VLVVRQGVAQKAAVRDAVNSLKKSQANILGTVLNDVRDSSHHGYYGYNSGYGYYSDEDK
>gnl|bykdb|A0A0G9L7G5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. C8] (length=217 residues).
MFIVEKEPKSIAAESYRTLRTNIQYSSFDKEYKVIMVTSSEPGEGKSTTAGNLALCLAQGEKKVILVDCDLRKPSLHKKF
KISNIVGLSDVMIGKEELVTAMHRYNNNLVILTSGKIPPNPSEMLSSKAMTTLLDALKKNFDYIILDTPPVQAVTDSQIL
ATKADGAILVVRAERTKKDSVQNAISLLKKVNANIIGTVLNGLDNSRNKYYYYYGEK
>gnl|bykdb|A0A0H0YRN1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus casei] (length=252 residues).
MKLTKVFNKFTRHNQEDQETQKNGVMLVTFAEPKHVVAEQFRTVRTNIEFAAAALDRCQIVMFTSSTMSEGKSTVSANVA
VTWAQAGKKVLLIDADLRRPTVHATFRTLNLDGVTTVLTGKTKPSDVVEQTFVDNLDIITSGPVPPNPSELLNSKRMTSL
LEWSRDKYDIIVLDAPPVLGVSDVQVLVPKTDGVVVVANMGKTLKGDLKRTVEVLKLAKAKILGSVERVRAKNGDRGYGY
GYGYGYQESDGR
>gnl|bykdb|A0A0H1RIT2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactococcus lactis subsp. lactis] (length=231 residues).
MAKNKRSIDNNRYIITSVNPQSPISEQYRTIRTTIDFKMADQGIKSFLVTSSEAAAGKSTASANLAVAFAQQGKKVLLID
GDLRKPTVNITFKVQNRVGLTNILMHQSSIEDAIQGTRISENLTIITSGPIPPNPSELLASSAMKDLIDSVSDFFDVVLI
DTPPLSAVTDAQILSSYVGGVVLVVRAYETKKESLAKTKKILEQVNANILGVVLHGVDSSDSPSYYYYGVE
>gnl|bykdb|A0A0H1ZAC3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus agalactiae] (length=232 residues).
MTRLEIVDSKLRQAKKTEEYFNAIRTNIQFSGKENKILAITSVREGEGKSTTSTSLALSLAQAGFKTLLIDADTRNSVMS
GTFKATGTIKGLTNYLSGNADLGDIICETNVPRLMVVPSGKVPPNPTALLQNAYFNKMIEAIKNIFDYIIIDTPPIGLVV
DAAIIANACDGFILVTQAGRIKRNYVEKAKEQMEQSGSKFLGIILNKVNESVATYGDYGDYGNYGKRDRKRK
>gnl|bykdb|A0A0H2WXD9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=228 residues).
MSKKENTTTTLFVYEKPKSTISEKFRGIRSNIMFSKANGEVKRLLVTSEKPGAGKSTVVSNVAITYAQAGYKTLVIDGDM
RKPTQNYIFNEQNNNGLSSLIIGRTTMSEAITSTEIENLDLLTAGPVPPNPSELIGSERFKELVDLFNKRYDIIIVDTPP
VNTVTDAQLYARAIKDSLLVIDSEKNDKNEVKKAKALMEKAGSNILGVILNKTKVDKSSSYYHYYGDE
>gnl|bykdb|A0A0H2WZS1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=230 residues).
MTNTRRSTSSLIVHEQPKSPISEKFRGIRSNIMFANPDSAVQSIVITSEAPGAGKSTIAANLAVAYAQAGYKTLIVDGDM
RKPTQHYIFNLPNNEGLSSLLLNWSTYQDSIISTEIQDLDVLTSGPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPP
VNTVTDAQLFSKFTGNVVYVVNSENNNRDEVKKGKELIEATGAKLLGVVLNRMPKDKSASYYAYYGTDES
>gnl|bykdb|A0A0H2XG22 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=230 residues).
MTNTRRSTSSLIVHEQPKSPISEKFRGIRSNIMFANPDSAVQSIVITSEAPGAGKSTIAANLAVAYAQAGYKTLIVDGDM
RKPTQHYIFNLPNNEGLSSLLLNWSTYQDSIISTEIQDLDVLTSGPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPP
VNTVTDAQLFSKFTGNVVYVVNSENNNRDEVKKGKELIEATGAKLLGVVLNRMPKDKSASYYAYYGTDES
>gnl|bykdb|A0A0H2XGL0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=228 residues).
MSKKENTTTTLFVYEKPKSTISEKFRGIRSNIMFSKANGEVKRLLVTSEKPGAGKSTVVSNVAITYAQAGYKTLVIDGDM
RKPTQNYIFNEQNNNGLSSLIIGRTTMSEAITSTEIENLDLLTAGPVPPNPSELIGSERFKELVDLFNKRYDIIIVDTPP
VNTVTDAQLYARAIKDSLLVIDSEKNDKNEVKKAKALMEKAGSNILGVILNKTKVDKSSSYYHYYGDE
>gnl|bykdb|A0A0H2YPY2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium perfringens] (length=217 residues).
MLILENNPKSVAAESYRTLRTNIQYSSFDNPVKSIVITSSEPGEGKSTTSANLALSFAQDGKKVILIDCDLRKPVVHKEF
QISNSRGLSEFLIGNVEFSKVVYKHESGLHVLPSGLVPPNPAEMLASRAMEHLLTQLEEKYDYIILDTPPVNAVTDSKIL
STKVDGTILVVKYGYTKKDAVIEAVKGLRAVNANIIGTVFNGEENQRGKYYHYYKKD
>gnl|bykdb|A0A0H3E402 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus atrophaeus] (length=226 residues).
MGFRKKKAKRGLAQISVLQNKSLVAEQYRTIRTNIAFSSVQTNLRSILVTSSVPGEGKSFSAANLAAVFAQQEKKVLLVD
ADLRKPTIHETFQLENVTGLTNVLVGTCSLSETVQQTPIDNLYILTSGPTPPNPAELLSSKAMGDLILDIYDQYSLVIFD
SPPLLAVADGQILANQTDGSVLVVLSGKTKIDTVQKAKDALEQSKAKLLGALLNKKKLKKPDLYSY
>gnl|bykdb|A0A0H3E6Z7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus atrophaeus] (length=231 residues).
MARKKTLRSLMSIRNIITMTEPKSLNSEQYRTIRTNIEYSSIDSQVKSLIITSAGPGEGKSTTAANLAVVFAQQGKKVLL
VDADLRKPTVHFTFRLDNADGLTSILLKQISFEQAVHPSEENNLDILTSGPIPPNPAELLSSKGMEDLLENIYECYDMVI
FDTPPLLAVADPQILGNYVDGSIMVVSSGKTDKEKAAKAKEVLATCKSKLLGAVMNGKKITKNSYYAYYGN
>gnl|bykdb|A0A0H3J709 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium pasteurianum DSM 525 = ATCC 6013] (length=234 residues).
MLIVKDNPKSPISESYRTLRTNIQFSSFDDNMSTILVTSSTPSEGKSTVSSNLALAMAETNKKVLLIDCDLRRPSIHKKF
GLSNEKGLSNLLIGQHSFNEIAQEITSNLCVLTSGTIPPNPSEMLSSKKMELFLKEAEKNFDFIILDTPPVVSVTDAQAL
STIVDGVLLVVSSGHAQIPEVHKAIELLQYVKANIIGIVANKVKSFRRGYKYYQYYYYGEGDGKNKKHRSKSSK
>gnl|bykdb|A0A0H3JNK3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=230 residues).
MTNTRRSTSSLIVHEQPKSPISEKFRGIRSNIMFANPDSAVQSIVITSEAPGAGKSTIAANLAVAYAQAGYKTLIVDGDM
RKPTQHYIFNLPNNEGLSSLLLNWSTYQDSIISTEIQDLDVLTSGPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPP
VNTVTDAQLFSKFTGNVVYVVNSENNNKDEVKKGKELIEATGAKLLGVVLNRMPKDKSASYYAYYGTDES
>gnl|bykdb|A0A0H3JSP3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=228 residues).
MSKKENTTTTLFVYEKPKSTISEKFRGIRSNIMFSKANGEVKRLLVTSEKPGAGKSTVVSNVAITYAQAGYKTLVIDGDM
RKPTQNYIFNEQNNNGLSSLIIGRTTMSEAITSTEIENLDLLTAGPVPPNPSELIGSERFKELVDLFNKRYDIIIVDTPP
VNTVTDAQLYARAIKDSLLVIDSEKNDKNEVKKAKALMEKAGSNILGVILNKTKVDKSSSYYHYYGDE
>gnl|bykdb|A0A0H3JU05 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=230 residues).
MTNTRRSTSSLIVHEQPKSPISEKFRGIRSNIMFANPDSAVQSIVITSEAPGAGKSTIAANLAVAYAQAGYKTLIVDGDM
RKPTQHYIFNLPNNEGLSSLLLNWSTYQDSIISTEIQDLDVLTSGPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPP
VNTVTDAQLFSKFTGNVVYVVNSENNNKDEVKKGKELIEATGAKLLGVVLNRMPKDKSASYYAYYGTDES
>gnl|bykdb|A0A0H3JUZ7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=228 residues).
MSKKENTTTTLFVYEKPKSTISEKFRGIRSNIMFSKANGEVKRLLVTSEKPGAGKSTVVSNVAITYAQAGYKTLVIDGDM
RKPTQNYIFNEQNNNGLSSLIIGRTTMSEAITSTEIENLDLLTAGPVPPNPSELIASERFKELVDLFNKRYDIIIVDTPP
VNTVTDAQLYARAIKDSLLVIDSEKNDKNEVKKAKALMEKAGSNILGVILNKTKVDKSSSYYHYYGDE
>gnl|bykdb|A0A0H3JYT2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=230 residues).
MTNTRRSTSSLIVHEQPKSPISEKFRGIRSNIMFANPDSAVQSIVITSEAPGAGKSTIAANLAVAYAQAGYKTLIVDGDM
RKPTQHYIFNLPNNEGLSSLLLNWSTYQDSIISTEIQDLDVLTSGPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPP
VNTVTDAQLFSKFTGNVVYVVNSENNNKDEVKKGKELIEATGAKLLGVVLNRMPKDKSASYYAYYGTDES
>gnl|bykdb|A0A0H3K5M2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=231 residues).
MLLMSKKENTTTTLFVYEKPKSTISEKFRGIRSNIMFSKANGEVKRLLVTSEKPGAGKSTVVSNVAITYAQAGYKTLVID
GDMRKPTQNYIFNEQNNNGLSSLIIGRTTMSEAITSTEIENLDLLTAGPVPPNPSELIGSERFKELVDLFNKRYDIIIVD
TPPVNTVTDAQLYARAIKDSLLVIDSEKNDKNEVKKAKALMEKAGSNILGVILNKTKVDKSSSYYHYYGDE
>gnl|bykdb|A0A0H3KAR1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=230 residues).
MTNTRRSTSSLIVHEQPKSPISEKFRGIRSNIMFANPDSAVQSIVITSEAPGAGKSTIAANLAVAYAQAGYKTLIVDGDM
RKPTQHYIFNLPNNEGLSSLLLNWSTYQDSIISTEIQDLDVLTSGPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPP
VNTVTDAQLFSKFTGNVVYVVNSENNNRDEVKKGKELIEATGAKLLGVVLNRMPKDKSASYYAYYGTDES
>gnl|bykdb|A0A0H3N0D2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=225 residues).
MAMLEIARTKREGVNKTEEYFNAIRTNIQLSGADIKVVGITSVKSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGNVKCSSLKKVKEQLEQTGTPFLGVILNKYDIATEKYSEYGNYGKKA
>gnl|bykdb|A0A0H4LEI8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus farciminis] (length=249 residues).
MKLFKSKRKKLDNYSLKHGVGLISYDDPTSTVSEQFKTIRTNIQFSSVDKKLKSILFTSSAPSEGKSTVSNNVAVTWAKQ
GDKVILIDADLRRPTMHKTFNLSNKFGLSNYLLGNAELEDVVQKTMVDNLYVITSGPIPPNPSELLGSMRTKDLLVRLAD
KFDLLILDAPPANSVTDAQVLATKVDGVVLVVPQGIAEKSGVAHAQQALETVHANILGFVMNRVIRESTGYYGGYYGGHY
GGYYGADKK
>gnl|bykdb|A0A0H4LV19 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus rhamnosus] (length=251 residues).
MQLSFSKLFHRHQEDQETQKNGVMLVAFAEPKHVVSEQFRTVRTNIEFAGAALDRCQVVMFTSSAMSEGKSTVSANVAVT
WAQAGKKVLLIDADLRRPTIHATFRTLNIDGVTTILIGKDEAGAVVEETFVDNLSVITSGPIPPNPSELLNSKRMANLLN
WARENYDIIVLDTPPVLAVSDVQVLVPKTDGVVVVANMGKTLKGDLRRTVEVLKLANAKILGSVERVKAKHGDRGYGYGY
GYGYGTNTGKK
>gnl|bykdb|A0A0H5SXP8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Herbinix hemicellulosilytica] (length=230 residues).
MQINFTNINKLSFRANEAYKTLRTNIQFCGNDIKTICITSCIPNEGKSNVSFNLARSLAEFGKKVIFIDADLRRSVLVGK
YKPDQAVIGLSHYLSGQNSIDEILYETNIDNLDIIFTGPVPPNPAELLGIDIFGELLRIFRKVYDYIIIDTPPIGSVIDS
AIVAQKCDGVILVIEANAISYKLAQRAIRQLNKSKSKILGAVLNKYDYGSRYYGYESKKYKKYLDYYTEY
>gnl|bykdb|A0A0J1DM87 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Peptococcaceae bacterium 1109] (length=233 residues).
MPLRDSLIVHNDPKSVGSEAFRTLRTNLQFTSPDRQLRVILVTSAAPGEGKSTISSNLAVAFSQAGLRTLLLDCDLRKPT
VHKIVGLHNSPGLTSLLVGEVKREDVVKDVGVPNLSVIPSGPVPPNPVELLGSQAMRNVLNAVREEFDMVVVDAPPIVAV
TDAAVLCPLVDGVLLTVAAGEVPRELAQHARSLLENANANVLGVVLNRINPSAQKNYQYYYYYYSEVAETSDD
>gnl|bykdb|A0A0J1FRN0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Desulfosporosinus acididurans] (length=253 residues).
MTYSLITVEQAKSPVSEAFRTFRTNVQFTSVDSETKKIMITSAGPREGKSSTVANLAVSMAQTGKSVLIIDADLRNPTQH
KLFGLDNSRGLSMALVQEYELDTFIQESSVPGIMVLTGGPIPPNPAELVGSKRMKRLIEEVSGQFDIILIDTPPIVAVTD
AAILAQEVDGVILVVASAEVNRDYAQRAKEQLDKVGAKILGAVLNKADLKTSEYYYYYYYHGSEAPAKKRKRHKHEKKTT
FFNLLHRNQKDVS
>gnl|bykdb|A0A0J1GBR5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Robinsoniella sp. RHS] (length=478 residues).
MQLYNDKIDIIYDDDKILDVRNFIDNMWNGLKRWKILLLLVFLMTTGGIVAVKSWNYTLLYQAKLTYVVTKTGDAATDVV
ITGRLSASFPDILANTGLSSDIKQKVQIKEEKLPGSIRMYNTSSSNMLNVMITSADYNQANAMMEAFQETYPVYASKNVG
TVELNVIDYTLATENPVNPYPQLKYILMGILSGGCCVFVLLVCYALTRKTIRRETDMKKIVNLDCLAYIPKVKEKKRTNK
EVRHILISDKKVSYDFRQAIRSIQSRTAKHLKEENAKILMITSSLPSEGKTTFAVNLAQAMADEGKRVVLVDCDLRHPSI
GTMLGIESSGEGLQDVIENKLELEKAVKKYRDHIMVLCAGKAREDTANVLSNPRFQEILDSLGSEYDYVVIDTPPVSFFT
DASMISEYADAGIYLVRQDYVEARYVREGMEMLANSELKLVGYVLNYVEAGFLKYGYHNYYYGKSYRYYKQKVSDGEN
>gnl|bykdb|A0A0J1HTP0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus anthracis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQPTAVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSLYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A0J1ID87 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Peptococcaceae bacterium CEB3] (length=247 residues).
MGLSNLITARKPKSPISEAYRTLRTNVQFTAVDGEVKKILVTSAGPGEGKSATVANLAVSLAEAGKHVLIIDADLRNPTQ
HKLFGLSNLEGLSTALVQERALRDLIRETKFTGLAVLSSGPIPPNPAELLNSKRMKRFLEEATGEFDTILIDSPPTIAVA
DASILAQSVDGVILVLASGEVNRDYALRAKEQLEKVGAKLLGVVLNKVEMKTREHYYYYYYGHEHKKRRHRREGNLPGPV
DKSGLGF
>gnl|bykdb|A0A0J1IJ51 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus circulans] (length=236 residues).
MAASKKAKKGGLALNNRRKLIAKYDPKSPISEQYRNIRTNIIYSSVDEEIRSILVTSSGPGEGKSTTTANLAVVFAQQGK
TVLLVDADLRKPTVHYTFNLNNTAGLTSILTNQMNLMEAVHQNDEQNLYILPSGPIPPNPSELLGSKAMSHFLEQALEEF
DIILFDTPPVMAVTDAQVLANLCDGSILVVGSGKADKEAVVKTKELLASSTGKILGVVLNNKKADKKGSYYYYGTN
>gnl|bykdb|A0A0J1J7S4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Robinsoniella sp. RHS] (length=251 residues).
MKKVNFEKIDALNFQSSEAYKTLRTNIQFCGEKIKVVSFTSCLPNEGKSTLVFRLASSMAEAGKKVLMIDADIRKSVTVA
RYQADKKVQGLSEYLTGQCALDDCLCGTNIENMDFIFTGPVAPNPSELLGSDKFEELIARLRPEYEYIFIDCPPLGSIID
AAIVSTVSDGAVFVIEADIISYKFAQKVKQQLEKSGCKILGAVLNKVDMDGKGYYGRYYGKYYGKKYGGYYGYGYGEKDV
QNAAKEAVAGN
>gnl|bykdb|A0A0J5GMQ2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. LL01] (length=231 residues).
MARPNKQVKENNKRGLITHTNRKSPISEQYRTIRTNIEFAAVDEPIRTIVVTSTSPGEGKSTTSANLAVVMAQNGNRVLF
IDGDMRKPTAHYTFGVLNTKGLXNVLTRQVSLEEAVSQTKIENLEILTCGPIPPNPAEXLNSKGMELLLEKTKEQYEVII
IDTPPVMAVTDSQLLANKCDGTVLVVCSGKTDRQMALKAKDLLSQAKAKLLGVVLNKKEVKPGDNYYYYYE
>gnl|bykdb|A0A0J5R6D2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus pseudalcaliphilus] (length=230 residues).
MARRELKSNGKKRALITHEKKKSPISEQFRTIRTNIEFSSVDKAIKTLLVTSSGPGEGKSTTTANLAIVLAQNGNSVLLI
DADLRKPTVHHTFGILNTRGLTSLLTKKAESDKAIQESEIENLSILPSGPIPPNPAELLSSKTMELLLDSFTQQFDIVLL
DTPPVMAVTDAQVLGNKVDASVLVVSNGKTDRNQAVKTKELLESTSSKLLGVVFNNKEVKKGHYYYYYGE
>gnl|bykdb|A0A0J5YVE4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus firmus] (length=223 residues).
MEHKRKLVTKNDPKSPISEQYRTIRTNIQFSSVDEEIRTIMVTSSGPGEGKSTTTANLAVVFAQQGKRVLLVDADLRKPT
VHYTFNLMNTSGLTSVLTNQMTLMESVKAIDMKNLFILPSGPIPPNPSELLGSKAMDYFMNAALEEFDIILFDTPPVLAV
TDAQILSNKCQGTILVAGSGKAEKEQLVKTKELLEAAKGKLLGVVLNNKKMKESQHYYYYGVN
>gnl|bykdb|A0A0J6CWX1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerobacillus macyae] (length=223 residues).
MKRNQMLVTHLNPKSPVAEQYRTIRTNIQFASINEQIQTYMVTSPMAGEGKTTTITNLAVVMAQQEKKVLIIDADTRKPS
VHYAFQRNNIKGVTNVLTGQLSLKGAVIPTAVPNLDILASGPIPPNPSELLASPQMEQLLKEACRHYDIVLVDTPPVLIV
SDAQIMANRCQGSILVVNSGKTESDSANQAKDALIHAKAKLLGVVLNRKNKRRDKTFYYYGRQ
>gnl|bykdb|A0A0J6ENT9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus glycinifermentans] (length=230 residues).
MSRLAIRKKRSRKYESALVALDQPNTPIVEQYRTIRTNIEFSSFEKPFRSLLITSGLPGEGKSFTAANLAVVFSQQEKKV
LLIDADLRKPSIHKIFQLDNHSGVTNVLMKKTHLENVVQQSQTESLHVLTSGPIPPNPAELLSSQAMADLLKEAYEQYDL
VLLDSPPLLPVADAQILANQVDGSILIILSGKTKLDNAIKARDALNSSKSELLGAVLNGRKVKKARQYNY
>gnl|bykdb|A0A0J6LCC9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. LK2] (length=229 residues).
MVLKKKILRARRQLIAYEQPKSSVSEQYRNIRTNIEFASVDKKIRSLIVTSANQSEGKTTTAANIATVFAQQGKKVLLID
ADLRKPALHQMMQVDNIFGLTSVLTRSKTLETCVTQTKIGNLTFLPCGPIPPNPAELLGASSMKDLLSEAYGTYDLVIFD
TSPILPVTDAQIMANQCDASVLVIRSGATEKEAALKAKQSLDSAKGTLLGVVLNDKEQNGSEYYYYSSN
>gnl|bykdb|A0A0J6NBG5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASVLVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDRERENGLYYYYGAN
>gnl|bykdb|A0A0J6WVZ4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Megasphaera cerevisiae DSM 20462] (length=236 residues).
MEEINLVTRYKAKSPFAEAYRAVRTNLQFSGAGSAIQCIIFTSAAPREGKSTTAANMAIMMAQDGKKVLLIDADMRKAVQ
HIIFNLPNKGLSNCISMNTPFEEVVQKGIAAPNLDILPGGPMPPNPAELLNSANMAALLRQVRNVYDYIFIDMPPIMVVT
DAAVLASKADRVVLVVRSGVVPPARLQSAKERLEQGGARLLGVILNCVPQYRCDNYGYGAYYDEKAEKQHHESAPL
>gnl|bykdb|A0A0J6WZI1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Megasphaera cerevisiae DSM 20462] (length=238 residues).
MEEINLIAQYDAKSPIAEAYKAIRTNLQFASVGTAARVITFTSATPAEGKSTTISNVALTMAQDGKKTLLIDADMRKPVQ
HRIFGIPNQGLSNCIAMDVSWEETVQHDVVPHLDVLTSGPVPPNPSELLGSERMQKIISQVRTQYDYVLIDMPPVLAVTD
AVVMASRADGVVFVVKSGSISPEEANMAKTKLEQGGAHILGVVLNEVPRRQHGSYGYEYYYYYDEEHVKHRNSKKVNN
>gnl|bykdb|A0A0J7DER0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNVEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTAVDNLNFLACGPIPPNPAELLGSKSMQELLGQAYSMYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKESAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A0J7EYB2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus wiedmannii] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNVEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSMYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A0J7H1I5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTNSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A0J7IDF6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNVEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTAVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSLYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A0J8GB34 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeria fleischmannii 1991] (length=219 residues).
MSNTKRNKRRKDSYSPTSEQFKLIRTGIDFSGIDEKKQVILITSPESGTGKSTVSSHLAVAYAEKGARTLLIDADMRKPT
LHKRFSKNLHLGLSNVMTGDISLEDSIQEVELRASTLSILTSGPIPPNPNDLLSSKKMSELIESLRDSFDKIIIDTPPVT
IVSDALVLADSADGTVLVCRYHKTLKEKAKHAVNQLRLSKAKLIGVIFNGTKNAENYYY
>gnl|bykdb|A0A0J8GCD9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeria fleischmannii 1991] (length=224 residues).
MLKLSERKLIAYANPSSPIAEQFKTLRAGIHFSSVDHKYKTILITSTEPESGKSTVSANLAVVYAQHGQKTLLIDADMRK
PTGHLTFGIRSNIGLSNLLASSDLAAAEVCSQTAIENLDILTSGTLPPNPNELLASKKMGQILEELASCYDQIIIDTPPI
LASSDALVLTSYVNGVILVLRSDKTLKDRAKIAVEQLRNTHVHIIGTVLNCVKNDSDNYYYYYQ
>gnl|bykdb|A0A0J8GCL7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeria fleischmannii 1991] (length=224 residues).
MKKTSRKQLIAYKNPTSPVSEQFKTIRTSIDFSAIDSAFQTILVTSPEVGSGKSTIAANLAIVYAQQGKKTLLIDGDLRK
PTVHKTFSKNMFCGLSSVLTDQIDLHEACQNTEVPNLSILTSGAIPPNPNEMLSSNKMTLILEELKQEYDLIIIDTPPVT
IVSDALVIAQEVDGVILAVRYGVTLKDRIKQAVEQIGMTRTPIIGTVLNGVSEKKSNYYYYAYK
>gnl|bykdb|A0A0J8GDV6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeria fleischmannii 1991] (length=224 residues).
MSEQITRGRNLITIVNPNGPISEQFKTLRTGIHFSSVDTKYQSIMITSPEPNNGKSTISANLAVCYAKQGNRTLLIDADM
RKPTVHRTFDIRVNVGLSNLLTGDMERSEVFRQTEIDNLVVLTSGTVPPNPNELLISKKMEKLMQQFSQEFDQIIIDTPP
ILASSDALVLTPYVDGTVVVLRSEKSLKDRTKIAVDQLRKTNVPIIGTVLNCVKNRLDNYYDYS
>gnl|bykdb|A0A0J8GH97 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeria fleischmannii 1991] (length=232 residues).
MKKTDKKDIKNRLVALHEPSNPQAEYFRTIKTNIEMANIDSQIKSLLITSPTQDSGKTMISVNLASTYANDGVKTLIVDL
DLRRPSLGFAFPFLKSCPGLTGILDSSQKLTLDDAIVKIGDTNLYALPVGVRPVSPYSILNSEKLVQLIKQLQEEFDMII
IDTPPVLMVTDALLISKWVEACILIARGSYSNKKDVRKSLKSLRDSNANVLGAIFNNPQMKQTNYYYAESDA
>gnl|bykdb|A0A0J9BVJ4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Clostridium] citroniae WAL-19142] (length=262 residues).
MDQILNLKNTGEKNYHFEESIKTLRTNMQFCGSSLKTIMFTSSLPNEGKSEITFSVAASLGSIGKKVLMIDADIRKSVLI
KRYEIKGNPNGLSQYLSGQKSLDEICYATDVENFDIILAGPYSPNPAELLEDSLFRELLEKAKERYDYIIIDTPPMANLI
DGAIIANQCDGAVIVIESGTISYHLVQKVKGQLEKSGCRILGAVLNRVDKEYENGYYKKYYGKYYGKYYRNTGGGGYRGI
SLWTEMGNNIYEANRKQEESKP
>gnl|bykdb|A0A0J9EWH6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Clostridium] citroniae WAL-19142] (length=249 residues).
MKQIITLNRDMKDDYHYNEAIKTLRTNIQFCGNGIRTIMLTSSLPDEGKSDITFAMAASLAQIGKKVVMIDADIRKSVLV
SRYQLETEVYGLSQYLSGQKMLADVLYDTNVENLSMVFAGPYSPNPAELLEEDLFEQMVQELKKTYDYVIIDTPPMANLI
DGAIVARQCDGAVMVVESGCISYRLEQRVKGQLEKSGCRILGVVLNKVSMERNGYYSKYYSRYGKYGKYSKYGKYGKYGK
YEKYEKAEA
>gnl|bykdb|A0A0J9F007 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Clostridium] citroniae WAL-19142] (length=247 residues).
MGQTLSLKNTGRKDYHYEEAVKTLRTNIQFCGNNLKTIMFTSSLPSEGKSDTTFAVAASFGSIGKKVLLIDGDIRKSVIV
KRHEIQGNPCGLSQYLSGQKTAEEICYGTDVENLDIILAGPYSPNPSELLEDPLFKELLDRARLKYDYIIIDTPPMANLI
DGAIIASLCDGAVIVINSGTISYHLVQKVKSQLEKSGCRILGAVLNRVGTDYDNGYYKKYYGKYYGRYYGKTYGGGGEKY
QILDEAR
>gnl|bykdb|A0A0K0GCF6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacilli bacterium VT-13-104] (length=232 residues).
MARKKPSKMNTKMRQLITKINPKSPISEQYRTIRTNIQFASVDNKIQSLLVTSSGPGEGKSTTTANLAVVYAEAGKKVLL
VDADLRKPTVHYTFRLDNLTGLSNVLVGENTLDEAANRTDIENLDVISCGPIPPNPSELLASKKMEQFISEATQSYDLVV
FDTPPVLAVTDAQILANMVDGSILVVRSKHTELESATKAKDVLEPARAKLLGTVLNGREKQGSNYYYYYGTN
>gnl|bykdb|A0A0K0QK30 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A0K0SG49 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis subsp. indiana] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A0K1KB17 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Geobacillus sp. LC300] (length=232 residues).
MAANSRKKFQKAERNLITFDDPKSPISEQYRTIRTNIQFSFIDEPLQSLMVTSSAPSEGKSTTAANLAVVFAQQGKKTVL
IDADLRKPTVHYTFRLNNYTGLTSVLTNAVPLLSALQGTAIENLTVLTAGPIPPNPAELLSSKMMDRLFHELKEIYDLVI
FDTPPVLAVTDAQILANKCDGTVLVVASGKTETDAAVKAKELLEAANAKIVGVVLNQRKQREGSGYYYYQYK
>gnl|bykdb|A0A0K2LE28 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus heilongjiangensis] (length=261 residues).
MEINQILRRGGSKVAFKLFKKTAKKLDNYSLSHGVSLVTYDNPISTISEQFNTIRTNIQFSSVDRNLQSILFTSSAPSEG
KSTVSNNVAVSWAKQDKRVILIDADLRRPTIHRTFGVSNHLGLSNYLSGTVDLETVIQPTMVENLFVITSGPTAPNPSEL
LGGNRINEMLATLTEQFDCLIFDAPPINSVTDAQVLATRVDGVILVVPCGIANKVGVTQAKKSLETVHAHILGFIMNRMT
KENMEGYYGGEYSGYYGAIQK
>gnl|bykdb|A0A0K2MHY2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium beijerinckii NRRL B-598] (length=238 residues).
MFSAKRLNKAVANQEYKGFVVEKKPKSIVSEAYRTLRTNIQYSSFDKTIKTIVITSAEAAEGKSTVSGNLALSFAQNEKR
VIIVDCDLRKPSVHKNFKLSNLSGLSEVLIGKEDLDKVIQNRNENLDILTSGKIPPNPSEMLSSTAMTNLIKKLGEKYDI
VILDSAPLQAVTDAQILSTKADGTILVVRAQRTSRESVIDAKNLLTKVGANILGTVLHAVENTRGKYYYYYGSSEEGK
>gnl|bykdb|A0A0K2MKT3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium beijerinckii NRRL B-598] (length=240 residues).
MKSYKLEKTVVDNRIHAGFIVEDKPKSIVAEAYRTLRTNIQYSSFDKEIRTIAVTSAEMAEGKSTVAGNIAVSFAQNEKK
VILVDCDLRKPSVHKNFKVSNLIGLSEVLLGKAAIEEAVQKRNDNFYFLTSGKIPPNPSEMLSSSAMSNLIERLKVEFNI
VVLDTAPLKAVTDAQILSTKVDGTILVIRAGETKRDIVMDAKNLLDKVGANIIGTVLHAVENTRGKYSYYYGNDEDKDNL
>gnl|bykdb|A0A0K6GM54 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anoxybacillus suryakundensis] (length=233 residues).
MVLKKKKQVFERTMRSLITKTNPKSPISEQYRTIRTNIQFSVADRPLRSIMVTSSAPAEGKSTTVANLAVVFAQQGKKVL
LIDADLRKPTVHYTFRRDNYVGLTNVLTKQATLQTAVKETDVENLFVLTSGPIPPNPAELLGSAAMEELLAEAYDQFNVV
LFDTPPVLAVTDAQILANQCDGTILVVQSGKTEIEAAQKAKELLLAAKGKLLGVVLNQKKQKESSYYYYYGNK
>gnl|bykdb|A0A0K6J109 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNVFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSMYDL
VIFDLPPILAVTDAQIMANQCDASILVVRSESTEKESAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A0K6JDF7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus subtilis] (length=228 residues).
MRRNVIAMTEPKSLNSEQYRTIRTNIEFASVDRQMKSVMITSACPGEGKSTTAANLAVVFAQQGKKVLLIDADLRKPTVH
TAFFLENTVGLTSVLLKKSSMEQAVQASNEKHLDVLTSGPIPPNPAELLSSKWMKELAYEACAAYDMVIFDTPPILAVAD
AQILGNVADGSVLVISSGKTEKEQAAKAKEALETCKSKLLGAIMNGKKLSKHSEYGYYGNKDNFMQNK
>gnl|bykdb|A0A0K6K993 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=238 residues).
MALRKSRGSWIRRNVIAMTEPKSLNSEQYRTIRTNIEFASVDRQMKSVMITSACPGEGKSTTAANLAVVFAQQGKKVLLI
DADLRKPTVHTAFHLENMIGLTTVLLKKSSLEQAVQAANATHLDVLTSGPIPPNPAELLSSKWMNELADEVCAAYDMVIF
DTPPILAVADAQILGNVADGSVLVISSGKTEKEQAAKAKEALESCKSKLLGAIMNGKKLSKHSEYGYYGNKENFIQNK
>gnl|bykdb|A0A0K6KHW0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=227 residues).
MVFRKKKARRGLAQISVLHNKSIVAEQYRTIRTNIEFSSVQTNLRSILVTSSVPGEGKSFSAANLAAVFAQQQEKKVLLV
DADLRKPTINQTFQVENVTGLTNVLVGNASLSETVQMTPIDNLYVLTSGPTPPNPAELLSSKAMGDLISDIYEQFSLVIF
DSPPLLAVADAQILANQTDGSVLVVLSGKTKTDTVLKAKDALEQSNAKLLGALLNKKKMKKSEHYSY
>gnl|bykdb|A0A0K6MFE6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus subtilis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLYFLACGPIPPNPAELLGSKSMQELLAQAYSMYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKESAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A0K8JA08 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Propionispora sp. 2/2-37] (length=223 residues).
MEQKLVVHEDAKSPIAEAYRTLRTNMQFAKLDGELKVIMFTSAGPDEGKSTTAANTAVALAQSGKSVLIVDCDLRKPVQY
RIFAKKNRGVTDILIEENITAAQLIVDTTIPNLRVLPSGPIPPNPSELLGSQSMTKLLEELKQTADVIIIDAPPAIAVTD
ACVLASKVDGVILVLGAGLVRPDMARKAKELLIKAQGEILGVIMNRVEVEAEHAYYYYYYGNE
>gnl|bykdb|A0A0K9F5I0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lysinibacillus xylanilyticus] (length=214 residues).
MARKLVTDSKSIISEQFRTIRTNIRFSLPDQEIKSLLVTSSIPGEGKSTNAANLGVVFAQEGKRVIIIDADMRKPTLHHT
FSTINTDGLSDVLTRQKIYLNVIQKTSVEELSIIPSGPLPPNPVDLLSSKTMEILMQDLRKDYDIIIIDAPPLLSVSDSQ
ILSNKCDGTILVVNMDLVKKVDVLKAKATLVSSKAQILGVVLNNVKTPKNHYYY
>gnl|bykdb|A0A0K9GHX6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. FJAT-27916] (length=250 residues).
MRRQRQEVYQGQEEVNQLVRKKSKKEIGMGNQRKLVTYSDPKSPVSEQFRTLRTNIQFTAVDEELQTILITSSGPSEGKS
TTASNTAVVFAQQGKRTLFIDADLRRPTAHYTFACLNTAGLTNVLTKQTTLEKAVQVVEPLGLHVLTSGPLPPNPAELLS
SRSMKELINQVKQDYDVIIIDSPPVTAVTDAQVLARECQGVILVVSSGRTQIEEAVKTKELLEHTGAKILGAVLNNKKIK
GSSYYYYGKK
>gnl|bykdb|A0A0K9GWN1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus loiseleuriae] (length=234 residues).
MALKNKKKPVSDSKRKLIAKFNPKSAISEQYRTIRTNIQFSSVDKDIRSIVVTSSSPSEGKSTTVANLAVVFAQQGKNVL
LIDGDMRKPTVHYTFNDANTIGLTNVLTKQKELVDAIITTDEKNLFVLTSGPVPPNPAELLASNAMKDLMETAKEQFDIV
LFDSPPVLAVTDAQILANFCDGTILVVSSGKTESEAALKSKELLLAANANLLGAVLNNKKSNAGDYYYYYGSKD
>gnl|bykdb|A0A0K9H3A7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. FJAT-27231] (length=235 residues).
MRLRRKERKKAARGSALRKLIVQTNPKSPISEQYRSIRTSISFSSADQSVRSLMITSAGPGEGKSTVAGNLAVAFAQQEK
RVLLIDADMRKPTVHYTFNLANYNGLTNVLTKQMELSQTVNETDIPFLLVLTSGPIPPNPAELLGSKAMDDCLEEACENF
DIVIFDTPPLLAVTDAQILANRCDGTVMVINSEKTEINDALKAKELLQSVQAKIIGTILNNKKMSKSNYYYDSDE
>gnl|bykdb|A0A0K9M7P8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. FJAT-27238] (length=231 residues).
MSMRRQKPDDRYQKLIAHWEPLSPLVEGYRTLRLNIQFSMGDKLMQTILVTSPGASEGKTITAANLSLMMAKDHKKTVLL
DFDLRNPRVHFTFDMPNLYGISSYFSDMCQIPDIIQPSGVSELSIITAGPIPHNPAEMLGTPRLLELMDYLRHSYDFVIV
DSPPLIVSDAMVLAREMDGCVMVVDASKTKRDSAIKAVEQLKAAGANLLGVVLNNKKVGKREGYYGYGYNA
>gnl|bykdb|A0A0K9NAJ8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Dorea sp. D27] (length=224 residues).
MQEIYLKNMGKDYRSNEAYKTLRTNIEFSGADNKVIVFTSCTPNEGKSTVSLSLAQSLAEGGKRVLFIDADLRKSVLIGR
HKVNGDLKGLSHFLSGQSEVDDIIYKTQEPGMMVIFSGVTPPNPAELLGYKRFSSLIASARKVYDYIIIDAPPLGSVIDS
AIVATVCDAAVLVIAANAISYKFARVVKEQLEKSNCSILGVVLNKVNMKQNKYYGKYYGEYGKK
>gnl|bykdb|A0A0L0QQG9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Virgibacillus pantothenticus] (length=231 residues).
MSRKNPSRPGTKMRHLIAKLNPKSPISEQYRTIRTNIDFASVDKEIRTLLVTSSGPGEGKSMTAANLAVVYAQQGKKVLL
IDADLRKPTVHYTFRIDNLRGLSNLLVGENSLEQVVQQSDVDYLDVMSCGPIPPNPSELLASKKMEQLLETLKATYDIVI
FDTPPVLAVTDAQILANIVDGSILVVRSKHTEIEGAQKAVESLKPARAKLLGTVLNGREKKQSNYYYYYGA
>gnl|bykdb|A0A0L0RGN1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus delbrueckii subsp. indicus] (length=261 residues).
MAFGRKKHLDKDTMKNGAKLITLANPQSVISEQFRNIRTNINFMNVDKEVKTIVFTSAMASDGKSTVSANVAITMAQAGK
KTILIDADLRRPTMHSTFNVSNSNGLTTLLTSRSVEMDASSVIRESGVENLSILTAGPIPPNPSELLSSKHMLDLIEDLK
QEYDMVVLDLAPILDAGETQQLTSSLDGTILVVRQAHSQKSAVKRAVELLKLTKSPILGYVMNDVDADGDDGYGYGYGYG
YGYGYGYGEEKEKKGLFGRKK
>gnl|bykdb|A0A0L1LKQ1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus megaterium] (length=236 residues).
MARKNKAQKNDKMLTLKRRLLAHNSPKDPVAEQYRTIRTNIQFSNVDQDIKTIVVTSSGAEEGKSTTTSNLATVYAQQGL
NVLLIDADLRKPTGHYTFRLENHIGLTNVLTRQSTLAQAVQESEIPHLSVLTSGPIPPNPSELLASAQMAELLKEMKEQF
DMIIFDTPPILAVADAQILANQVDGTILVVSSGKTEKDAALKSKELLSNAQGKLLGVVLNNRKVEEGNYYYYYGQN
>gnl|bykdb|A0A0L1LVJ9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus megaterium] (length=237 residues).
MKQEVIQLARKDKEKLFQLRNRSLISLTNPKSSIAEQFRTVRTSIQFSGIEADLQSLLVTSPSPAEGKSTIAANLAVVFA
QQGKRTLFIDSDLRKPTVHYTFHIENHIGLTNILTGQVTLEEAVKTTRQENLWVLTSGPIPPNPSELLGSKGMDALLEKA
KDEFDLVIFDSPPVLAVTDAQVLSNLTNGVVLVINSGKTKIDDAKKTKELLENAKAKILGVVLNNKKEQANQYYYYE
>gnl|bykdb|A0A0L6JIJ7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pseudobacteroides cellulosolvens ATCC 35603 = DSM 2933] (length=245 residues).
MTTINYEHEFKINESLEEAFKVLRANIHFCDPENKLKTIAITSYSSGDGKSCVSANLSYTIAKSGMKVLFVDADLRKPIL
YKKLVSKDFKGLSNYLLGNSTLEQIINKTQIEGFDFVSCGIKTLSPGELIASPRLGEFLIKTREIYDFVIIDTPPLGSVI
DGALISSQSDAAIIVVSQYKTKCNNAIMMKEQLQKANANILGVVFNKVNKLDFRNYYGGYDYDNKKTKYSRKLLKEIKNV
KRDNL
>gnl|bykdb|A0A0L6U303 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Acetobacterium bakii] (length=242 residues).
MQDTIITFRLPKSPISEAFRNMRTNITFSDIDNELQVLAITSTNKSSGKTTILSNYAVALAQSGKRTLLLDCDLRRPKIH
KKFELSNNKGLTNILLKEIEVINGIQETEVPNLFVISSGPIPPNPSEILASRRMGELVAELKNNFDYILLDAPPVGMVTD
AAVLSSVAEGYILVVAIGNCDRDGVRYSLESLAKVNANVIGIVANKVPINKRSGYYAYYSAYEEDRVLNEKTKKKQLKKE
PI
>gnl|bykdb|A0A0L6ZCA8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium homopropionicum DSM 5847] (length=238 residues).
MLIVEKEPKSIAAEAYRTLRTNIQYSSFDNNIKTILVTSSGPSEGKSTTAGNLALSMAQADKKILIIDCDLRKPTVHKKF
NISNEKGLSNYLIGEVKLEEVMTKYSDNLYLLTSGTIPPNPAEILSSKKMKEFLESVKNQFDSIVIDSPPVLAVTDAQIL
STIVEGVLLVVATGETEKEATIKSKELLKKVNANILGVVMTKMPVKTGKGYGYGYGYGYYYYYGEDHKKHTKRGKKKK
>gnl|bykdb|A0A0L7NHF7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium botulinum] (length=234 residues).
MLIVEKEPKSIAAEAYRTLRTNIQYSSFDKELKTIIVTSSGPSEGKSTTSGNLALSMAQSDRKVLLVDCDLRKPTVHKKF
HISNEKGLSNYLVGEALFEEVIVKYNENLSLLPAGTIPPNPAEMVASKKMKSFLDSLKGKFDCVLIDTPPVIAVTDAQIL
STVVDGVLLVAASGQAEKEAATRAKELLLKVNANILGVVLTKVPLNEGKGYGYSYYYYYGNEDEESKKGRRHKK
>gnl|bykdb|A0A0L9ZXL8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium botulinum] (length=236 residues).
MDRNLSLITIKEPKSPISEAYRTLRTNIQFSSFDEKISVIFVTSSTPGEGKSTTSANLAITMAQNGSETILVDCDLRKPN
VHKLFKLSNTRGLSNLLIEDNGIDKVIQQSGIENLHILTSGIKPPNPSELLSSKKMKKFIEMSKEHYDYIILDTPPVGVV
TDAQLVSQYSDGGILVTASGQVERELAIRAKQLLQKVNAKILGVVLNKVDTSSGNGYRYYNYYYEEDGKKKKRSKK
>gnl|bykdb|A0A0M0EYF4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus butanolivorans] (length=227 residues).
MGFLRSKDEKQVNLIAQTNPKSPITEQYRIIRTNIQFSSVDKEIKTIVVTSAEPNDGKSTTAANLAIVLAQEEKKVLLVD
ADLRKPSIHYAFNLSNIHGLTSVLTKKMDLRKNILNSNVPNLDILTSGPIPPNPSELLNSKAMETAINELKDIYDFIIFD
TPPVLLVTDSQIVANKCDGVIMVVASGKTNKQSAVKAKELLEKANTALLGVVLNGMESNTSNYYYQS
>gnl|bykdb|A0A0M0G0K3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus marisflavi] (length=222 residues).
MSTRRKLVTHDNPQSPISEQYKTIRTSINFSSIDQQIRSIMVTSSGPGEGKSTTAANLAVVFAQEGKNVLLVDGDMRKPT
SHYTFNVNNTFGLTSALSRQKTLREVVHQTDIKNLDLLTCGPVPPNPAELLSSRSMEELLNDIYQDYDLVVFDTPPLLAV
TDAQVLANKCDGTVLVLSSGTTEIDSAKKAKELLDTTNGRLLGVILNNREIKDTSYYYYGKK
>gnl|bykdb|A0A0M0KFV4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus okuhidensis] (length=235 residues).
MLGKGSKQKNGSEQRELITHIKKNSPISEQYRTIRTNIEFAAVDRELKTIVVTSSGPGEGKSTTSANLAVVMAQNGHNVL
FVDADLRKPTAHYTFRAVNTRGLTRVLMRQETLEEAIQETKVENLSLLTSGPIPPNPAELLNSKMMELIIKEVRDRFDIV
IIDSPPLNAVTDAQILSSKCDGTVLVISSGKTQKEEALKAKDLLDKSNANLLGVVLNNKELRNSNMYYYYGESDR
>gnl|bykdb|A0A0M0KRJ0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Jeotgalibacillus marinus] (length=227 residues).
MVFRKKKARRGLAQISVLHNKSIVAEQYRTIRTNIEFSSVQTNLRSILVTSSVPGEGKSFSAANLAAVFAQQQEKKVLLV
DADLRKPTINQTFQVENVTGLTNVLVGNASLSETVQKTPIDNLYVLTSGPTPPNPAELLSSKAMGDLISDIYEQFSLVIF
DSPPLLAVADAQILANQTDGSVLVVLSGKTKTDTVLKAKDALEQSNAKLLGALLNKKKMKKSEHYSY
>gnl|bykdb|A0A0M0KSK6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Jeotgalibacillus marinus] (length=238 residues).
MALRKSSGSWIRRNVIAMTEPKSLNSEQYRTIRTNIEFASVDRQMKSVMITSACPGEGKSTTAANLAVVFAQQGKKVLLI
DADLRKPTVHTAFHFENMIGLTTVLLKKSSLEQAVQASNATHLDVLTSGPIPPNPAELLSSKWMNELADEVCAAYDMVIF
DTPPILAVADAQILGNVADGSVLVISSGKTEKEQAAKAKEALESCKSKLLGAIMNGKKLSKHSEYGYYGNKENFIQNK
>gnl|bykdb|A0A0M0LHP8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus koreensis] (length=237 residues).
MAKRFGKNKKVSNMRNLIAHLKPKSTISEQYRTIRTNIQFSNVDQKLRSIVVTSSVPGEGKSTTIANLATVFAQQDKRVL
LIDGDLRKPTAHYTFRLENRMGLTNVLTKQTRLASAIQRSEVKNLDILTSGPIPPNPAELLASQAMANLFTELYEHYELI
VFDSPPILPVTDAQILANQCDGAVLVVQSGRSDKEATQKAKELLDAAKGKLLGVVLNRKEQKASSGYYHYYGTDNNN
>gnl|bykdb|A0A0M0LLP3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Viridibacillus arvi] (length=231 residues).
MFKKKRKEHRRKLITSTDPRSIVSEQFRMVRANIKFSMKDKQFCTLLFTSASKGEGKSTVAANTAIAFAQEGKKVLLVDA
DLRKPTMHHTFNKLLSPGFTNLLMIQWKIADVVKESGIKGLDLITCGPIPSNPAELLGSTSMDLFIKEAKALYDIVVFDA
PPVLSVADAQILSEKCDGTILVINAGSTEKRFAVKTKEVLQSSKANIIGTILNNFKLEKGHYYYEYYGQDV
>gnl|bykdb|A0A0M0WU87 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. FJAT-21351] (length=224 residues).
MLTLKRRLLAHNSPKDPVAEQYRTIRTNIQFSGADEEIKSLVLTSSGPSEGKSTTAANLAAVYAQQGINVLLIDGDLRKP
TAHYTFRLENHTGLTNVLTKQSQLGQAVQSTEVPNLYVLTSGPIPPNPSELLASKQMGEVLAEMKERFDMVIFDTPPILA
VADAQILANQVDASLLIVSSAKTEKDAALKAKDLLTQAKSKLLGAVLNNRKMNEGNYYYYYGSN
>gnl|bykdb|A0A0M0WZM9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lysinibacillus sp. FJAT-14745] (length=223 residues).
MPRKLVTVLDENSISSEQFRAIRTNIKFALPDKDLKTILVTSSTAGEGKSTSAANLAVVFAQEGKRVLIVDADMRKPTIH
HTFEMYNTSGLSTVLTRQEKLHEVVQQSFIVGLDVIVSGPTPPNPTDLLDSTTMDILMKEIYRDYDIIIFDAPPLLHIAD
AQILAHKCDGTLLVVDTDVALKDDMLKAKTLLTTARAKVLGVIMNNMALTRDHYYYQYSSNKK
>gnl|bykdb|A0A0M1NC91 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. FJAT-21352] (length=225 residues).
MRSKDKKQVNLIAQTNPKSPITEQYRLIRTNIQFSSVDKEIQTIVVTSAEPNDGKSTTAANLAIVLAQEVKKVVLVDADL
RKPSVHYAFSLSNIEGLTSVLTKKMSIEKALVKTNVPNLDILTSGPIPPNPSELLNSKAIEKAIDELKGMYDYIIIDTPP
VLVVPDSQIVANKCDGVIMVVASGKTNKQSAVKAKELLVKANTSLLGVVLNGVETDNSNYYYYQS
>gnl|bykdb|A0A0M1NZ20 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. FJAT-22058] (length=228 residues).
MGFLRSKDEKQVNLIAQTNPKSPITEQYRLIRTNIQFSSVDKEIKTIVVTSSEPNDGKSTTAANLAIVLAQEEKKVLLVD
ADLRKPSVHYAFNLSNIHGLTSVLTKKMDLRKTILNSNVSNLDILTSGPIPPNPSELLNSKAIEIAINELKEMYDYIIFD
TPPVLVVPDSQIVANKCDGVIMVVASGKTNKQSAVKAKELLVKANTSLLGVVLNGVETDNSNYYYYQS
>gnl|bykdb|A0A0M1UXR5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paeniclostridium sordellii] (length=237 residues).
MSIVAFKEPKSPISEAYRSIRTNIQFSNIDKDIKTILFTSSKQDEGKTTVVANMGVSFAALEGKKVLIIDADLRNPSIHR
KFNLTNTYGLTEVLSGQKDFKKAIQNTEINNLQILTTGKMPPNPSEMLESKKMKEFAQTLEESYDYIFIDSPPIGVITDA
GSIANYSDATVLVVGSGETDIEMAKITKERLEKVKANIIGVVLNKYVGEDGAYGYYSYCYEQNDGSRSARHKKKNKK
>gnl|bykdb|A0A0M1X983 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus faecium E417] (length=232 residues).
MARTQKQKATQTHAVSLITLTNPSSPIAEQYRTIRTNIQFASAAGQQIKTIVVTSSGPGEGKSTTAANIAVVFAKSGQRV
LLVDADLRKPVVYKTFQLNNASGLSTALSSSGSVADVIQRTPVENLSILPSGPKPPNPSELLSSPRMDQVLAEARQLFDV
VIFDMPPVVAVTDAQIMSSKTDGTLLVVRENTSRKESLTKAKELLEMVQARVLGVVYNGAEHSKDAGYYYGN
>gnl|bykdb|A0A0M2AJS9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus faecium EnGen0153] (length=232 residues).
MARTQKQKAAQTHAVSLITLTNPSSPIAEQYRTIRTNIQFASAAGQQIKTIVVTSSGPGEGKSTTSANIAVVFAKSGQRV
LLVDADLRKPVVYKTFQLSNASGLSTTLSSSGSVADVIQRTPVENLSILPSGPKPPNPSELLSSPRMDQVLAEARQLFDV
VIFDMPPVVAVTDAQIMSSKTDGTLLVVRENTSRKESLTKAKELLEMVQARVLGVVYNGAEHSKDAGYYYGN
>gnl|bykdb|A0A0M2B107 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus faecium OC2A-1] (length=232 residues).
MARTQKQKAAQTHAVSLITLTNTSSPIAEQYRTIRTNIQFASAAGQQIKTIVVTSSGPGEGKSTTAANIAVVFAKSGQRV
LLVDADLRKPVVYKTFQLNNASGLSTALSSSGSVADVIQRTPVENLSILPSGPKPPNPSELLSSPRMDQILAEARQLFDV
VIFDMPPVVAVTDAQIMSSKTDGTLLVVRENTSRKESLTKAKELLEMVQARVLGVVYNGAEHSKDAGYYYGN
>gnl|bykdb|A0A0M2NRW6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus pasteuri] (length=230 residues).
MSNVRRKYPKLIVNEQPKSPISEKFRGIRSNILFASADDPIKSVVVTSDGPGSGKSTTSANLAISFAQAGYKTILIDGDM
RKPTQHYLFKLPNNEGLSSLLLKWSDYESAIQSTHIEGLDVLTSGPIPPNPSELITSRSFKNMFDHISEKYNFVIIDTPP
VNVVTDAQLFSNYTQHAVYVVNVESNNKEEVKKGKQLLEKSGSKIIGIVLNKAPQEKNSKYYAYYGDDKS
>gnl|bykdb|A0A0M2PKD2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. SA1-12] (length=233 residues).
MARKDRKQLFQLQNRSLISMTNPKSPIAEQFRTIRTNIQFSSVDEELQTMIVTSSGPAEGKSTTTANLAVVFAQQGKRVL
LVDADLRKPTVHYTFRLENHIGLSNVLTRQSSLQEAVQITSQEKLWILSSGPIPPNPSELLGSKGMQAMIEQAKDEYDVI
IFDSPPVLAVTDAQILSNLTDGVVLVVSSGKTEIDAAKKAKELLDNAKAKILGVVLNNKKVQDSQYYYYYGGK
>gnl|bykdb|A0A0M2PPJ5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. SA1-12] (length=233 residues).
MARKDKNKVFISQNRSLISLSNPKSPIAEQFRTIRTNIQFTSVDEELKTIIVTSAGPAEGKSTTTANLAVVFAQQGKKVL
MIDADLRKPTVHYTFNKENYIGLSNVLTKQETLVEAIQTTSQENLFVLTSGPIPPNPSELLGSKGMKSMLEEAKQEFDVI
ILDSPPVLAVTDAQVLSNVTDGVVLVTSAGKTEVDSAKKAKELLQSAKAKILGVVLNNKKAQDSQYYYYYGGK
>gnl|bykdb|A0A0M2PRY2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. SA1-12] (length=233 residues).
MARKKFGSQLRNLSRNLITMTNPKSPVSEQYRTIRTNIQYSTVDQKIKTLMVTSSNPMEGKSTTVANLAVVFAQQGKKVL
VIDADMRKPTVHYTFRVENIVGLINVLSKEASIDQAIQSTENENLFVLSCGPIPPNPAELLESEAMNDLLDSVKEHFDFV
IFDTPPILAVTDAQILANKCDGTVLVIHSGKTEIDLAQKAKDMLVDANGKYLGVVLNAKKQQLGQHYYYYGGK
>gnl|bykdb|A0A0M2SM41 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Salinicoccus sediminis] (length=238 residues).
MMRHRKMNNEVASAKKIIVATKPHSPVSEQFRTIRTNIMYSSIDRPIRSVLFTSAVAGAGKSTIAANVAIAYAQAGKKTL
LLDGDLRRPTCHYTFKVSNQKGLSTAIVNDIASEDLVNQTEFDNLYLITSGPIPPNPSELLSSKKLTQFIDHLKFQYEMI
IVDSPPLLSVTDAQLLSKSADGVIMITDVENNNRNHLLEAKDLLNKADANIIGLVLNNRDAKYRLKDDYYYHQASHDG
>gnl|bykdb|A0A0M2SQ00 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus campisalis] (length=229 residues).
MSRKTKRRQKNPVSLIAHTNPIAPITEQYRLIRNNIHYSSVDKIIKTVFVTSADPAEGKSTTAANLAIVMAQKGKKTILV
DADLRKPTVHYSFTVSNMEGLTSVLAKEISLEDTVLRTNVPNLDIITSGPIPPNPAELLDSKAMELLMGELKEMYEYIVI
DSPPILAVTDPQIMATKCDGVVLVVASGKTQKDRAVKAKELLERSGAKIIGVVVNGVEEKLEGYYGHYR
>gnl|bykdb|A0A0M2SXK2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus campisalis] (length=232 residues).
MALRKKQKPSIERRKLVTSFDPKSPVSEQYRTIRTNIEFSAVDEEIKTIMVTSAGPGEGKSTTSANLAVVFAQQEKRVLL
VDADLRKPTTHYTFNQTNTFGLTTVLAGQMALKDAVNTTNVDNLEVLTSGPIAPNPAELMGSKSMERFLNEAKESYDVVI
FDTPPILAVTDAQVLANKCDGTVLVLYSGRTEMEEASRAKELLQSAKGKLLGAVLNHKKLENSDYYYYYGKK
>gnl|bykdb|A0A0M2T0F1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus campisalis] (length=232 residues).
MVFSFRKKAAPSNKRKLIAVEDAKSPISEQYRTIRTNIQFTAVDESIKTIMISSAGPGEGKSTTAANLAVTFAQQEKRVL
LVDADLRKPTVHYTFNLANHYGLTSILTNGKALDEAISPTGIENLSVLTSGPIPPNPAELLGSKKMKQLLQQVKEEFDVV
IFDTPPALAVTDGQILANSCDGIVLVLYSGKTEVDQVTKAKNLLAAANGRILGVVLNHKKIQGSNYYYYYGS
>gnl|bykdb|A0A0M2U580 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridiales bacterium PH28_bin88] (length=231 residues).
MPRSLQQTIAYHEPKSPATEAYRTLRTNIQYASVDHPVNSLLITSAGPGEGKSLTAANLAVVMAQSGKETLLVDCDLRKP
MQHRLFGLRNNRGLTSLLVQGGDPGTVTQQTEVAHLNIITSGLIPPNPAELLGSQAMKPLVQELKSRYATVIIDGPPLIA
VTDAALLAPRVDGVLLVIRAGEARIDMVQEAKSIIENAGARVIGCVLNGVRRKSKDYHYYYYYAEKSGTDD
>gnl|bykdb|A0A0M2VKA5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. DMB20] (length=229 residues).
MLRSANKPKLIMQTNRRSRISEGYRNIRTNIQFSEWNGRRHVLAVTSTQAGEGKTTTISNLAVAYAHEGKRVLLIDADLR
NPSLQDIFQSSNKTGLSNLLANQCSHAEVVRKTEIDHLSLITAGPIPPNPTELLSSGKLREYLEIWKGSYDIILIDTSPV
MAVADGLIVSSMSDGVILVIQSGKVKREHILKSKERLGHVQAQIIGVVLNNKKINKAEARHYNYYGLRS
>gnl|bykdb|A0A0M2ZR22 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactococcus lactis subsp. cremoris] (length=231 residues).
MAKNKRSIDNNRYIITSVNPQSPISEQYRTIRTTIDFKMADQGIKSFLVTSSEAAAGKSTASANLAVAFAQQGKKVLLID
GDLRKPTVNITFKVQNRVGLTNILMHQSSIEDAIQGTRISENLTIITSGPIPPNPSELLASSAMKDLIDSVSDFFDVVLI
DTPPLSAVTDAQILSSYVGGVVLVVRAYKTKKESLAKTKKILEQVNANILGVVLHGVDSSDSPSYYYYGVE
>gnl|bykdb|A0A0M3DGN7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paraclostridium benzoelyticum] (length=248 residues).
MKIKVRKVVNKMINITTFNDPKSPIAESYRSIRTNIQFSKLDNEMKTIVITSSKQDEGKTTVSSNLAVSFASLEGKKVLL
IDADLRNPSVHKMFTKPNALGLTDVLAGKKELKQCVQNTELENLQILTAGTIPPNPGEMLESKKMREFIDVLRDYYDYIF
IDTPPIGIIMDAGVLANYADGTILVVGAKDVETERAKISKERLEKVKANVIGAVLNKYIEKNGSYGYYSYYYEQSDSSRV
SKKKKKKH
>gnl|bykdb|A0A0M3RB28 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus gobiensis] (length=221 residues).
MTKDNPRSIIAMFQPKSPIVEQFRTIRTNIEFSSMEDHIRSILVTSAHSSEGKSFIAANLAVVFAQQEKKVLLIDGDLRK
PTNHGLFQLDNSIGLTNVLMRQRTLENAVQASTVENLDLLTSGPTPPNPAELLSSRAMEDLLVQAYDRYSLVIFDSPPIL
AVADAQILANQTDGSILVIASSKTKNEDAKKAKDALEASKGKLLGALLNNKKMRKNELYVY
>gnl|bykdb|A0A0M3RB32 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus gobiensis] (length=213 residues).
MEPKSPSSEQYRTIRTNIEFSSVDKNVRSILITSSGPGEGKSTTAANLAVVFAQQGKRVLLIDSDLRKPTVQYTFQLDNT
DGLTTVLLKQMSLKTIVQKCMVDNLDILTSGPIPPNPAELLSSKSMGKLLEDAYKIYDIIIFDSPPVLAVTDAQILANHT
DGSLLVVSSGKTEKELAVKAKEVLSSTKSKLLGAVLNGKKLEQSSYYYYYGGK
>gnl|bykdb|A0A0M4CSE0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus plantarum] (length=226 residues).
MHTGIQLTTLTAPMSVVTEQVKTIRTNLNYAMVGKPLKTLMITSAIQGEGKSTVGSNLAVEYAKKGLQVLLVDADLRRPT
IHQTFAISNQRGVSSWLSGQLTDVNEAIYPVLDHLFVMPSGPKPPNPAELLASDRMTEFLTVATRKLDLVIVDAPPILPV
TDARILAGQVDGTVLVVRQNFVEKVAVRQAVSALKNARAQLLGTILNDVDIKTHGYGYGYYGTETN
>gnl|bykdb|A0A0M4FWC9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. FJAT-22090] (length=230 residues).
MFKKKNNRNQNKRKLVISTNPKSIVAEQFRTVRANIKFAMKGKEFKTLLFTSASVGEGKSTVAANVAISFAQEGLKVLLI
DADLRKPTLHYTFSILISPGFTNFLMSNWKLEDVIRESEIKGLHLITSGPIPSNPSELLGSDLIYDLWKKIKSRYDIVIF
DAPPILSVADAQILSEKCDATILVVDSGKTEKKNILKAKEVLEASKANTIGVILNNFILEKDHYYYEYYG
>gnl|bykdb|A0A0M4G5Y2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. FJAT-22090] (length=236 residues).
MFKKRSRNKKIQTAARKLITIENPKAVVSEQFRTVRTNINFSMPDKELKTLLITSSTPGEGKSTSAANMAIVFAQEGKKV
LLIDSDMRKPTMHHTFHITNTVGLSNLLTRKLTMQDVVVDTNIECLDLITSGPIPPNPAELIGSKTMDILMNELMEKYDL
IIFDAPPLLSVTDAQILSNKCDGTILVINSGTTEKSNVIKAKEALIASKAKILGTLLNNFVLDKDHYYYQYYGSVE
>gnl|bykdb|A0A0M4GAZ4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. FJAT-18017] (length=229 residues).
MAKKKLLQGKRKLITKLDPKSPISEQYRTLRTNIQFSSVDEEIKKIMVTSSGPGEGKSTTTANLAVVFAQQGKSVLLIDA
DLRKPTVHYSFNLTNTIGLTNVLSHQVNLEEAINETDVKGLYVVSSGPIPPNPSELLGSRMMDSFIKEAEGKFDIIMFDT
PPVLAVTDAQILSNKCDGTILVVSSENTEIEQAVKAKELLTTAQAKVLGVVLNNRKFEKNQQYYYYGVK
>gnl|bykdb|A0A0M4K1Z6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus gordonii] (length=231 residues).
MPVLELSNNKKQSIQKTEEYYNALRTNIQLSGEDIKIVAVTSVQPNEGKSTTSTNLAIAFARAGYTTLLIDADIRNSIMS
GVFKSKERITGLTDYLVGKNDLSQGLCETDVSNLFVIESGQSSPNPTALLQSKNFDEMMNILRRHYDYIIVDTPPIGLVI
DAAIISQKCDASLLVAEAGSVKRKALQKSKEQLEQTGTPFLGVVLNKYDVSGDRYGVYGAYGNYGAYGKKH
>gnl|bykdb|A0A0M6W8C0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus paracasei] (length=249 residues).
MNWSLKSILPNRKIDQETQKNGVLLVTFAEPKHVVSEQFRTVRTNIEFAGAALNKCQVIMFTSSAMSEGKSTVSANVAVT
WAQAGKKVLLIDADLRRPTIQATFRKLNLDGVTTVLTGKMKPDEVVSDTFVEGLSVVTSGPVPPNPSELLNSKKMIQLLD
WARDNFDIIVLDAPPVLAVSDVQVLVPKTDGVVVVANMGKTLKGDLQRTVEVLKLAKAKILGSVERVKTKRGDRGYGYGY
GYGYGNEKN
>gnl|bykdb|A0A0M6WRN5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Eubacterium] rectale] (length=241 residues).
METVVINQIKDQSYTMKESLRALKTSISFSGKGVKSILFTSSLPNEGKTTVVMDLARSMADSKKSVLVVDTDMRKSVLVG
RIRAKLESGGKIYGLSHYLSGQVSLDKVIYATNIKGVFILFAGHEVPNPTELLETEEFKELIEFGEKNFDYVLVDTPPTG
AAIDAAVVGKNVDGAVIVAAQNATSSRAIINTKRTLEDSGVKILGAVLNKCRFEESKYGHYYGNYYGNYYGNYYGRDDDE
N
>gnl|bykdb|A0A0M6WZD6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Roseburia faecis] (length=242 residues).
MKSVTFENLKKQNYTMKESLRALKTNIQFCGDDICTIVVTSAMPNEGKSTVTMDLARSFSESGKRVLLIDTDMRKSVYVG
RLRAVASDGREIYGLSHFLSGQRKLEDVLYGTTIPGLFMIFAGPSVPNPTEILEKKYFTELLNFAKEHFDYVLLDCAPIG
AAIDAAVIAKHCDGAILVIAQGMASGRLIQTVKKQMEASGVRVLGAVLNKVRMKKNGYEGGYYGGYYGSYYGNYGEHHEK
NA
>gnl|bykdb|A0A0M9BJV0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. A59] (length=227 residues).
MPRLTNDKGSLVTMANPKSTSSEAYRKLRTNIQFSSIDSQIQTIMIASALSGEGKTTTIGNLAVTYAQEGKKVLLMDTDL
RKPTVHRMFNVPNHVGLTSVLSSQYKVTEVLRETGVEGLHVLSSGPIPPNPSEMIGSRKMTALLEDLKEEYDVILFDTPP
VLAVTDALIISSLCDGVILVVSAGKVKKDLVKKAKAHLEHVNARILGAVLNNVQVPKSRNAYYGENA
>gnl|bykdb|A0A0M9DC63 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus kunkeei] (length=239 residues).
MGLFNKSPKKKLNDDSSKFGVNLVAELYPTSSVSEQFRTVMTNISFANINGELKSIMVTSSDPSEGKSTFSANLAVTYAK
QGRNVVLVDADMRRPTVHKSFNVSNQKGLSTILSGNSTIEDTIKYTSIDNLNVITSGPIPPNASALLGNRKIVDIINKFN
KPNDLVIVDVPPVNTMTDASIVSTTVDGTIFVLPQGVAEKKRAKMAVEQLKKVNANILGGVMNMSKDNITNDYYYYYSK
>gnl|bykdb|A0A0M9GTQ4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. CHD6a] (length=236 residues).
MALKKNKLINKAKATTSRHLISDKLPKSPISEQYRTIRTNIQFSSVDQQLRSIMVTSSGPSEGKSTTASNLAVVNAQQGK
KVLFVDADLRKPTAHYTFQQENFRGLTTILTRQTSLSETIQPTRIANLDILTSGPIPPNPAELLSSKAMEDLLAAVYHSY
DLVIFDTPPVLAVTDAQILANQCDGTVLVIASGATDKDSAIKAKELLNSAKAKLLGVVLNMKKLKESSYYYYYGVK
>gnl|bykdb|A0A0M9WUY5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lysinibacillus sp. FJAT-14222] (length=235 residues).
MFRTKKKRKLLTLARKLVTVYDSKSILSEQFRTIRTNITFSLCEQDEKTMLITSSIPGEGKSTNAANIGIVFAQEGKKVL
LVDADMRKPTIHHTFHLTNTVGLSSLLIRQKILETIIQTTSVEGLSVITSGPIPPNPAELLASKAMNEFFETVKKEFDIV
IFDAPPLLSVTDAQILANKCDGTLLIVNTGVVEKLNVIKAKSILINAQAKILGVVLNNYVFPRNHHSNQYYNSIE
>gnl|bykdb|A0A0M9X1L6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lysinibacillus contaminans] (length=221 residues).
MARKLVTVTDSKSLISEQFRTMRTNIRFSMPDQDIKSLLVTSSIAGEGKSTNAANLGVVFAQEGKRVLIIDADMRKPTLH
HTFRTLNSSGLSDVLTRQQIYFNVIQKTSVEGLSVIPSGPLPPNPVELLSSKTMDILMQDLRKDYDIVILDAPPLLSVSD
AQILSNKCDGTLLIVNMDVAQKVDVLKAKATLSSSKAKILGVVLNNIKIPKNHYYYQTYGS
>gnl|bykdb|A0A0N0UVK1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus kunkeei] (length=239 residues).
MGLFNKSPKKKLNDDSSKFGVNLVAELYPTSSVSEQFRTVMTNISFANINGNLKSLMVTSSDPSEGKSTFSANLAVTYAK
QGRNVVLVDADMRRPTVHKSFNVSNQKGLSTILSGNSTIEDTIKYTSIDNLNVITSGPIPPNASALLGNRKIVDIINKFN
KPNDLVIVDVPPVNTMTDASIVSTTVDGTIFVLPQGVAEKKRAKMAVEQLKKVNANILGGVMNMSKDNITNDYYYYYSK
>gnl|bykdb|A0A0N1CLC9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus sp. RIT-PI-f] (length=234 residues).
MAKKQERKATQTHAVSLITLVDPSSPIAEQYRTIRTNIQFASSADRRIQTIVITSSGPGEGKSTTSANLAVVFAKSGQRV
LLVDADMRKPTVYKTFNLSNASGLSTVLSTSTSVLEVAQKTVIDNLSVLTSGPKPPNPSELLGSTRMNQVMEEAKNLYDV
VIFDMPPVVAVTDAQIMASKADGTIVVVRENVSRKESLSKAKELLNMVQARVLGVVYNGAENSKDSSYYYYYGN
>gnl|bykdb|A0A0N1CRX6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus sp. RIT-PI-f] (length=228 residues).
MAKKNTNLSPVSLMTVANTNSVIAEQLRTIRSNINFSSVDKELQSMVITSSGAGEGKSTTSANLAVVFANSGKRVLLVDA
DLRKPTVALTFRLPNHRGLSTLIADREGQLEQHIQESGVENLSILTSGPIPPNPSELLQSQRMTDLIPELTRQFDLIIFD
MPPIGVVTDAQILASKTDGTLLVVRERKTTKQGLIKAKKLLTLANAHLIGVVYNGVKKGNADNYYYYA
>gnl|bykdb|A0A0N1IZI9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus kunkeei] (length=239 residues).
MGLFNKSPKKKLNDDSSKFGVNLVAELYPTSSVSEQFRTVMTNISFANINGNLKSIMVTSSDPSEGKSTFSANLAVTYAK
QGRNVVLVDADMRRPTVHKSFNVSNQKGLSTILSGNSTIEDAIKYTSIDNLNVITSGPIPPNASALLGNRKIIDIINKFN
KPNDLVIVDVPPVNTMTDASIVSTTVDGTIFVLPQGVAEKKRVKMAVEQLKKVNANILGGVMNMSKDNITNDYYYYYSK
>gnl|bykdb|A0A0N7CIR2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus fermentum 3872] (length=249 residues).
MGLFKHRYTESTDTMNNGAMLITLADPKSGPAEQFRTIRTNIHFMSVDRPLKTVAFTSSGISEGKSTVTANVAIAWAQEG
KRVLLIDADLRRSTLHATFGLSNQKGLTTVLTGDSNEVDLSNVVQKSGVENLEVLTAGPVPPNPSELLSSQRMQSLIDGV
REVYDLVVLDVPPMLQVTDTQVLSSNLDGVILVVRQGVTQKAAVRRAVEMLRISKTNILGYVMNDVYDADAGYGYGYGYG
YGYGYEDER
>gnl|bykdb|A0A0P0EME6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus gallinarum] (length=266 residues).
MSLFKKKRGTDETIKNGVKLITVADPKSPVTEQFRTIRTNINFMAVDHDIKSVAFTSANISEGKSTVAANVAVTYAQAGR
KVLLIDADLRRPTVHRTFNLSNHVGLSTVISSTAKEVDLDEVVQDSGIADLAILPAGPTPPNPSELIGSKRMQDFISLVE
DHYDMVIIDLAPVLEVSDTQELARRLDGIILVVRQGKTQKAAIKRAVEMLNFSKAKVLGFIMNDISPDNAGYGYGYGYGY
GYGYGYGYGYGEEDKKKKGFFSRLKK
>gnl|bykdb|A0A0P0NBB9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus anginosus] (length=231 residues).
MPSLELAKNKEKTIKKTEEYYNALRTNIQLSGDNIKVIAVTSVQSGEGKSTTSTNLAIAFARSGYNTLLIDADIRNSVMS
GIFKTRDKITGLTDYLAGATDLSNGLCETNIDNLFVIEAGQVSPNPTALLQSKNFGIMIDILRNHYDYIVVDTPPIGLVI
DAAIITQKCDASVLIVESGNVKRKTLQKAKEQLEQTGTPFLGVILNKYDIQLEKYGSYGNYGNYGNYGKKK
>gnl|bykdb|A0A0P1GKW9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus paracasei subsp. paracasei] (length=253 residues).
MRGKSMNFSLKEILPHHKVDQETQKNGVMLVTFAEPKHVVAEQFRTVRTNIEFAGAALDVCKVIMFTSSAMSEGKSTVSA
NVAVTWAQSGKKVLLIDADLRRPTVHATFRTLNLDGVTTVLTGKNTPEQVVETTFVDHLSIITSGPVPPNPSELLNSKRM
GKLLDWARNNFDIIVLDAPPVLAVSDVQVLVPKTDGVVVVANMGKTLKGDLERTVEVLKLANAKILGSVERVKAKHGDRG
YGYGYGYGYGNEK
>gnl|bykdb|A0A0P6WE77 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus vietnamensis] (length=224 residues).
MNTKRKLITKTDPMSPISEQYKTIRTNINFSFIDQELRSLMVTSSGPGEGKSTTSANLGVVFAQEGKRVLLVDADMRKPT
AHYTFGLNNTFGLTSVLTRQKSLTEVTHSSDVKNLDLLTCGPIPPNPAELLNSKRMEHFFKEVHEEYDMVIFDTPPVLAV
TDGQILANQCQGTILVISSGTTEVDRAVKSKELLEAAKAKLVGVVLNNREMKDSNYYYYYGGNK
>gnl|bykdb|A0A0P7GBK1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus australimaris] (length=227 residues).
MIFKRKKREKRDLSCISVLNPHSVIAEQFRTIRTNIEFTSIQTRLKSILVTSSLPKEGKSFTAANLAAVFAQQKKRVLLV
DADLRKPAVHEYFDLSYHTGLTNVLLNNCSLEEAILPTPIEHLELLPSGTIPPNPAELLSSSVMKQLFYEIEQQYDMVIV
DSSPLLPVADAKILANRTDGSILVVLSGKTKIAAVKKSKEVLDGTTGKLLGAMLNGKKEKKGRLYMY
>gnl|bykdb|A0A0P7IYH4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus kunkeei] (length=239 residues).
MGLFNKSPKKKLNDDSSKFGVNLVAELYPTSSVSEQFRTVMTNISFANINGELKSIMVTSSDPSEGKSTFSANLAVTYAK
QGRNVVLVDADMRRPTVHKSFNISNQKGLSTILSGNSTIEDTIKYTSIDNLNVITSGPIPPNASALLGNRKIVDIINKFN
KPNDLVIVDVPPVNTMTDASIVSTTVDGTIFVLPQGVAEKKRAKMAVEQLKKVNANILGGVMNMSKDNITNDYYYYYSK
>gnl|bykdb|A0A0P7JZF1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus kunkeei] (length=239 residues).
MGLFNKSPKKKLNDDSSKFGVNLVAELYPTSSVAEQFRTVMTNISFANIKGELKSLMVTSSDPSEGKSTFSANLAVTYAK
QGRNVVLVDADMRRPTVHKSFNVSNQKGLSTILSGNSTIEDTIKYTSIDNLNVITSGPIPPNASALLGNRKIIDIINKFN
KPNDLVIVDVPPVNTMTDASIVSTTVDGTIFVLPQGVAEKKRAKMAVDQLKKVNANILGGVMNMSKDNVTNDYYYYYSK
>gnl|bykdb|A0A0P7K1M7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus kunkeei] (length=239 residues).
MGLFNKSPKKKLNDDSSKFGVNLVAELYPTSSVSEQFRTVMTNISFANINGELKSIMVTSSDPSEGKSTFSANLAVTYAK
QGRNVVLVDADMRRPTVHKSFNVSNQKGLSTILSGNSTIEDTIKYTSIDNLNVITSGPIPPNASALLGNRKIIDIINKFN
KPNDLVIVDVPPVNTMTDASIVSTTVDGTIFVLPQGVAEKKRAKMAVEQLKKVNANILGGVMNMSKDNITNDYYYYYSK
>gnl|bykdb|A0A0P7KDU3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lysinibacillus sp. ZYM-1] (length=232 residues).
MLFKRKTKKSPMARKLITVSDMMSIPSEQYRTIRANIKFSQPNQDVKTILVTSSIAGEGKSTNAANIGVVFSQEGKRVLI
IDADMRKPTLHHTFYLDNIFGLSSVLSRQSTIEDVIQETFVEGVDIISSGPIPPNPTELLASETLTALLVEVKVRYDMII
IDAPPLLFLSDAQILSNKCDGTLLIVNTGTVGKAAVVKSKSILTISKANILGVILNNFKINGSTYEQYYGKE
>gnl|bykdb|A0A0P8UZR7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Caloranaerobacter sp. TR13] (length=248 residues).
MDQIRLVTQENPKSPVAEAFRTLRTNIQFSNVDKELKSILITSPGPGEGKSTTIVNLAVTMAQNDKRVLLIDCDLRKPRI
HKNFGISNSKGLTTILSENIDYKEILHSIGIGLQLDVLTSGPIPPNPSELLGTKKMKAFLEKVEADYDIVLIDSPPVGMV
TDAAVLSTITDGVILVCAAGQSIIEGAKNAKALLQKVKANILGVVLTKVPIGDGKYYKYHYYSYYYDYFNDENNEEKGRR
RKKAEANA
>gnl|bykdb|A0A0P8X4L7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A0P9C2V3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Alicyclobacillus ferrooxydans] (length=225 residues).
MPVKTSRAWPISQTHPESSYAESYRSILTNIELLSINVKSIMVTSAHPGEGKTSTAANLAIVATQASKRVLLVDTDLRHP
QLAQRFGVANEEGLTKVLRQGCDAQDVIVPTEIPGLHVLPSGAVGLNSPSLLSSLAFTSLVNRLKSKYDLVVFDAPPVLP
VSDPLVLSRNVDGIVFVVDGRTTNRLVAQRALKELHKVNGTIIGGILNRGSFENDHSYYYGSSDI
>gnl|bykdb|A0A0P9DM48 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. A3] (length=226 residues).
MSRSDKRRPVIAHSHPKSPISESYRTLRTNIQFSSVDRLYRTLMVTSSSPMEGKSTTINNLAVVYAQSNKKVLLIDADLR
KPTAHHTFHLSNRYGLTDMLTSQCTLDMAVKETDIPNLEVMTSGSIPPNPSEILASQKMTGLLEELKRQYDIVLLDTPPV
LAVTDSQIIAAKCDGVILVIDSGKIKRDMAQKAKNSLELVQANLLGVVLNRISRPSGNAYYYYGNE
>gnl|bykdb|A0A0Q0TXL5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium butyricum] (length=241 residues).
MFFKSKLEKAVDNQKHMGFVMERKPKSVVSEAYRTLRTNIQYSSFDKKIQTIVVTSAEAAEGKSTVSGNLALAFAQNEKR
VIIVDCDLRKPSVHKNFKVSNLCGLSEVLIGKSELNNVIQNRNEHLDILTSGKIPPNPSEMLSSSAMTKLIETLKEEYDV
IILDSAPLGAVTDAQILSTKVDGTILVTRAERTKREIVLEAKNSLEKVGANILGCVLHAVENTKGKYYYYYGTDGEHKKK
N
>gnl|bykdb|A0A0Q0UQV5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Geobacillus sp. PA-3] (length=232 residues).
MAAKKRKKFQKAERNLITFDDPKSPISEQYRTIRTNIQFSFIDEPLRSLMVTSSAPSEGKSTTAANLAVVFAQQGKKTLL
VDADLRKPTVHYTFRLNNYAGLTSVLTNASPLSSALQDTSVENLTVLTAGPIPPNPAELLSSKMMDRLLRELNEMYDLVI
FDTPPVLAVTDAQILANKCDCTVLVVSSGNTETDAAVKAKELLEAANAKLVGVVLNQRKQREGSGYYQYQYK
>gnl|bykdb|A0A0Q0YJS7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Leuconostoc lactis] (length=254 residues).
MVFFKKKYKTGRDGLSVETMMEGARLIAAAEPKNPVSEQFRTIRTNIDFAAVAKGNVKTLLVSSALPSEGKSNVTANLAV
VYAQQGKRVLLVDTDLRRPTVARTFGVTDNHGLTNYLADVNSDMGSIVRHTRMSTLDVVASGPVPPNPAELLASSRMTNL
ITELRQQYDLIIFDVPPFLMVTDAQVLMSKVDGVAIVVSGRHTTKGALQRTTDMLKLADAPMLGFIYNDRSRKKTSGSGY
GYGYGYGYGYGETK
>gnl|bykdb|A0A0Q0YMB6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium butyricum] (length=215 residues).
MLIVESRPKSAEAEAYKTLRTNVQYSSISKKIKTLLVTSADSKDGKSTVCSNLGVTFSQNGQSVIILDCDFRKPSIHKFF
NISNSAGITDILLGEEKLEETIQHYNSNTDILTAGNIPPNPSEILGSQSMINLLSFLSERYDIVIIDSPPVGVVTDAQII
SASVDGTLVVIRAEETKAKRVTEAVNLLKKVDANIIGMVLNEAQTINKSYSDYYA
>gnl|bykdb|A0A0Q1DTL1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Geobacillus sp. Sah69] (length=232 residues).
MARKPAASIRKAERKLITFDNPKSPIAEQYRTIRTNIQFSFIDAPLRSLIVTSTRSGEGKTTTAANLAVVFAQQGKKTLL
VDADLRKPTVHYTFRLNNYMGLTNVLTGSAPLLPTCQATEIDHLSVLTSGPIPPNPAELLSSKAMAQCLEQLYETFDLVV
FDTPPVLAVTDAQILANQCDGTVLVIESGGTEIEAAVKAKELLEAANAKLLGVVLNKRKHRDGGYYYYYQYK
>gnl|bykdb|A0A0Q3VZ53 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Psychrobacillus sp. FJAT-21963] (length=232 residues).
MFKKKKRIPTVRKLVTITDPKSIVSEQFRTLRANIKFAMKGEEMGTLLFTSASVGEGKSTVAANVAISFAQEGKKVLLVD
ADLRKPTVHYTFNTLISPGLTNRLMSHWKFENIVKNSGIVGLNIVTCGPIPSNPAELLGSTSMDIFIEEMKSKYDIVIFD
APPVLSVADAQILSNKCDGTILVISSGATDKRNVVKAKEALQASNANIIGTILNNFKLDKSHYYYEYYGEVE
>gnl|bykdb|A0A0Q3W8A8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. FJAT-25509] (length=231 residues).
MVRKMAKESLKRFLITLTNPKSPFAEQYRTVRTNIQFSSIDKKIKSILVTSSEPSEGKTTTIANLAVTYAQQEKKVLLVD
ADLRKPQLHSDFKLENFKGLTTAIAQEKSLKDVIQKTDISNLSILTSGPIPPNPSELLSSEKMKKLIAQMYEQYDVILFD
APPLLAVTDAQIISQVCDGTILVVRRGYTAKEKIKKAKELLTLVNANILGVVLNRAEQDKDGYYDYYGSEK
>gnl|bykdb|A0A0Q3WCR5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. FJAT-21955] (length=227 residues).
MIFKRKKREKRDLSCISVLNPHSVIAEQFRTIRTNIEFTSIQTRLKSILVTSSLPKEGKSFTAANLAAVFAQQKKRVLLM
DADLRKPAIHEYFDLSPHTGLTNVLLNNCSLEEAILPTPIEHLELLPSGTIPPNPAELLSSSVMKQLFYEIEQQYDMVIV
DSTPLLPVADAKILANRTDGSILVVLSGKTKIAAVKKSKEVLEGTTGKLLGAMLNGKKVKKGRHYMY
>gnl|bykdb|A0A0Q3WXV3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus shackletonii] (length=233 residues).
MRQLLRKHKNIVKDEIKLITYYQPQSYITEQYRLLKNNIQFSSVDKEIKTIVVTSPEPADGKTTTSANLSIVLAQQGKRV
ILVDSDLRKPSVHYSFNISNLHGLTNVLTREISLENAILKTHIHNLEVLTSGPIPPNPSELLESKAMELLIYQLHSGFDY
VVFDTPPILAVSDSQILANKCDGVIMVVSSGKTRKDAALKSKNILLQANARLIGVVMNGIEQKRREDYYQYGP
>gnl|bykdb|A0A0Q4QG39 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. Leaf72] (length=230 residues).
MRRLTSETNLVALTNPNSPISEVYRTLRTNIQYAEIDTPKQILMIASSQPDEGKTTTITNLAVTIAQEERKVLLVDADMR
KPSLHQVFDKPNRIGLSSAISNQFSWQEAVMDTMVEHLSVITSGPIPPNPSEMLGSNRMKALVQEWKEHYDVILFDTPPV
LAVTDALIVSAFCDGVVLVVLAGKVKKEMVKKMKANLDRVQAQIVGVVMNKINPKDSEDIQLQYYETAKS
>gnl|bykdb|A0A0Q4RJY1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. Leaf72] (length=225 residues).
MSRTKPNWPLITETNPKSPISEAYRILRTNIDFSNLEEEIRTLMVTSTKMNEGKSTTSANIAVTYAQSNKRVLLIDADMR
KPTQHQLFRVSNQIGLTSVLSNQKEWETAIQATSVSGLSILPAGPVPPNPSEMLASKRMDQLLEKMKEHYDIIIVDTPPI
MVVTDAQIVASKSDGVVLVIDSGTVKKEVAIKAKASLEHVKARILGVVLNKIKRSSSEGYLYYYQ
>gnl|bykdb|A0A0Q6HRT0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. Leaf13] (length=227 residues).
MGFLRSKDEKQVNLIAQTNPKSPITERYRIIRTNIQFSSVDKEIKTIVVTSAEPNDGKSTTAANLAIVLAQEEKKVLLVD
ADLRKPSIHYAFNLSNIHGLTSVLTKKMDLRKTILNSNVPNLDILTSGPIPPNPSELLNSKAMETAINELKDIYDFIIFD
TPPVLLVTDSQIVANKCDGVIMVVASGKTNKQSAVKAKELLEKANTALLGVVLNGMESNTSNYYYQS
>gnl|bykdb|A0A0Q6I7X8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. Leaf75] (length=224 residues).
MLTLKRRLLSHNSPKDPVAEQYRTIRTNIQFSGADEEIKSLVLTSSGPSEGKSTTAANLATVYAQQGLNVLLIDGDLRKP
TAHYTFRLENHTGLTNVLTRQSSLGQAVQQTEVPNLYVLTSGPIPPNPSELLASKQMGEVLAEMKERFDMVIFDTPPILA
VADAQILANQVDASLLIVSSSKTEKDAALKAKELLTQAKSKLLGAVLNNRKMEEGNYYYYYGSN
>gnl|bykdb|A0A0Q7T431 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. Root52] (length=226 residues).
MSRLTNENNNLVTYFNSKSHISEGYRKLRTNIQFSSIDSHIKTIMVASAQAGEGKTTTISNLAVTYAQEGKKVLLIDADL
RNPSLHQVFSVPNHIGLSSVLSNQYDVDEVLRESYIENLQLFTSGPIPPNPSEMIGSNRMKNLMNDLQSKYDVIMFDTPP
VLAVTDALIVSSFCDGVLLVVNSGKVKKELVKKTKAHLEHVNARILGAILNNIKTTSNSVSYYGEK
>gnl|bykdb|A0A0Q9FWB0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. Root147] (length=224 residues).
MLTLKRRLLAHNSPKDPVAEQYRTIRTNIQFSGADEEIKSLVLTSSGPSEGKSTTAANLAAVYAQQGLNVLLIDGDLRKP
TAHYTFRLENHTGLTNVLTKQSQLGQAVQSTEVPNLYVLTSGPIPPNPSELLASKQMGEVLAEMKERFDMVIFDTPPILA
VADAQILANQVDASLLIVSSAKTEKDAALKAKELLTQAKSKLLGAVLNNRKMEEGNYYYYYGSN
>gnl|bykdb|A0A0Q9G4W6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. Root131] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A0Q9I016 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. Root239] (length=236 residues).
MARKNKAQKNDKMLTLKRRLLAHNSPKDPVAEQYRTIRTNIQFSNVDQDIKTIVVTSSGAEEGKSTTTSNLATVYAQQGL
KVLLIDADLRKPTGHYTFRLENHIGLTNVLTRQSTLAQAVQESEIPHLSVLTSGPIPPNPSELLASAQMAELLKEMKEQF
DMIIFDTPPILAVADAQILANQVDGTILVVSSGKTEKDAALKSKELLSNAQGKLLGVVLNNRKVEEGNYYYYYGSN
>gnl|bykdb|A0A0Q9LEW6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. Soil522] (length=230 residues).
MSQSKNKRQMITVTNPRSPISESYRALRTNIEFSSIDETLQVLMVSSAGPGEGKSTTITNLAITFAQSEKKVILIDADLR
KPTAHHTFSLSNRWGLSSVISQQSKLEEVIQASDIPNLDVMTSGAIPPNPAEMMGSKKMTSLLEQLRQMYDIILIDTPPL
LAVTDAQIVATKSDGVILVVDQGKVKRDIASKAVKSLESVKARILGVVLNNVKRKANEEVYYYYYGVQEK
>gnl|bykdb|A0A0Q9LUB9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. Soil750] (length=229 residues).
MSNSTNKRPIITHQNPKSPISEAYRALRTNIQFSSIDEELRVIMVTSAGPGEGKSTTLINLAVAYAQTDKKVLIIDGDLR
KPTMHHTLRVSNRWGLTNLLTNQLTIREVLQDTFIPNLQIITSGPIPPNPSEILASKKMISTIDELKQSFDVILIDAPPA
IAVTDSQIIASRTDGVILVVNSDRTKREAVLKAKQNLDNVRARILGVVLNNVDRKNKDAYYYYYYGESQ
>gnl|bykdb|A0A0Q9NB04 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. Soil750] (length=229 residues).
MRTLINRHQLITELHPKSHVSESYRTLRTNIQFSSIDRIMKTILVTSAQPGEGKSTTAANLSVAYAQEGKKVLIVDADLR
KPTIHHYFGVSNRYGLTSAIVNRTQFDEFISETSIENLSLITSGPIPPNPSELLMSQKMTAFLEEMTARFDVIIIDSPPT
LAVADAQILATKCDGVVMVISDGKVKRDMARKAIHNLERVQAKILGVVLNNKRHRKSDAAYYYYYGDKE
>gnl|bykdb|A0A0Q9NZ66 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. Soil766] (length=229 residues).
MLNSVNKRPIITHQNPKSPISEAYRTLRTNIQFSSIDEELRVIMVTSAGPGEGKSTTLINLAVAYAQTDKKVLVIDGDLR
KPTMHHALQVSNRLGLTNLLTNQLTITDVLQVSSVPNLQIITSGPIPPNPSEILSSKKMLSVLDELKQQFDIILIDAPPA
IAVTDAQIIATRSDGVILVVNSDKTKRDVVLKAKQNLENVRARILGVVLNNVDRKNKDAYYYYYYGESQ
>gnl|bykdb|A0A0Q9Q2L5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. Soil766] (length=229 residues).
MRTLINKHQLITETHPKSQVSEAYRTLRTNIQFSSIDRIMKTILITSAQPGEGKSTTAANLSVAYAQEGKKVLIVDADLR
KPTIHHYFGKSNRYGLTSALVNRTQFDEFISETSIENLSLITSGPIPPNPSELLMSQKMTAFLEEMAARFDVIIIDSPPT
LAVADAQILATKCDGVVMVISDGKVKRDMARKAIHNLERVQAKILGVVLNNKRQKKSDAAYYYYYGHTE
>gnl|bykdb|A0A0Q9S9G4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. Soil787] (length=229 residues).
MFRSDKRRPVITMINPKSPISEGYRTLRTNIQFSSVDKHYQTLMITSSEPMEGKSTTINNLAVVYAQMNKKVLLIDADLR
KPTAHHTFQVSNRHGLTDLITNQCSLEMAIKETDIPNLYILTAGSIPPNPSEILASQKMSGQLDELKELFDFILIDTPPV
LAVSDAQIIATKCDGVILVVDAGKVKRELVQKAKSSLEFVKAHILGVVLNKISQKEIANSYSYYGGEVE
>gnl|bykdb|A0A0Q9T8B9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. Soil787] (length=229 residues).
MPVPTNKHQLITEINPRSHISEAYRTLRTNIQFSSIDQVIKTILVTSAQPAEGKSTTVANLAVAYAQEGKKVLVIDADLR
KPTMHHYFGKSNRKGLTNTLASQNDVDDVMFDTTVDNLFLIPSGPIPPNPSELLTSQKMTAFLEDMAARFDVIVVDSPPT
LAVTDSQILAAKCDGVVLVINEGKVKRDVAKKAIDNLKRVQAKILGVVLNNKRHSKGDSTYYYYYGHKE
>gnl|bykdb|A0A0Q9UMF3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. Soil531] (length=236 residues).
MARKNKAQKNDKMLTLKRRLLAHNSPKDPVAEQYRTIRTNIQFSNVDQDIKTIVVTSSGAEEGKSTTTSNLATVYAQQGL
KVLLIDADLRKPTGHYTFRLENHIGLTNVLTRQSTLAQAVQESEIPHLSVLTSGPIPPNPSELLASAQMAELLKEMREQF
DMIIFDTPPILAVADAQILANQVDGTILVVSSGKTEKDAALKSKELLSNAQGKLLGVVLNNHKVEEDNYYYYYGTN
>gnl|bykdb|A0A0Q9VKT2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. Soil768D1] (length=225 residues).
MRRKDEKQVNLIAQTNPKSPITEQYRLIRTNIQFSSVDKEIKTIVVTSAEPNDGKSTTAANLAIVLAQEEKKVLLVDADL
RKPSIHYAFNLSNIHGITSVLTKKMDLRKTISNSNVPNLDILTSGPIPPNPSELLNSKAIETAINELKGIYDYIIFDTPP
VLIVTDSQIVANKCDGVIMVVASGKTNKQSAVKAKQLLEKANTALLGVVLNGMESNTSNYYYYQS
>gnl|bykdb|A0A0Q9Y407 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Virgibacillus soli] (length=231 residues).
MAKQNLKPQSGKRKLVAKANPKSPISEQYRTIRTNIEFSAVDEEIRTLMVTSSGPAEGKSTTTANLAVVFAQQGKKVLIV
DADMRKPTVHYTFGVTNTIGLTNVLTRQATLEDAARSTDVENLNVLSSGPIPPNPAELLGSKGMQLFFEKAKELYDMVIF
DTPPVLAVTDAQILANKCDGTVLVVASGKTELESAQKTKELLSAAQAKLLGVVLNNKKMEKTDYYYYYGTN
>gnl|bykdb|A0A0R1EM05 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus zeae DSM 20178 = KCTC 3804] (length=249 residues).
MMNWLFKFGFKRKQEDQESQKNGVMLVTYAEPKHVVSEQYRTVRTNIEFAGAALDKCQVVMFTSSTMFEGKSTVSANVAV
TWAQAGKKVLLIDADLRRPTVHATFRKLNLDGVTTVLTGKSKPSEVVEETFVDNLSIIPSGPIPPNPSELLNSKRMSDLL
DWTRENFDIVVLDAPPVLAVSDVQVLVPKTDGVVIVTKIGQTQKSDLRRTVEVLKLAKAKILGSVERVKSRHGDKGYGYG
YGYGYQSNA
>gnl|bykdb|A0A0R1FC80 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus coryniformis subsp. coryniformis KCTC 3167 = DSM 20001] (length=247 residues).
MALFKKKKQLDSSSMKNGVGLITVTKPTSSIAEQFRTIRTNVQFSSADRQLKTLLFTSADPSEGKSTISANVAVTWADQG
NKVLLIDSDLRRPAVARSFRVSNSQGLTTILTAKQANLSESIHETEVPNLYVLPSGPVPPNPSELLNSSKMDQLLKVLKE
QFDIIILDVPPVNKVTDAQILASKVDGVILVVPQGIALKGAVLRARDLLKKVNANLIGAVLNRVTDAASGGYYGGYYGGY
YGTDDKK
>gnl|bykdb|A0A0R1FCH0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus delbrueckii subsp. delbrueckii DSM 20074 = JCM 1012] (length=246 residues).
MKNGVKLITLANPQSVISEQFRNIRTNINFMNVDKEVKTIAFTSDMASTGKSTVSANVAVTMAQAGKKTILIDADLRRPT
LHPTFNVSNSNGLTTLLTSRGKEMDASSVIRESGVENLSILTAGPIPPNPSELLSSKHMLDLIEVLKQEYDMVVIDLAPI
LDAGETQQLTSSLDGTILVVRQAHSQKLAVKRAVELLKLTNSTILGYVMNDVDADGDGGYGYGYGYGYGYGYGEEKEKKG
LFGRKK
>gnl|bykdb|A0A0R1FKW8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus kunkeei DSM 12361 = ATCC 700308] (length=239 residues).
MGLFNKSPKKKLNDDSSKFGVNLVAELYPTSSVSEQFRTVMTNISFANINGDLKSIMVTSSDPSEGKSTFSANLAVTYAK
QGRNVVLVDADMRRPTVHKSFNISNQKGLSTILSGNSTIEDTIKYTSIDNLNVITSGPIPPNASALLGNRKIVDIINKFN
KPNDLVIVDVPPVNTMTDASIVSTTVDGTIFVLPQGVTEKKRAKMAVEQLKKVNANILGAVMNMSKDNMTNDYYYYYSK
>gnl|bykdb|A0A0R1GF52 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus bifermentans DSM 20003] (length=233 residues).
MQHGVSLITVNDPTSVVSEQFRTIRTNIQFSAVASKLKTLLVTSAGPSEGKSTVSANLAATWTAQNTNVLIVDADLRRPT
VHRTFGLSNNQGLTTLLTNPEVKLDQVIMQTAVNHLYALPSGPIPPNPAELLGSERMDKLMQILKNSFDLVLFDVPPVIS
VTDAQIMANKVDGVILVTPQGLAEKGAVMKSKELLEAVHANILGVIMNRVHAEGTGGYYGGYYGGYYGTDDKK
>gnl|bykdb|A0A0R1GM06 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus parabrevis ATCC 53295] (length=223 residues).
MIAEQFKTIRTNIQFSSVDKQLQSILFTSSEPSEGKSTISNNMAVTWADQGTKVVLVDADLRRPAVHRSFDVSNRMGLTN
YLSGNADLSAVVRETMVKDLSVITSGPVPPNPAELLGSKRIENLLSELTAEFDLVIVDAPPVNTVTDAQLLASRIDGTVL
VVPQGIADKNGVRRAKQLLETVHANILGTVMNRVTAQKSVGYYGGNYYGGSYYGGYYGTDDKK
>gnl|bykdb|A0A0R1GPK6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus crispatus DSM 20584 = JCM 1185] (length=261 residues).
MSLFRKKRGTDDTIKHGAQLITVADPRSAVAEQFRTIRTNINFMAVDEEINTLAFTSANISEGKSTVTANVAITYAQAGR
KTLLIDADLRRPTLHSTFNVKNNTGLTTVLTSEADEINLNDVVEESGIENLSILTSGPIPPNPAELIGSRRMETFIELVK
SHYDMVIVDLAPVLEVSDTQELASHLDGVVLVVRQGVTQKAGITRAVQMLKFAKARILGYVMNDIRAENGGYGYGYGYGY
GYGYGAEKKKGLFGRKKSDDQ
>gnl|bykdb|A0A0R1GXK7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus amylotrophicus DSM 20534] (length=242 residues).
MAIFKKKSNGLQPVAAANLFTLNNPSAVATEQIKTIRTNISFSQEAQNLQTIMITSTVASEGKSTIAANLAVEFAHAGKN
TLLIDTDLRRSTVDRTFGMHGTTKGLTSYLVHRFEELTDVIHETEVENLSVIPSGPIPPNPAELIASQGMKDVLTQLKES
FDLVIVDAPPLLPVTDGQIMSNMVDGVVLVVRQNHTLKAGVKEAKQTLENAKANILGVVFNDVESSNDSGYYGEGHYDNN
EQ
>gnl|bykdb|A0A0R1H6K0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus amylovorus DSM 20531] (length=260 residues).
MPLFKKKRGTDETIKNGAKLITVAKPKSPVAEQFRTVRTNINFMAVDHDIKSLAFTSANISEGKSTVAANVAVTYAQAGR
KVLLVDADLRRPTVHSTFNLSNHVGLSTVISSTAKEVDLDSVAQESGVDNLYVLTAGPMPPNPAELIGSKRMRDFVKLTE
ERYDLVIIDLAPVLEVSDTQELASHLDGVVLVVRQGKTQKMAIKRAVEMLEFAKARILGYVMNDVSSDNAGYGYGYGYGY
GYGYGEEDTKKKGLFSKFRK
>gnl|bykdb|A0A0R1HGX3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus algidus DSM 15638] (length=246 residues).
MGVIKMSLFKKDKKLSTDSIDNGVGLITVTQPTSTIAEQFRTVRTNIQFSSIDKEMKVIMATSSGPSAGKSTVITNLAVT
YANQGLKVLLIDADMRRPTAHQTFGLSNETGLTNCLTEKDIDIAKAVEETPIENLYVMPAGPTPPNPSELLNTKRMDAIL
MAVAEQMDMVIIDTPPLISVTDAQIVATKVDGTILVVREGVAKKGAVLKAKELLDTVHARIIGTILNDVSGSDESGYYGG
YYGYYK
>gnl|bykdb|A0A0R1IBH5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus paralimentarius DSM 13961 = JCM 10707] (length=247 residues).
MALFKKKTTKLDNYSLKNGVGLVTYDDPTSTISEQFNTIRTNIQFSSVDKKLNSILFTSSASSEGKSTVSNNVAVTWAKQ
GETVVLVDADLRRPTIHKTFNVSNRVGLSSYLLGNASFEDVVQPTMVKNLFVITSGPIPPNPSELLGSMRNKDLINRLED
KFGLLIMDAPPANSVTDAQVLATQVDGVVMVVPQGIAEKAGVAHAKQLLDTVHANILGVIMNRVTKEKSQGYYGGYYSGY
YGAEKEK
>gnl|bykdb|A0A0R1J163 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus tucceti DSM 20183] (length=247 residues).
MPLFKSKTKKLDKYSLKHGVGLITYDDPTSATSEQFNTIRINIQFSSVDKKLKSILFTSSAPSEGKSTVSNNVAVTWANQ
GEKVILMDADLRRPTVHKIFNVSNRVGLSSYLLGNASFEEIIQPTMVNNLFVITSGPIPPNPSELLGSMRTKDLLTRLED
KSDLLILDAPPANSVTDAQVLAAQVDGVIMVVPQGIAEKAGVAHAKQALETVHANILGVIMNRVTKEKYSGYYGGYYGGY
YGAEKKK
>gnl|bykdb|A0A0R1J1W2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus farciminis KCTC 3681 = DSM 20184] (length=251 residues).
MKMKLFKGKRKKLDNYSLKHGVGLISYDDPTSTVSEQFKTIRTNIQFSSVDKKLKSILFTSSAPSEGKSTVSNNVAVTWA
KQGDKVILIDADLRRPTMHKTFNLSNKFGLSNYLLGNAELEDVVQKTMVDNLYVITSGPIPPNPSELLGSMRTKDLLVRL
ADKFDLLILDAPPANSVTDAQVLATKVDGVILVIPQGIAEKSGVAHAQQALETVHANILGFVMNRVIRESTGYYGGYYGG
HYGGYYGADKK
>gnl|bykdb|A0A0R1JGZ6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus sakei subsp. sakei DSM 20017 = JCM 1157] (length=247 residues).
MGLFKKEKSLDQASMKEGVGLITLTEPTSVIAEQFRTVRTNIQFSSIDQKLRSVVFTSAGPLQGKSTVSANVAVTWADQG
VNVLLVDADMRRPTVHQTFQVPNKKGLTSLLTGDKFDFNTTIQKTPVDHLFVLPCGVVPPNPSELLNTKKMDKLIQELTK
HFDLVIFDVPPVVSVTDAQILASKVDGTILVVPQGIVEKGSVAKAKELLEVVHARILGTIMNRVKAENTGGYYGGYYGGY
YGAEEIK
>gnl|bykdb|A0A0R1JNI6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus namurensis DSM 19117] (length=251 residues).
MAWFKRKPKKLDNNGLKYGVGLVTYDDPSGMVSEQFKTIRTNIQFSSVGEELHSIMFTSSEPSEGKSTVSNNVAVTYADQ
GTKVILMDADLRRPTVHKTFGVSNRFGLSGYLAGNASLDEIIQPTMVDGLSVISSGPVPPNPSELLTSSKMATLLNDLKA
KADLLIVDAPPVNTVTDAQLLGARVDGTILVVPQGIAVKAGVRRAKQSLETVHANILGAIMNRVTAQKSGGYYGGYYGGN
YGGYYGTEDKK
>gnl|bykdb|A0A0R1K5Z6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus nodensis DSM 19682 = JCM 14932 = NBRC 107160] (length=254 residues).
MAFNIFSHKKHKIDNTSLKYGIGLVTYTDPKGMISEQFKTVRTNIQFSSVDKKLKSLLFTSSDPSEGKSTISNNMAVTWA
DQGSKVILVDADLRRPTVHKTFSVSNRKGLSNYLLGNATLEEIVQETVVDGLYVITSGPVPPNPAELLGSMRTQDLLVRL
MDKFDLLILDAPPVNTVTDAQVLAARVDGTILVVPQGIADKAGVLHAKEALKTVNANILGAIMNRVTEQKSGGYYGGSYY
GGYYGGYYGADKHK
>gnl|bykdb|A0A0R1K612 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus nodensis DSM 19682 = JCM 14932 = NBRC 107160] (length=241 residues).
MMFGMKKNKLDSTSQKHGVNLITYNHPQDVVAEQFRTIRTNIQFTAVDKKIKSIVFTSSEPSEGKSTVSNNFAVTCANQG
SKVVLIDADLRRPTIHKTFGLDNKVGLSNYLLGNAKLDEILQPALVRNLYIIPSGPIPPNPSELLGSVRVKDLIKELESK
FDMLVLDAPPVNTVTDTQVLATVVDGVVMVVPQGIAMKAGVRHARESLELVHAHIIGAILNRVTVQKSVYYGGEYYGAEK
K
>gnl|bykdb|A0A0R1KG57 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus paralimentarius DSM 19674] (length=246 residues).
MLNFKNKHKKLDNYSLHHGVGLVASDDPNGIISEQFKTIRTNIQFSSVDKPLKSILFTSSEPSEGKSTVSSNIAVTWAQQ
NEKVLLIDADLRRPTVHQTFNVDNKKGLSNYLLGNATFEEIIQPTDFHNLYVITSGPIPPNPSELLGSNKIKQLFTRLSE
SFGLLILDAPPINTVTDAQVLANLVDGVILVVPQGIANKAAVAHAKQALLMVHAHILGAVMNRVIRDQHYGYYGSYYGLE
KYQRKS
>gnl|bykdb|A0A0R1KN07 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus paralimentarius DSM 19674] (length=251 residues).
MALFKKKTTKLDNYSLKNGVGLVTYDDPTSTISEQFNTIRTNIQFSSVDKKLNSILFTSSAPSEGKSTVSNNVAVTWAKQ
GETVVLVDADLRRPTIHKTFNVSNRVGLSSYLLGNASFEDVIQPTMVKNLFVITSGPIPPNPSELLGSMRTKDLINRLED
KFGLLIMDTPPVNTVTDAQVLAAQIDGVIMVVPQGIAEKAGVAHAKQLLDTVHANILGVIMNRVTKEKSQGYYGGYYGGY
YGGYYGAEKEK
>gnl|bykdb|A0A0R1KQV9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus koreensis JCM 16448] (length=250 residues).
MSLFNRKKKLEDTSLKYGVGLVTYTDPSGMIAEQFKTIRTNIQFSSVDSDLKSILFTSSEPSEGKSTVSNNMAVTWADQG
NRVILVDSDLRRPTIHRTFDVSNRKGLTNYLSGNASLDEIIQPTMVQNLYVITSGPVPPNPAELLGSSRINTLIKELTDK
YDLLILDAPPVNTVTDSQLLAARVDGTILVVPQGIADKNGVRRAKKMLETVHANILGAVMNRVTAQKSEGYYGGSYYGGG
YYGAEKTSKD
>gnl|bykdb|A0A0R1L5J9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus sunkii DSM 19904] (length=253 residues).
MNIFRRKQKKISTDTLRNGVKLITDVDPKDIVSEQFRTVRTNINFSAVNQKLKTIIFTSSAVSEGKSTVSANLAVIWAQQ
GQKVLFIDSDLRRPTLHTTFGLLNTNGLSTALSTDIDFNSVVQKTEIDNLSVITSGPIPPNPSDLLASNRMKELISYFKK
IYDVIILDVPPLLSVTDTQIIAAQADGVVLVVRQGLAQKLAIKRSIELLKMVKANLLGYVLNDVAPKNGYGYGYGYGYGY
GYGYGYGYDNKSK
>gnl|bykdb|A0A0R1LVZ5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus futsaii JCM 17355] (length=247 residues).
MALFKKKTTKLENYSWKNGVGLVTYDDPTSTISEQFNTIRTNIQFSSVDKKLNSILFTSSAPSEGKSTVSNNVAVTWAKQ
GETVVLVDADLRRPTIHKTFNVSNRVGLSSYLLGNASLEDVVQPTMVKNLFVITSGPIPPNPSELLGSMRTKDLITRLED
KFGLLIMDTPPANSVTDAQILATQVDGVVMVVPQGIAEKAGVAHAKQLLDTVHANILGVIMNRVTKEKSQGYYGGYYGGY
YGAEKEK
>gnl|bykdb|A0A0R1MYE1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus zymae DSM 19395] (length=251 residues).
MALFKRKQKKLDDSSLKYGVGLVTYSDPTGMISEQFKTLRTNIQFSSVNNKLHSIMFTSSAPSEGKSTVSNNVAVTWADQ
GSQVILVDADLRRPTIHRTFNVSNRVGLSNYLSGNAELAEVIQPTMIANLSVITSGPIPPNPSELLNSSRTAVLLKELVN
QSDLLILDAPPVNTVTDAQLLGARVDGTILVVPQGIAEKVGVRHAKQALETVHANILGAVMNRVTAEKSGGYYGGYYGGN
YGGYYGTDDKK
>gnl|bykdb|A0A0R1NZI2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus gallinarum DSM 10532 = JCM 2011] (length=262 residues).
MPLFKKKRGTDDTIKNGAKLITVAKPKSPIAEQFRTVRTNINFMAVDHDIKSLAFTSANISEGKSTVAANVAVTYAQAGR
KVLLIDADLRRPTVHSTFNLSNHVGLSTVISSTAKEVDLDSVVQESGVNNLYVLTAGPMPPNPAELIGSKRMRDFVKLTE
ERYDLVIIDLAPVLEVSDTQELASHLDGVVLVVRQGKTQKMAIKRAVEMLEFAKARILGYIMNDVSSDNAGYGYGYGYGY
GYGYGYGEEDTKKKGLFSKFRK
>gnl|bykdb|A0A0R1P4G8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus frumenti DSM 13145] (length=256 residues).
MVNLFRKHSRVDNNSIHNGVKLITVAQPKSVIAEQFRTIRTNISFMGIDRPIKSLAFTSANVSEGKSTVAANIAVVWANT
GKRVLLIDADLRRPTLHKTFNLSNQVGLTSILTADEETVDITSMVRGTDVNNLSVITSGPIPPNPAELLNSKRMRSLLNA
VRNAFDVVILDVPPLLEVSDTQALISQLDGVVLVVKVGQTQKIAAKRAVELTKLSKARLLGYVMNDVGRGGDSAYGYGYG
YGYGYGYGYGYSTDNK
>gnl|bykdb|A0A0R1P7V6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus mucosae DSM 13345] (length=253 residues).
MMGIFKRKSRVDNNTMKNGAKLITVAKPKSVAAEQFRTVRTNIHFMAVDRRLKTIAFTSANISEGKSTVAANLAIVWAQE
GKSVLLIDADMRRPTLNSTFDLTGQSGLSTVLSSDQSEVNLNDVIQESGIEGLDLLPSGAVPPNPAELLSSQRMKVLLEA
VQAQYDLVVLDVPPMLEVTDTQTIAGSVDGVVLVVRQGVTQKAGVRRAVELLKMSHAHLLGYVMNDVVPEDDAGYGYGYG
YGYGYGYEKESEN
>gnl|bykdb|A0A0R1PAD5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus kefiranofaciens subsp. kefirgranum DSM 10550 = JCM 8572] (length=274 residues).
MSLFKKKRGTDETIKKGAKLITVADPKSPVTEQFRTIRTNINFMAVDHDIKSVAFTSASISEGKSTVAANVAVTYAQAGH
KVLLIDADLRRPTVHRTFNLSNHVGLSTVISSTAKEVDLDEVVQDSGIADLAILPAGPTPPNPSELIGSKRMQDFISLVE
DHYDMVIIDLAPVIEVSDTQELARRLDGIILVVRQGKTQKAAIKRAVEMLNFSKAKVLGFIMNDISPDNAGYGYGYGYGY
GYGYGYGYGYGYGYGYGYGEEDKKKKGFFSGRKK
>gnl|bykdb|A0A0R1PYT5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus uvarum DSM 19971] (length=246 residues).
MMWFFNKKNKELSNDTMENGVHMITAALPNSVISEQFKTLRTNIQFSNVDKKYRTLMLTSALASEGKSTIAANLAVTFAN
EGLKTLLVDADMRRPTINTTFSIADPKGLTNYLTDHEFDINNAIYETSVTNLLVMPSGPVPPNPSELINSHRMDELIKSL
YKKLALIIFDVPPLLSVTDAQILSTKVDGTILVVKKNFAEKEAVHRAVELLNHVGGHILGTVLNDVASENKNGYYGYYGY
YEKNKN
>gnl|bykdb|A0A0R1QIC1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus paraplantarum DSM 10667] (length=242 residues).
MFKRKEQNITTTAPINLTTINEPMSVITEQIKTIRTNINFAATDHQLRTLMVTSAMLGEGKSTVSGNLAVEYAKEGMQVL
LVDADLRRPTIHKTFGLKNHKGLSSWLANQMDDVNDAIHPVIGNLFVMTSGPKPPNPAELLGSNKMTEFLTSATRKLDLV
IVDAPPILPVTDSQLLANKVDGTVLVVRQGVAQKAAVRDAVNSLKKSQANILGAILNDVRDGSHHGYYGYNNGYGYYSNE
DK
>gnl|bykdb|A0A0R1QJT2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus manihotivorans DSM 13343 = JCM 12514] (length=239 residues).
MHKGVGLITDYAPKSHISEQFRTLRTNIQYSDADHQIKTLVFTSSGPSEGKSTISGNIAVTFANQGLRTLLVDADTRRPT
VHATFSLLNERGLVTLLTSKEDLDLSEYIVPTSVDHLSVLPTGPVPPNPSELLSSKRMERLIATLAKNFDMVIFDVPPLG
SVTDAQILASKVDATVLVVPYGIAQKGAVLAAKSMLEQVDANIIGVVQNRVPEEANGYYGYYGYYGYYGKKDKDNTAAK
>gnl|bykdb|A0A0R1RM96 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus oligofermentans DSM 15707 = LMG 22743] (length=249 residues).
MAIFKKQKSKNDLSTDTMENGVMLITEVTPKDVVSEQFRTIRTNVEFSAVDKEYKTLIFTSSNVSEGKSTVAANTAVTWA
QQGKKVLFIDADLRRPTLHATFGLPNNQGLTNVLTNKELDYHDVIKTTRVENLSVLTSGPVPPNPSELLNSDRMKNYIEL
LKGEYDLIIFDVPPMLQVTDTQIMAAYVDGVILVVRQGVAQQKAVTRSIELLEMVHANLLGYVMNDVASRNGYGYGYGYG
YGYGYGETK
>gnl|bykdb|A0A0R1RSB7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus fuchuensis DSM 14340 = JCM 11249] (length=247 residues).
MGFFRKEKKLEQDSMKEGVGLITLTEPTSVIAEQFRTIRTNIQFSSIDQKLRSVVFTSSGPFQGKSTVSANVAVTWADQG
VDVLLVDADMRRPTIHQTFQVPNKRGLTALLTEDEFDLNSTIQKTPVDHLFVLPCGVVPPNPSELLNTKKMNKLIAELTK
HFDLVIFDAPPVISVTDAQILASKVDGAILVTPQGIVEKGSIAKAKELLEVVNARILGTIMNRVKSENTGGYYGGYYGGY
YGADESK
>gnl|bykdb|A0A0R1SNN0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus versmoldensis DSM 14857 = KCTC 3814] (length=245 residues).
MMLKLFSKKNKKKQKESYSMNYGVSLLAHDDPTNVISEQFNTIRTNIQFSSVDTKLHSILFTSAAPSEGKSTVSANLAVS
WAKQDEKVILIDADLRKPTIHKTFNQSNQSGLSNYLLGSANLDEIVKETKVPNLYVITSGPIPPNPSEILASKRIGNLME
ELQNRFDLLMFDAPPVNSVTDAQVLATKIDGTILVTPQGVAEKHSVAHAKKLLDTVHANILGAIVNQAEIDKSSNYYGGY
YGIEQ
>gnl|bykdb|A0A0R1U203 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus equi DSM 15833 = JCM 10991] (length=240 residues).
MMAFFKKNKDKIDNTSMEKGVKLITVAEPNSVITEQFNTIRTNIQFSSVDKSFKTLMITSSLMSEGKSTVSANVAASFAK
QGLRVLLVDADLRRPTIASTFGISSPQGLTNYLTEQNFNINNIIYETSVDNLFVMPSGPIPPNPSELIGSNKMQHLVAVL
ADQLDLVIFDAPPVLSVTDAQILSTCVDGTILVTRAERSEKDAVRKAVESIKHVQGHIIGAILNDVHGSDGAYGYGYYAK
>gnl|bykdb|A0A0R1UES6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus pantheris DSM 15945 = JCM 12539 = NBRC 106106] (length=250 residues).
MRIPFFHKRYKEDMTSQTQGVRLVTYADPKHVVSEQFRTVRTNIEFAGAALDQLQVVMFTSAAISEGKSTVSNNVAVAWA
QSGKRVLLIDADLRRPTVHATFDMLNTDGLTNVLAGNIKVGDAAKETFVPNLSVMNAGPVPPNPSELLNSQRMADLLAWA
REHYDMVVLDVPPVLAVSDVQVLVPQTDGVVLVVRMEHTLKGDLERTVEVLKMAHAKVLGVVERVHSKHGDRGYGYGYGY
GYGYGSEGAK
>gnl|bykdb|A0A0R1UFJ0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus ingluviei DSM 15946] (length=247 residues).
MGLFKRKNKKYSTDTMDNGAMLITVADPKNPVAEQFRTIRTNIHFMSVDKPLRRVAFTSSNVSEGKSTVTANVAITWAQE
GKRVLLIDADLRRSTLHTTFGVPNHHGLTTVLTSAVSEIDLSQVIMDSGVENLDVLPAGPVPPNPSELLNSQRMTAFLDA
VEPIYDIIVLDVPPLLEVTDTQALSGKLDGVILVVRAGVTQKAAISRAVEMLKISKAHLLGYVMNDVDGEDAAYGYGYGY
GYGEEEK
>gnl|bykdb|A0A0R1UFP0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus plantarum subsp. argentoratensis DSM 16365] (length=219 residues).
MSVITEQIKTIRTNINFAATDHKLRTLMVTSAMLGEGKSTVSGNLAVEYAKEGMQVLLVDADLRRPTIHKTFGLKNHKGL
SSWLANQMDDVNDAIHPVIGNLFVMTSGPKPPNPAELLGSNKMTEFLTSATRNLDLVIVDAPPILPVTDSQLLANKVDGT
VLVVRQGIAQKAAVRDAVNSLKKSQANILGTVLNDVRDGSHHGYYGYNNGYGYYSNEDK
>gnl|bykdb|A0A0R1UI73 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus kalixensis DSM 16043] (length=258 residues).
MALFRKKRGSSETMKKGARLITAADPKSPVSEQFRTVRTNINFMAVDYDIKTMAFTSANISEGKSTVTANVAITYAQAGL
KTLLIDADLRRPTLHSTFDVQNNRGLTTVLTSEADVFNLDEVVEDSGIENLSILTSGPIPPNPAELIGSKRMSTFIDLVK
SHYDLVILDLAPVLEVSDTQALASNLDGVVLVVRQGKTQKPAIKRAVEMLRFAKVRILGYVMNDVSSENNGYGYGYGYGY
GYGNENKQKTGFLSRFRK
>gnl|bykdb|A0A0R1US13 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus hammesii DSM 16381] (length=251 residues).
MAWFKSRKKKLDDTSLKYGVGLVTYTDPAGQISEQFKTVRTNIQFSSLGKDLKSVLFTSSEPSEGKSTVSNNMAVTWADQ
GTKVILVDADLRRPTVHKSFSVSNRAGLTNYLSQAMDLAAVIQPTIIDNLDVISSGPIPPNPAELLGSDRVQQLIDKLSE
KYDLIIFDAPPVNTVTDSQLLAARTDGTILVVPQGIADKNGVRRAKQLLETVHANILGAVMNRVTAQKSEGYYGGSYYGG
NYGGYYGTDGK
>gnl|bykdb|A0A0R1UUC5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus plantarum subsp. argentoratensis DSM 16365] (length=213 residues).
MSVVTEQIKTIRTNLNYSMVGKPLKTLMITSAVQGEGKSTIGGNLAVEYAKKGMQVLLVDADLRRPTIHQTFGVSNQRGL
SSWLSGQLVDVNDAIHPVLDHLFVMPSGPKPPNPAELLASDKMTEFLTVATRKLDLVIVDAPPVLPVTDARILAGQVDGT
VLVVRQNFVEKVAVRQAVNALKNARTQLLGTVLNDVDIKTNGYGYGYYGTDTN
>gnl|bykdb|A0A0R1VHW0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus gastricus DSM 16045] (length=251 residues).
MGLFSRKKIQSVDTMVNGANLVTLTKPQSLVAEQFRTIKTNITFMGVDHPIKALAFTSSNISEGKSTVTANVGVTWAQDN
KRVLMVDADLRRPTMHSTFDLDNRQGLTTLLMDQEHVINSQDVIQATEVPNLDVLTVGPVPPNATGLLNSQRMRDLVATF
EQMYDVVIIDVPPILEVNDTQVLSSMLDGVVLVVRSGVTQKVAVKRAVEMLNISKANLLGYVMNDVASGDDDGYGYGYGY
GYGYGSVEPED
>gnl|bykdb|A0A0R1VQ95 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus concavus DSM 17758] (length=245 residues).
MFNRKNKGPEPVAPANLFTVNEPSSVIAEQVKTIRTNVSFAQQAQSLRTIMVTSAMASEGKSIVTANLAVEFAQAGKRVV
LIDADLRRSTVNRTFRIREVNRGLTNYLVRQIDDITEVCHPTMVENLAVIPSGPTPPNPAELIGSPLMATVFDQLKQYFD
LIIVDAPPILPVTDGQILSNMVDGVILVVRQNYTDKRAVVDTKERLEQAQANILGVVLNDVRSEGHSGYYNNGDGYYGYE
YSEKK
>gnl|bykdb|A0A0R1WGS5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus nantensis DSM 16982] (length=242 residues).
MAFKLLKKKTKKLDDYSLTHGVGLVTYDDPSSVISEQFNTIRTNIQFSSVDKELNSILFTSSAPSEGKSTVSNNVAVSWA
KQDKKVVLIDADLRRPTIHKTFNVSNKAGLSNYLLGTASLESVIQSTMVDNLFVITSGPTAPNPSELLGSKKITELFQDL
TAQFDFMILDAPPVNSVTDAQVLATKVDGVILVVPQGYADKTGVIHAKKALQTVHSNILGAIMNRTAKDKMKGYYGSQYG
GY
>gnl|bykdb|A0A0R1WHZ1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus nantensis DSM 16982] (length=255 residues).
MAFNLFSRRKHKIDNTSLKYGIGLVTYTDPKGMISEQFKTVRTNIQFSSVDKKLKSLLFTSSDPSEGKSTISNNVAVTWA
DQGSKVILIDADLRRPTVHKTFGVSNRRGLSNYLLGNATLEEIVQPTVVNGLYVITSGPVPPNPAELLGSLRAKDLLVRL
TDKFDLLVLDAPPVNTVTDAQVLAARVDGTILVVPQGIADKAGVMHAKEALETVNANILGAIMNRVTEQKSGGYYGGSYY
GGYYGGYYGTDDKKK
>gnl|bykdb|A0A0R1WQI7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus hayakitensis DSM 18933 = JCM 14209] (length=241 residues).
MFGKKKKKLDSNSMKNGVYLVTVAAPKSVDTEQFNTIRTNITFSSVDESFKSIMITSSGASEGKSTVAANVAASFAKQGK
KTLLVDSDLRRPTIASTFNIASTQGLTNFLTDKNFDINEVLYPTTVENLYVMPAGPVPPNPSELIGSKRMKMLKEALTEK
LDLVIFDAPPVLSVTDAQLLSVSVDGTILVVRQGEAEKEAVKQSVDLLNHVNAKIIGTIMNDVDVTSTDGYYGYYGYYGK
E
>gnl|bykdb|A0A0R1WTI0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus graminis DSM 20719] (length=247 residues).
MGLFRKEKKLDQASMKEGVGLITLTDPTSIIAEQFRTIRTNIQFSSIDQKLRSVVFTSSGPSQGKSTVSANVAVTWADQG
VDVLLVDADMRRPTVHQTFQVPNKKGLTSLLTEETFDLNNAIQKTPVDHLFVLPCGVVPPNPSELLNTKKMDKLIIELTK
HFDLVVFDAPPVISVTDAQILASKVDGTILVTPQGIAEKGAVAKSKELLEVVHARILGTIMNRVKSENTGGYYGGYYGGY
YGAEENK
>gnl|bykdb|A0A0R1XAP5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus panis DSM 6035] (length=209 residues).
MAIDHPIKTLALTSANVSEGKSTVTDNLAIVWAQTGQRVLLVDADLRRSTLHWTFSLDNREGLTTILTSHAHSIDLNKII
QPSGIDNLSLLPSGPTPPNPAELLSSQRMKDFLKAARERYDMVIVDVPPMLEVTDTQVISHNLDAVVLVVNQGQTQKLGA
KRAVELLKMAHANLLGYVMNDVVSDGGAGYGYGYGYGYGYGYGNDGDDK
>gnl|bykdb|A0A0R1XVN6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus intestinalis DSM 6629] (length=264 residues).
MSLFKKKRGTNETMKKGAKLITAADPQSPISEQFRTVRTNINFMSVDKEIKTLAFTSANISEGKSTVTANVAITYAQAGR
KTLLIDGDLRRPTLHSTFNVKNNRGLTTVLTSDADEIDLEDVVKESGVKNLSILTSGPIPPNPSELIGSHRMQTFIDLVK
AHYDLVIIDLAPVLEVSDTQELASHLDGIILVVRQGKTQKVAIRRAVEMLEFAKVRILGYVMNDISAENSGYGYGYGYGY
GYGYGQENKKSRFFGGSSTNKESK
>gnl|bykdb|A0A0R1Y5I1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus pontis DSM 8475] (length=252 residues).
MSLFHRGNKNQANAKINNGAQLITAVHLKSPISEQFRTLRTNINFMAIDNPIKTLALTSANVSEGKSTVTDNLAVVWAQN
GQKVLLVDADLRRSTLHRTFDLDNREGLTTILTSHARTIDLNKIIQPSGIENLSVLPSGPTPPNPAELLSSQRMKDFLKA
AKERYDMVIVDVPPMLEVTDTQVISHYLDAVVLVVKQGQTQKLGAKRAVELLKLAHANLLGYVMNDVPSDGSADYGYGYG
YGYGYGDDGDDK
>gnl|bykdb|A0A0R1YC58 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus hamsteri DSM 5661 = JCM 6256] (length=259 residues).
MALFRRKRGTTETMKKGAKLITVANPQSPVSEQFRTVRTNINFMAVDHDIKTMAFTSANISEGKSTVTANVAITYAQSGL
KTLLIDGDLRRPTLHSTFNVRNNRGLTTVLTSEAKEINLEDVVEESGVENLSILTSGPIPPNPAELIGSHRMRTFIDLVK
AHYDLVIIDLAPVLEVSDTQELASHLDGIVLVVRQGKTQKPAIKRAVDMLTFAKVRILGYVMNDVSSENAGYGYGYGYGY
GYGYGETNKKKGFLSRFKK
>gnl|bykdb|A0A0R1YL91 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus amylophilus DSM 20533 = JCM 1125] (length=242 residues).
MAIFKKKSNGLQPVAAANLFTLNNPSAVATEQIKTIRTNISFSQEAQNLQTIMITSTVASEGKSTIAANLAVEFAHAGKN
TLLIDTDLRRSTVDRTFGMHGTTKGLTSYLVHRFEELTDVIHETEVENLSVIPSGPIPPNPAELIASQGMKDVLTQLKES
FDLVIVDAPPLLPVTDGQIMSNMVDGVVLVVRQNHTLKAGVKEAKQTLENAKANILGVVFNDVESSNDSGYYGEGHYDNN
EQ
>gnl|bykdb|A0A0R1YMT3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus parafarraginis DSM 18390 = JCM 14109] (length=247 residues).
MNIFHRKEKKLSTDTLKNGVKLITDVNPKDVVSEQFRTVRTNINFSAVNQKLKTIIFTSSAVSEGKSTVSANLAVIWAQQ
GQKTLFIDSDLRRPTLHTTFGLLNTSGLSTALSTDIDFNSVVQKTEIDNLSVITSGPIPPNPSDLLASNRMKELISYFKK
IYDVIILDVPPLLSVTDTQIIAAQADGVVLVVRQGLAQKLAIKRSIELLKMVKANLLGYVLNDVAPKNGYGYGYGYGYGY
GYDNKGK
>gnl|bykdb|A0A0R1Z021 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus parabuchneri DSM 5707 = NBRC 107865] (length=232 residues).
MKLITDVDPKDVVSEQFRTVRTNINFSAVNQKLKTIIFTSSAVSEGKSTVSANLAVIWAQQGQKVLFIDSDLRRPTLHTT
FGLLNTNGLSTALSTDIDFNSVVQKTEIDNLSVITSGPIPPNPSDLLASNRMKELISYFKKIYDVIILDVPPLLSVTDTQ
IIAAQVDGVVLVVRQGLAQKLAIKRSTELLKMVKANLLGYVLNDVAPKNGYGYGYGYGYGYGYGYGYDNEGK
>gnl|bykdb|A0A0R1ZIE9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus sharpeae JCM 1186 = DSM 20505] (length=252 residues).
MFKIFKNKHKQESDESITNGVRLITAYQPKHTISEQLRTVRTNIEFAGAALDELKVVMFTSPEMSDGKSTVAANVAVTWA
QAGKKVLLVDADMRRPTVHLTFNSANTQGLSTILAGNKLPEEVITDSFVDNLAVLTAGPVPPNPSELLGSKHMHQFVEWA
RANYDIVILDATPVLAVSDVQVSLPEVDGTVLVVRMEKTLRGNIQRTVEVLKMADAKILGVVERVKNGRGDKGYGYGYGY
GYGYGYGYGSDK
>gnl|bykdb|A0A0R2A1J5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus vaccinostercus DSM 20634] (length=240 residues).
MGIFKHHKKLSTDTMSNGAKLITASNPKDPISEQFRTIRTNIDFSSVDRDLKTVLFTSADVSEGKSTVSANMAVIWAQQG
KRVLFVDADLRRPTLHMTFGLVNTKGLTTYLARGADYHELLGNSGIENLTILTSGPVPPNPAELLNSKRMKDFLANSQNE
FDIVMLDVPPLLSVTDTQVLSAEVDGVVLIVRQGITQKAAVQRSVELLKMVNAKVLGYVLNDVSARSGYGYGYGYGYGYK
>gnl|bykdb|A0A0R2A997 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus agilis DSM 20509] (length=245 residues).
MGLFRKNKNQDANTMETGVKMITVTDPTSVDTEQFNTIRTNIKFSNVDKDYKTLMITSSNMSEGKSTVSANIATAFAKQG
LHTLLVDSDLRRPTINATFGIDNPQGLSNYLSERSFDVNKIIYKTSVKNLYVMPSGPIPPNPSELIGSKRMAELIKKLSE
QLDLVIFDAPPVLSVTDAQIVSTNVDGTILVVRANKTEKAAVKEAVRLIKQVGGHIIGTVLNDVEVKGSGYYGYYGYSKD
SKKKK
>gnl|bykdb|A0A0R2BAC2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus collinoides DSM 20515 = JCM 1123] (length=256 residues).
MKNGQDVGYGYKRVKTMALFRRKKKQSDDSIINGVKLVTAVEPKNVVSEQFRTVRTNIDFSSVDKQIKTLLFTSSGMSEG
KSTVSANTAVTWAQQGKKILFIDADLRRPSVQSSFDLVNGRGLSSVLSNNLDFHEVTQQTAIDNLEVITSGPIPPNPAEL
LNSNRMKRLLDSVEAEYDLVLLDVPPLLSVTDTQVLAARVDGVVLVVRQGVAQKTAITRAVELLQMVHANLLGYVLNDMV
PRDGYGYGYGYGYGHE
>gnl|bykdb|A0A0R2CCB5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus thailandensis DSM 22698 = JCM 13996] (length=249 residues).
MRIPFFHKHYKEDMTFQTHGVRLVTYADPKHVVSEQFRTVRTNIEFAGAALDKLQVVMFTSAAISEGKSTVSNNVAVAWA
QSGKRVLLIDADLRRPTVHATFDLLNTDGLTNVLAGNVKVEDAVKDTFVPNLAVMNAGPVPPNPSELLNSQKMADLLAWA
REHYDIVVLDVPPVLAVSDVQVLVPETDGVVLVVRMEHTLKGDLERTVEVLRMAHAKVLGVVERVHSKHGDRGYGYGYGY
GYGYGNDSK
>gnl|bykdb|A0A0R2CUI0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus aquaticus DSM 21051] (length=251 residues).
MMMRIFNKKNKELSNDTMENGVHMITAAAPSSVISEQFKTLRTNIQFSNADKKYRTLMLTSALASEGKSTVAANLAVTFA
DQGLKTLLVDADMRRPTINATFSIANPMGLTNYLTDHKFDINNAIYETSVTNLFVMPSGPVPPNPSELINSRRMDGLIKS
MSEQLELVIFDAPPVLSVTDAQILSTKVDGTILVVKENFAEKEAVRRAVDLLKHVNGHILGSVLNDVTSEGGKGYYGYYD
YYGKDTEKDKK
>gnl|bykdb|A0A0R2D7Z0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus rennini DSM 20253] (length=251 residues).
MSLFRKKKKLDSHSMKHGVGLITVTKPNSTIAEQFRTIRTNIQFSSADRQLKTIIFTSANPSEGKSTVSSNVAVTWADQG
SKVLFIDADLRRSTAHRTFRVSNTHGLTTILTAKQADLNESIKKTEVNNLYVLPSGPVPPNPSELLNSSKMDQLLKALVD
QFDMIILDAPPVNTATDAQVLASRVDGVILVVPQGVALKGAVLRARDLLEKVHANVLGTILNRAVDTDSGGYYGGYYGGY
YGGYYGTDDKK
>gnl|bykdb|A0A0R2DXC3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus paracasei subsp. tolerans DSM 20258] (length=252 residues).
MSLNGIFKKFTHRDEEDNETQKNGVMLVTFAEPKHVVAEQFRTVRTNIEFAGAALDRCEVVMFTSPSMSEGKSTVSANVA
VTWAQAGEKVLLIDADLRRPTVHATFRTLNLEGVTTVLTGKTKPSDVVEKTFVDNLDIITSGPVPPNPSELLNSKRMANL
LEWGRANYDIIVLDAPPVLAVSDVQVLVPKTDGVVVVTNMGKTLKGDLKRTVEVLKLAKAKILGSVERVRATKGDRSYGY
GYGYGYQSNDGR
>gnl|bykdb|A0A0R2E0G9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus fermentum] (length=247 residues).
MGLFKHRYTESTDTMDNGAMLITLADPKSGPAEQFRTIRTNIHFMSVDRPLKTVAFTSSGISEGKSTVTANVAIAWAQEG
KRVLLIDADLRRSTLHATFGLSNQKGLTTVLTGDSNEVDLSNVVQKSGVENLEVLTAGPVPPNPSELLSSQRMQSLINGV
RDAYDLVVLDVPPMLQVTDTQALSSSLDGVVVVVRQGVTQKAAVRRAVEMLRISKTNILGYVMNDVYDADAGYGYGYGYG
YGYEDER
>gnl|bykdb|A0A0R2F5X1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus similis DSM 23365 = JCM 2765] (length=239 residues).
MALFRKKKKLSTDTIDNGVKLITAVEPKNVVAEQFRTVRTNIDFSSIDKTLKTILFTSSDVSEGKSTVSANTAVTWAQQG
KKVLFVDADMRRPTLHTTFGVTNTQGLSTILANNEDYHGIAVDSVVDNLTVITSGPVPPNPAELLNSNRMKNFLQTVQNE
YDMVILDVPPLLSVTDTQILSAGVDGVVLVVRQGVAQRTSVQRAVELLEMVHANLLGYVLNDVAPKNGYGYGYGYGYEK
>gnl|bykdb|A0A0R2FT82 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Weissella halotolerans DSM 20190] (length=241 residues).
MTFFSKKIKQDDETQRNGARLITFTEPKNIISEQFRTVKTNIEFAGAALDKLQVVMFTSAEISDGKSTVAANIAITWAQA
GKSVLLVDADLRRPTAHSTFDIPNTRGLTSILASDMQPKDLVRETFVPNLSVLQAGPVPPNPAELLGSKRMTALVNWMRN
NYDMVVLDVPPVMAVTDAQVMFKLVDGIVLVTTIGKTLKANLKRTVETISLTDAKVLGCVERVKDKSNDAGYGYGYGYGY
E
>gnl|bykdb|A0A0R2FW20 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus selangorensis] (length=261 residues).
MANKLTTWWQNRKDKSKLDDQSMQKGVSLITVSDPKSTIAEQFRTIRTNIQFSQVDDQLRTLSFTSSGPSEGKSTVSANI
AVTFADQGMKTLLIDADMRRPTIHQTFQIPNRKGLTTILTSSKNDYDSVIVKTKVANLSVMPSGPVPPNPSELLNTHKMD
QIIEELSEQYDLIIFDAPPVGSVTDAQIIGTKVDGSILVVPQGIALKGAVLQAKDALDSVHARIIGTIMNRVSRKNGTGY
YGGYYGGYYGGYYGKNEDKKN
>gnl|bykdb|A0A0R2G7V3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus acetotolerans DSM 20749 = JCM 3825] (length=263 residues).
MSLFKKKRGTDETIKNGAKLITVADPKSPVTEQFRTIRTNINFMAVDHDIKSVAFTSASIGEGKSTVAANVAVTYAQAGR
KVLLIDADLRRPTVHRTFNLSNHVGLSTVISSTAKEVDLDEVVQDSGIADLAILPAGPTPPNPSELIGSKRMQNFISLVE
DHYDMVIIDLAPVLEVSDTQELARRLDGIILVVRQGKTQKAAIKRAVEILNFSKAKVLGFIMNDISPDNASYGYGYGYGY
GYGYGYGYGEEKKKKSWFSRQCH
>gnl|bykdb|A0A0R2GAB7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus plantarum] (length=242 residues).
MFKRKEQNTTTTAPINLTAINEPMSVITEQIKTIRTNINFAASDRKLRTLMVTSAMLGEGKSTVSGNLAVEYAKEGMQVL
LVDADLRRPTIHKTFGLKNQKGLSSWLGNQLEDVNDAIHPVIGNLFVMTSGPKPPNPAELLGSNKMTEFLTSATRKLDLV
IVDAPPILPVTDSQLLANKVDGTVLVVRQGVAQKAAVRDAVRSLKKSHANILGSVLNDVRDSSHHGYYGYDNGYGYYSNE
DK
>gnl|bykdb|A0A0R2GZ22 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Weissella viridescens] (length=245 residues).
MSLFKRHYKEDVETQTNGARLITFTEPKNVISEQLRTVRTNIEYAGAALDKLQVVMFTSSQMSDGKSTVSSNVAVTWAQA
GKKALIVDADLRRPTVHTTFRLDNRQGLTTILASDLQPKDLVHETMVPGLSALTSGPVPPNPAELLGSPRMAALVEWMRN
NYDIVVLDVPPLNLVTDAQVMLPLADGVVLLITLNQTQKVNLERAVELLNLTSTKVLGVVSRAKRNDGDSGYGYGYGYGY
GSTQD
>gnl|bykdb|A0A0R2H680 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus ingluviei] (length=247 residues).
MGLFKRKNKKYSTDTMDNGAMLITVADPKNPVAEQFRTIRTNIHFMSVDKPLRRVAFTSSNVSEGKSTVTANVAITWAQE
GKRVLLIDADLRRSTLNTTFGVPNHHGLTTVLTSAVSEIDLSQVIIDSGVENLDVLPAGPVPPNPSELLNSQRMTAFLDA
VEPIYDIIVLDVPPLLEVTDTQALSGKLDGVILVVRAGVTQKAAVSRAVEMLKISKARLLGYVMNDVDGEDAAYGYGYGY
GYGEEEK
>gnl|bykdb|A0A0R2HET3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pediococcus pentosaceus] (length=243 residues).
MFKKKQKSDNESLKNGVGLVTFTDPTSTIAEQFRTVRTNIQFSSVDKALKSIVFTSSAPSEGKSTVSNNVAVTWADQGKR
VLIVDADMRRPTVHRTFSVSNAVGLSNLLAETGSLENAIHETIINNLSVMPSGPIPPNPSELLGSTKMAALLDQLTGAYD
LVIIDAPPVNTVTDAQVLAARADGTILVVPQGIADKAGVRHAKQLLEAVQANILGAILNRATAEKSTGYYGGYYGGYYGT
DDK
>gnl|bykdb|A0A0R2HXK1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Carnobacterium divergens DSM 20623] (length=239 residues).
MFKSKNNSNQGSSNGASLITTTKPNSVVAEQFRTIRTNIQFSMVDKDLKSLIFTSSGPGEGKSTISANTAIVFASQGKRV
LLVDADMRKPTVHKTFNIPNHEGLTTLLTEKDVKLSSVIRQGTNENLFILTSGPIPPNPSELLDSNKMNKIIEILEGAFD
LVIFDMPPVITVTDSQIMATKTDGTIFVIRSGVANKEALIKSKQLLDIVNANVIGTVFNGVERTKDSAYKYYGLDSDTV
>gnl|bykdb|A0A0R2HZW6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus secaliphilus] (length=260 residues).
MSILSTLLFDRKKKNSTDTIDNGVKLITAVHPKSIISEQFRTIRTNIDFMAIDKQIRTLAFTSANVSEGKSTVTDNIVVV
FAQNGQHVLLVDADLRRPTLSKSFGVDNRQGLTSILTSRVQSIDLSQIIKPSGIQNLDVLPSGPIPPNPAELLASQRMQA
FLDAVKQNYDMVILDVPPMLEVTDTQVLSHSLDAVVMVIRQGRTQKMAARRSVELLHMAHANLLGYVMNAADSKADAGYG
YGYGYGYGYGYGYGYGEGEK
>gnl|bykdb|A0A0R2I6Y6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Carnobacterium divergens DSM 20623] (length=226 residues).
MNRLGDEKRRLITKMHATSSISEQFKNIRTAIEFSGVDKTFQTILITSPEPMSGKSTISANLAIVYAQKGKKTLLVDGDM
RKPTVHKTFNQSIFKGLSTSLTGDSKVSDNFQKTEIENLFILTSGPIPPNPNELLGSKRMGAVLKELKTQFDVIIIDSPP
VTVVSDALVLASYTDGVLFVFRNQVTMKNKAKQAIEQIKMTRVPIIGAILNGEQEKQHNNYYYAYK
>gnl|bykdb|A0A0R2IQW0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Carnobacterium maltaromaticum DSM 20342] (length=235 residues).
MLNFRSKKQTRVVKAPKLITSLYPNSIISEQFRTIRSNLQFSENGMNLKTIGVTSSGPGEGKSTVSANLATVFADQKHRV
LLIDADLRRPSIHRVFKKPNTKGLTSLLNNPNLSVEEVIHRSKIENLFLITSGPTPTNPSELLSSNGMDRLIKLFQKNFD
LIIFDLPPTVAVTDAQIMATKVDGTILVVRNDVAYKDAVDKAVDLLRTVGANLVGFIFNGAERKTTDPYSYYGKD
>gnl|bykdb|A0A0R2IS62 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Carnobacterium maltaromaticum DSM 20342] (length=238 residues).
MNYSGEQLIESQKNGASLVTVTKPNSVVAEQFRTIRTNIQFSMIDRDLKSLIFTSSGPGEGKSTTSANLAVVFATQGKRV
LLVDADMRKPSVNKTFKLSNHEGLTTLLTEKEVVLGDVVHETNTENLFILTCGPIPPNPSELLDSKKMNRVIEILEETFD
LVIFDMPPIVSVTDAQIMASKTDGTVFVIRNGIATKEAVLKAKQLLDIVNANVVGTIFNALEKRKVKAYKYYGIEGEN
>gnl|bykdb|A0A0R2IT86 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pediococcus cellicola] (length=251 residues).
MPLFRKKRKLNNASLKNGVGLVTVTDPSSVVSEQFRTIRTNIQFSSVDKTLRSIAVTSPEPFEGKSTVGANLAVVWAKQN
QKTVIIDADMRRPTVHRTFNLLNASGLSSYLAGNAVYEEIVQSTDVPNLSVITSGPVPPNPAELLNSQRLDTLIQRLQSE
FEMIIVDAPPVNTVTDAQVLAAKVDGVVLIVPQAIAEKGSVIHAVEQLKKVQAKILGTVMNRFKASKTPGYYGGYYGGNY
GGYYGVDDKHD
>gnl|bykdb|A0A0R2J2V6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Carnobacterium maltaromaticum] (length=241 residues).
MFKFKTNKEQLIESQKNGASLVTVTKPNSVVAEQFRTIRTNIQFSMIDRDLKSLIFTSSGPGEGKSTTSANLAVVFATQG
KRVLLVDADMRKPSVNKTFKLSNHEGLTTLLTEKEVVLGDVVHETNTENLFILTSGPIPPNPSELLDSKKMNRVIEILEE
TFDLVIFDMPPIVSVTDAQIMASKTDGTVFVIRNGIATKEAVLKAKQLLDIVNANVVGTIFNGLEKRKDKAYKYYGIEGE
N
>gnl|bykdb|A0A0R2J5A5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Carnobacterium maltaromaticum] (length=235 residues).
MLNFRSKKQTRVVKAPKLITSLYPNSIISEQFRTIRSNLQFSENGMNLKTIGVTSSGPGEGKSTVSANLATVFADQKHRV
LLIDADLRRPSIHRVFKKPNTKGLTSLLNNPNLSVEEVIHRSKIENLFLITSGPTPTNPSELLSSNGMDRLIKLFQKNFD
LIIFDLPPTVAVTDAQIMATKVDGTILVVRNDVAYKDAVDKAVDLLRTVGANLVGFIFNGAERKTTDPYSYYGKD
>gnl|bykdb|A0A0R2JUW8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus acidipiscis] (length=247 residues).
MALFKKKKQLDSNSMKHGVGLITVTKPTSSIAEQFRTIRTNIQFSSADRQLKTLVFTSADPSEGKSTISFNVAVTWADQG
NKVLLIDSDLRRPTVARSFRVSNSQGLTTILTEKQANLSESIHETEIPNLYVLPSGPVPPNPSELLNSSKMDQLLKVLKE
QFDIIILDVPPVNTVTDAQILASKVDGVILVVPQGIALKGAVLRARDLLKKVNANLIGAVLNRVTDTASGGYYGGYYGGY
YGTDDKK
>gnl|bykdb|A0A0R2JWJ9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pediococcus ethanolidurans] (length=251 residues).
MPLFRKKRKLDNESLKRGVGLITVTDPSSVVAEQFRTIRTNIQFSSVDKRLQSIVITSSEPSEGKSTVSSNLAVVWAKQK
QKVVIIDADLRRPTAHRTFHVLNAAGLSSYLTNNAVYEEIIQTTDVPNLSVISSGPVPPNPAEILNSHRINNLLERLQTE
FDMIIIDAPPINTVTDAQLLANKADGVVLVVPQGIAEKGSVTHAVDQLKTVHAKLLGTIMNRFKADKSPGYYGGYYGGDY
GGYYGVDDKDD
>gnl|bykdb|A0A0R2KTQ4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus amylovorus DSM 16698] (length=260 residues).
MPLFKKKRGTDDTIKNGAKLITVAKPKSPVAEQFRTVRTNINFMAVDHDIKSLAFTSANISEGKSTVAANVAVTYAQAGR
KVLLVDADLRRPTVHSTFNLSNHVGLSTVISSTAKEVDLDSVVQESGVDNLYVLTAGPMPPNPAELIGSKRMRDFVKLTE
ERYDLVIIDLAPVLEVSDTQELASHLDGVVLVVRQGKTQKMAIKRAVEMLEFAKARILGYVMNDVSSDNAGYGYGYGYGY
GYGYGEEDTKKKGLFSKFRK
>gnl|bykdb|A0A0R2KZR0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pediococcus stilesii] (length=247 residues).
MFGKKKRQKKLDNESLKNGVGLITFTEPTSSIAEQFRTVRTNIQFSSVDKQLKSIVFTSSAPSEGKSTISNNVAVTWADQ
GKRVLIVDADMRRPTVYRTFRVSNAIGLSNLLAGTGNLEGAIHETVVNNLSVMPSGPIPPNPSELLGSTKMVSLLETLTN
AYDLVIIDAPPVNTVTDAQVLAAHADGTVLVVPQGIADKAGVRHAKQLLEAVQANILGAILNRASAEKSTGYYGGYYGGY
YGTDDKK
>gnl|bykdb|A0A0R2L487 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus siliginis] (length=256 residues).
MALFHRNKKKLSEDTMLNGAKMITALHPKAVVSEQFRTIRTNIEFASVDRAIKTVTFTSADASEGKSTVSANVAVTWAQQ
GKKVLFVDADLRRPTVHSTFGLSNTQGLSTLLTMEKTENFSEFVQESPIDNLSVITSGPVPPNPSELLNSHRMDTFISKA
REFFDMVVFDVPPMLTVTDAQLLTAKVDGVILVVRFGVTNKAAITRTKELLDLAHANLLGYVMNDATGDAAGSGYGYGYG
YGYGYGYGKTEDKKEG
>gnl|bykdb|A0A0R2LMV6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus kimchiensis] (length=246 residues).
MSLFKRKNKKLDNYSLKHGVGLITYDDPSSTISEQFNTIRTNIQFSSVDKKLKSILFTSSAPSEGKSTISNNVAVTWAKQ
GEKVILVDADLRRPTIHKTFDVSNRIGLSSYLLGNATLEEIIQPTMVKDLYVIASGPIPPNPSELLGSMRIKGLFKALED
KFGLLILDAPPTNAVTDAQILAAQVDGVILVVPQGLAEKAGVAHAKQALDTVHANILGAIMNRVTKAESQGYYGGYYGGY
YGVEKK
>gnl|bykdb|A0A0R2M7H6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus xiangfangensis] (length=241 residues).
MFKRQVNNTTTAAINLTTINEPMAVVTEQIKTIRTNINFAASDRPLRTMMVTSAMLGEGKSTVSANLAVEYAKEGVRVLL
VDADMRRPTVHKTFNLSNHQGLSSWLGRQLDDVNKAIHPVLDNLFVMTSGPKPPNPAELLDGQLMADFLKTTTRKLDLVI
VDAPPILPVTDAQLLAHKVDGTVLVVRQNVAQKVAVRDAVVTLKKSHAHLLGAVFNDVRDGSHHGYYGYESGYGYYSDED
K
>gnl|bykdb|A0A0R2MUS5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus delbrueckii subsp. jakobsenii ZN7a-9 = DSM 26046] (length=246 residues).
MKNGVKLITLANPQSVISEQFRNIRTNINFMNVDKEVKTIAFTSAMASAGKSTVSANVSITMAQVGKKTILIDADLRRPT
LHSTFNVSNSNGLTTLLTSRAKEMGANSVIRESGVENLSILTAGPIPPNPSELLSSKHMLNLIEDLKQEYDMVVIDLAPV
LDAAETQLLTSSLDGTILVVRQAYSQKSAVKRAVELLKLTKSPILGYVMNDVDADGDDGYGYGYGYGYGYGYGEEKEKKG
LFGRKK
>gnl|bykdb|A0A0R2NCL4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pediococcus argentinicus] (length=246 residues).
MALFKRKQKKLDNNSLKYGVGLITYSDPTSSISEQFRTIRTNIQFSSIDKSLSSVLFTSSEPSEGKSTVSNNVAVTWADQ
GKKVILIDADLRRPTVHKTFGVGNSKGLSTILSGNDQLEDVIQSTVIPNLFVITSGPVPPNPSELLNSSRMDNLLKELTS
QSDLLIVDAPPVNTVTDAQVLAARVDGTILVVPQGIADKGGVRHAKQLLQAVHANILGAIMNRVTAEKSSGYYGGYYGGY
YGADDK
>gnl|bykdb|A0A0R2NQ84 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus fabifermentans DSM 21115] (length=191 residues).
MITSAMLGEGKSTVSSNLAVEYANEGMKVLLVDADLRRPTVHKTFGLSNRQGLSSWLAHQTSDINDAIHQTVDNLFVMTS
GPKPPNPAELLGSKMMDEFLNSATRKLDLVIVDAPPILPVTDSQLLANKVDGTVLVVRQNVAQKAAVRDAVSALKRSHAH
ILGAVLNDVSDGKHSGYYGYNNGYYSEQDDQ
>gnl|bykdb|A0A0R2NUN6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus fabifermentans DSM 21115] (length=237 residues).
MFKKHKKLINDTQAIDLTTVNEPNSIISEQFKTIRTNIVFSASDIKTLMVTSSLTGEGKSTIAANLAVEFANNNKNVLLI
DADMRRPTVHKTFGINNIEGLSTLLTKQRIGINSCILKSKIERLNILPSGPIPPNPAELLSSKDMVEIIRNARKVFDVVL
LDCPPILPVTDARILAPLVDGTILVVRRGGISKKIVRESKSVLEQVRANLLGAVLNGFYNKETVGYYGETYGSYSTK
>gnl|bykdb|A0A0S2W8N7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Intestinimonas butyriciproducens] (length=480 residues).
MEEHKLDQEEGRIDLYRLLPELGRALRRLFWVPLLLALLGAAAMGVRAWRSYVPRYHSEATFTIETSASALSDMAGSGSY
YDKATAEQLAKTFPYLLQSDLLQSLLRQELGVSWLNGSISARAVDNTSLFSLRVTSTSAQDAYDILETVIRIYPRVADYV
VGSTEMHILTQPAVAAQPDAPFDPVRSICKGALLGLALGLAVVLLFAATRRTVRTPEEVKRRLNQTCLASLPAVRFKRRS
GQFDRTISIQNPRISGAFLENVRSLRIKFLREAEGRKVIMVSSTLPGEGKTTVAVNLALTLSQNGARVILVDLDLRKPSV
KRCLGVSVPSRGAPELLNLRGADPREHLLTLEGTQVRLLAGDEPSSNPRRQMESRRLEALLTTLREEADYVILDTPPCGL
LGDGAALAGLADASLYVVRSGTAQVSHILDSLQFLAGSGTPLMGCVLNGASGGGGRYGYGYGYGYGGDHYGKYHAYRQEK
>gnl|bykdb|A0A0S3KC41 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus silesiacus] (length=233 residues).
MANKGRVQKKQKTKAVSLITLADKTSPISEQYRTIRTNIQYAMVDRDLKTLVITSSGPSEGKSTTSANLAIVFANSGKRV
LLVDADMRKPTVAKTFSLDNIRGLSTLLGSRETMLHQVVQSSGVDNLFLMTSGPKPPNPSELLDSRRMKELILELKHQYD
LVIFDMPPVVAVTDAQIVASKSDGTILVVRENVSKRDSLLKAKSLLELVDANILGVVYNGSKNITDQGYYYGT
>gnl|bykdb|A0A0S3TG69 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus parauberis] (length=239 residues).
MARLELVKSKKELYDIAEEYYNSIRTNIQFSGRDLKVITLTSVQPGEGKSTLSANIAISFAKAGLKTLLIDADIRNSVMS
GTFKADEKYEGLSSYLSGNAELSAVISHTNIENLMLIPAGHVPPNPTTLLQNSNFNFMIDTVKELFDYVIIDTPPIGLVI
DSAIISQKADANILVTEAGAIKRRFIQKAKEQMEQSGALFLGVILNKVEETLDSYGGYGSYGAYGNYGKPAKKKSRKRR
>gnl|bykdb|A0A0S6U5S1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium botulinum B str. Osaka05] (length=236 residues).
MNRNLELITIKDPKSPISESYRILRTNIQFSSFDEKISVIFVTSSTPGEGKSTTSANLAITMAQNGAKTILVDCDLRKPN
VHKLFKLSNIRGLSNLLIEDNSIDGVIQQSSVENLHILTSGVKPPNPSELLSSRKMNKFIETSKKHYDYIILDTPPVGVV
TDAQLVSQYSDGGILVTASGQVERELAIRAKQLLEKVNAKIIGVVLNKVDTEFGNGYRYYNYYYEEDGEKKKRNKK
>gnl|bykdb|A0A0T7J365 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=229 residues).
MPTLEISQAKLDSVKKAEEYYNALCTNLQLSGDGLKVFSITSVKLGEGKSTTSTNIAWAFARAGYKTLLIDGDIRNSVML
GVFKARDKITGLTEFLSGTTDLSQGLCDTNIENLFVIQAGSVSPNPTALLQSKNFTTMLETLRKYFDYIIVDTAPVGVVI
DAAIITRNCDASILVTEAGEINRRDIQKAKEQLEHTGKPFLGIVLNKFDTSVDKYGSYGNYGNYGKNKK
>gnl|bykdb|A0A0T8AXE3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MPTLEIAQKKLEFIKKAEEYYNALCTNIQLSGDKLKVISVTSVNPGEGKTTTSVNIARSFARTGYKTLLIDGDTRNSVIS
GVFKSREKITGLTEFLSETADLSHGLCDTNIENLFVIQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTPPIGIVI
DAAIITQKCDASILVTAIGEVNKRDVQKAKQQLEQTEKLFLGVVLNKLDISVDKYGLYGSYGNYRKE
>gnl|bykdb|A0A0T8BFI8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MPTLEIAQKKLEFIKKAEEYYNALCTNIQLSGDKLKVISVTSVNPGEGKTTTSVNIARSFARAGYKTLLIDGDTRNSVIS
GVFKSREKITGLTEFLSGTADLSHGLCDTNIENLFVIQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTAPIGIVI
DAAIITQKCDASILVTATGEVNKRDVQKAKQQLEQTGKLFLGVVLNKLDISVDKYGVYGSYGNYGKK
>gnl|bykdb|A0A0T8I9C6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A0T8PZY9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MIFRKKKARRGLAQISVLHNKSVVAEQYRTIRTNIEFSSVQTNLRSILVTSSVPGEGKSFSAANLAAVFAQQQEKKVLLV
DADLRKPTINQTFQVDNVTGLTNVLVGNASLSETVQKTPIDNLYVLTSGPTPPNPAELLSSKAMGDLISEIYEQFSLVIF
DSPPLLAVADAQILANQTDGSVLVVLSGKTKTDTVLKAKDALEQSNAKLLGALLNKKKMKKSEHYSY
>gnl|bykdb|A0A0T8QNK2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MPTLEIAQKKLEFIKKAEEYYNALCTNIQLSGDKLKVISVTSVNPGEGKTTTSVNIARSFARAGYKTLLIDGDTRNSVIS
GVFKSREKITGLTEFLSGTADLSHGLCDTNIENLFVIQSGSVSPNPTALLQGKNFNDMIETLRKYFDYIIVDTAPIGIVI
DAAIITQKCDASILVTATGEVNKRDVQKAKQQLEQTGKLFLGVVLNKLDISVDKYGVYGSYGNYGKK
>gnl|bykdb|A0A0T8QT90 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MPTLEIAQKKLEFVKKAEEYYNALCTNIQLSGDKLKVISVTSVNPGEGKTTTSVNIARSFARAGYKTLLIDGDIRNSVMS
GFFKSREKITGLTEFLSGTADLSHGLCDTNIENLFVVQSGTVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTAPIGIVI
DAAIITQKCDASILVTATGEVNKRDVQKAKQQLEQTGKLFLGVVFNKLDISVDKCGVYGFYGNYGKK
>gnl|bykdb|A0A0T8Y3R6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=204 residues).
MCTNIQLSGDKLKVISVTSVNPGEGKTTTSVNIARSFARAGYKTLLIDGDTRNSVISGVFKSREKITGLTEFLSGTADLS
YGLCDTNIENLFVVQSGSVSPNPIALLQSKNFNDMIETLRKYFDYIIVDTPPVGIVIDAVIITQKCDASILVTATGEANK
RDVQKAKQQLEQTGKLFLGVVLNKLDISVDKYGVYASYGNYGKK
>gnl|bykdb|A0A0T9AGT6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MPTLEIAQKKLEFIKKAEEYYNALCTNIQLSGDKLKVISVTSVNPGEGKTTTSVNIARSFARAGYKTLLLDGDTRNSVIS
GFFKSREKITGLTEFLSGTADLSHGLCDTTIENLFVVQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTAPIGIVI
DAAIITQKCDASILVTATGEVNKRDVQKAKQQLEQTGKLFLGVVLNKLDISVDKYGVYGSYGSYGKK
>gnl|bykdb|A0A0U0BLL0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MPTLEIAQKKLEFAKKAEEYYNALCTNIQLSGDKLKVISVTSVNPGEGKTTTSINIAWSFARAGYKTLLIDGDTRQSVMS
GVFKSREKITGLTEFLSGTADLSYGLCDTNIENLFVVQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTPPVGIVI
DAVIITQKCDASILVTATGEANKRDVQKAKQQLEQTGKLFLGVVLNKLDISVDKYGVYASYGNYGKK
>gnl|bykdb|A0A0U0CXW4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=226 residues).
MGFRKKKSRRGLAQISVLHHKSLVAEQYRTIRTNIEFSSVQTHLRSILVTSSVPGEGKSFSAANLAAVFAQQEKKVLLVD
ADLRKPTIHETYQLENVQGLTNVLVGNASLGETVQKTLIDNLYVLTSGPTPPNPAELLSSKAMGELIQEMYSRYSLVIFD
SPPLLAVADGQILANQTDGSVLVVLSGKTKMDTVQKAKDALQQSKAKLLGALLNKKKIKKTEHYSY
>gnl|bykdb|A0A0U0CYW6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=229 residues).
MLTRKKDKPGKRSVIAMSEPKSINSEQYRTIRTNIEFSSVDTEVKSLLITSAGPEEGKSTTAANLAVVFAQQGKKVLLID
ADLRKPTVHFTFKLDNGTGLTSLLLKQLPFQKAVLPADEANLDILTSGPIPPNPAELLSTGAMKDLLSEAATVYDKVILD
TPPVLAVADTKILGSYTDGAIMVISSGKTDKEKAAKAKEALDYCPCKLLGAVMNGKKQTKHSDYAYYGQ
>gnl|bykdb|A0A0U0EUP5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNVEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSLYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A0U0I8N0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQLDNIFGLTNVLTNSERLEKCIQATSVDNLGFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSEATEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A0U0IPK3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=252 residues).
MSFFRNRTDKKNRLLTDTMTNGARLIAAAELKNPVVEQFRTIRTNIDFASVAKGDIKTLLISSALPSEGKSTVNANLAVV
YAQQGKKVLLVDADLRRPTVAATFGDDRTTVGLTNYLSDNKKEISDVIKTSGIPNLDIITSGPIPPNPAELLGSGIMTEL
IDKLKSVYDLVIFDVPPFLMVTDAQVLLSKVDGVAIVVNGGKSNKSDLKRTYEILQLSEVPLLGFIYNDKNNKKNSGYGY
GYGYGYGTTADK
>gnl|bykdb|A0A0U0MPC3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MPTLEIAQKKLEFIKKAEEYYNALCTNIQLSGDKLKVISVTSVNPGEGKTTTSVNIARSFARTGYKTLLIDGDTRNSVIS
GVFKSREKITGLTEFLSGTADLSHGLCDTNIENLFVIQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTPPIGIVI
DAAIITQKCDASILVTAIGEVNKRDVQKAKQQLEQTEKLFLGVVLNKLDISVDKYRGYGSYGNYRKE
>gnl|bykdb|A0A0U1KJQ7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paraliobacillus sp. PM-2] (length=233 residues).
MARRKKQAKNTAIRHLIAKLNPKSPISEQYRTIRTNLQFSSVDGEMKKILVTSSGPSEGKSSTVANLAIVFAQQGKKVLL
IDGDMRKPTVHYTFRIDNRRGLSSVLVSEATLEESIEKSDVADLDILTCGPIPPNPSELLGSKAMGKLMEQACEYYDIVL
FDTPPVLAVTDAQILANSCDGSILVLRSKQTDYEAAQKARDLLQPANAKLIGAVLNDRDMKKGNSYYYYYGNH
>gnl|bykdb|A0A0U1KTG0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Sporomusa sp. An4] (length=246 residues).
MTQQRKLIVHEDAKSPIAEAYRTLRTNIQFARVDSDLRTIMFTSAGPGEGKSTTTANTAVAIAQTGKRVIIVDCDLRKPV
QHKIFGKRNRGVTNILVEELTVKDLVQDTDIDNLKILTSGPIPPNPSELLGSYKMQEVIAALQEVADIVIIDAPPTVAVT
DACVLASKVDGIVLVLDSKAIRPEMAQKAKENLLKANGCILGVILNRVEIEEEHAYYYYYYGDQKKIEKIRFGYILMRRK
FGSTCS
>gnl|bykdb|A0A0U1L4W2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Sporomusa sp. An4] (length=231 residues).
MMNDRTLIVNHSPKSIWAEAFRAFRTKILHSKKGSIVKSILVTSAGAGEGKSVTVANTAVVLAQTGKKVILMDCDLRKPV
QHEIFKKRKTNRGLTNVLNGECSISDIVQDTGIPNLQLITSGSIRFNPSELLDSDKFKETISSLKSQADYIIIDSPPVLP
VTDACILGSKVDGIILVVGVGKVQPEMALKAKEHMEIVNGNILGIIINHYENFVEQSAYYHYCENVEKAAN
>gnl|bykdb|A0A0U1MTL6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=230 residues).
MTNTRRSTSSLIVHEQPKSPISEKFRGIRSNIMFANPDSAVQSIVITSEAPGAGKSTIAANLAVAYAQAGYKTLIVDGDM
RKPTQHYIFNLPNNEGLSSLLLNWSSYQDSIISTEIEDLDVLTSGPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPP
VNTVTDAQLFSKFTGNVVYVINSENNNKDEVKKGKELIEATGAKLLGVVLNRMPKDKSASYYAYYGTDES
>gnl|bykdb|A0A0U1MV54 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=228 residues).
MSKKENTTTTLFVYEKPKSTISEKFRGIRSNIMFSKANGEVKRLLVTSEKPGAGKSTVVSNVAITYAQAGYKTLVIDGDM
RKPTQNYIFNEQNNNGLSNLIIGRTTMSEAITSTEIDNLDLLTAGPVPPNPSELIASERFKELVDLFNERYDIIIVDTPP
VNTVTDAQLYARAIKDSLLVIDSEKNDKNEVKKAKALMEKAGSNILGVILNKTKVDKSSSYYHYYGDE
>gnl|bykdb|A0A0U1MV87 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=228 residues).
MSKKENTTTTLFVYEKPKSTISEKFRGIRSNIMFSKANGEVKRLLVTSEKPGAGKSTVVSNVAITYAQAGYKTLVIDGDM
RKPTQNYIFNEQNNNGLSSLIIGRTTMSEAITSTEIENLDLLTAGPVPPNPSELIGSERFKELVDIFNERYDIIIVDTPP
VNTVTDAQLYARAIKDSLLVIDSEKNDKNEVKKAKTLMEKAGSNILGVILNKAKVDKSSSYYHYYGDE
>gnl|bykdb|A0A0U1NQ42 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. LF1] (length=232 residues).
MTLKKKTTKTSSRRKLVTILDPKSPIAEQYRTVRTNIQFSSVDQELKTIMVTSSGPGEGKSTTAANLAVVFAQLGKKVLI
VDADLRKPTVHHTFGINTHIGFSTVLTKQADLTSAIVKTEEKDLYVLPSGPIPPNPSELLSSKSMEQFIADVKTVFDYII
FDTPPLLAVADPQILANQCDGAILVVYSEKTVREHAVKGKEMLENVKSKLLGVVLNHKELQKNDYYYYYGNK
>gnl|bykdb|A0A0U2ILF9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus naphthalenovorans] (length=231 residues).
MPTSTRNYNIITDVNPKSYISEAYRTLRTNIQFSTIDNHIRSIIVTSPEPSEGKSTTITNLAVAFAQEGKKVVLVDADLR
KPTLHHFFMKSNRIGLSNLLAGQFTLQQAISDTHIDNLSLICSGPVPPNPAEMLNSKRLEQQLEELKKMFDIILFDAPPT
LAVTDAQVLSTKCDGVVFVLNSGKVKRDTARKAIDRLNHVNAKILGVVLNNKDRNKNESPYYYYYGPNDKK
>gnl|bykdb|A0A0U2N769 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planococcus rifietoensis] (length=232 residues).
MRMLNQTASKRPLARKLVARIKPNSVISEQYRTIRTTINFSLPGNEMKTLLFTSASKEEGKSTTSANMAVVFAESGKKVL
LVDADMRKPTLHHTFNLNNHIGLSNLLVGKGELEQSVRDSGIRGLELLTSGQVPHNPAELLDSPVLDQLVAEMKERYDLI
IFDSPPILSVTDSKILANKCDGTVLVVNTGKTEKQSAIKARDSLATSRAYIVGVVMNNYKLSKDHYYSHEYN
>gnl|bykdb|A0A0U2N9S2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planococcus kocurii] (length=234 residues).
MVGQQKKPEVKNRKLITFTNPKSRVSEQFRTLRTNIHFTSPDGDIRSLVVTSASHSEGKSTTASNLAIVFAQEGKRVLFI
DADMRKPTMHHTFNIANTRGLSTVLSRQIALKMAIQPAEIKNLDLLPSGPIPPNPAELLSSNHMDFLLEHALDTYDLLIF
DTPPVLSVTDSVILANKCEGTILVVNSGKTEKAYALKAKEAITTATKARLLGAVLNNVKVQQESDYGQYYGVER
>gnl|bykdb|A0A0U2N9T6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planococcus kocurii] (length=231 residues).
MRTANKTKRLMPRKLVARTNPHSIAAEQYRTIRTNINFSTPDLHSRVILFTSAAKEEGKSTTAANMAIVFAETGKKVLLI
DADMRRPTLYRTFQLGNNTGLSNLLLRKGSLKQSVKVSGIANLDLLMSGQIPPNPAELLEADALDELIAEMRETYDYILF
DSPPILSVTDSKILANRCDGTVLVVNTGKSEKISVEKARDSLATAKALILGVVLNNYPMNKENYYYHNYNE
>gnl|bykdb|A0A0U2NMR5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus rotai] (length=233 residues).
MTNIVRAQKKQKTKAVSLITLADKSSPISEQYRTIRTNIQYAMVDRDLKTLVITSSGPSEGKSTTSANLAIVFANSGKRV
LLVDADMRKPTVAKTFSLDNARGLSTLLGSRETVLHQVVQNSGVDNLFLMTSGPKPPNPSELLDSRRMKELIQELKQQYD
LVIFDMPPVVAVTDAQIVASKSDGTILVVRENVSKKDSLLKAKSLMELVNANILGVVYNGSKNIEDQGYYYGS
>gnl|bykdb|A0A0U2PDM8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planococcus rifietoensis] (length=234 residues).
MAKKKQSLQATARKVVTHTTPRSFVSEQFRTLRTNVNFASPDLELRSIVVTSAAPGEGKSTTSANLATVFAQEGKNVLLV
DGDMRKPTTHYTFHMPNTIGLSNVLTRQATVEDAIRPTTIERLDLMTCGPIPPNPAELLASNAMGMLISDLKKRYDVVIF
DAPPVLSVTDGQVLANKCDGAILVVNSGSTEKEMAAKAKEAIEASNSKLIGAVLNNFELAKDSYYYQYYGNAEE
>gnl|bykdb|A0A0U2RJL2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus delbrueckii subsp. bulgaricus] (length=257 residues).
MAFGRKKHLNNDTMKNGVKLITLANPQSVISEQFRNIRTNINFMNVDKEVKTIVFTSAMASAGKSTVSANVAITMAQAGK
KTILVDADLRRPTMHSTFNVSNSNGLTTLLTSRSMEMDANSVIRESGVENLSILTAGPIPPNPSELLSSKHMLDLIEDLK
QEYDMVVLDLAPILDAGETQQLTSSLDGTILVVRQAHSQKLAVKRAVELLKLTKSPILGYVMNDVDADGDDGYGYGYGYG
YGYGEEKEKKGLFGRKK
>gnl|bykdb|A0A0U2UUZ5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. 32O-W] (length=227 residues).
MSRQNSEANLVTFVNPNSPISEAYRTLRTNIQFSSIDHPVQVIMCASAQSGEGKTTTISNLAVTYAHEGKNVLLIDADLR
KPTLHNVFVTSNRVGLSNLIAGQCALPEVTVETRINHLSVIPSGPVPPNPSELLGSQRMRAIMKDIRSRYDIILLDTPPV
LAVPDSLIVSSLSDGVIMVVQAGKVKSDMVRKAKAGLEHAKARILGVVLNRIKRNENAQFIRYYGSK
>gnl|bykdb|A0A0U2WGK5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. 32O-W] (length=229 residues).
MSRSHEARPLITDVNPLSPISEAYRTLRTNLQYAEVDRPLRLLMVTSASPREGKTTTVNNLAVAYAQTGKSVLLVDADLR
RPTAHHTFQTSNRCGLTHILTGQAKVADAVQNTSINGLKLLSSGSIPPNPSELLGSDKMDRLLAELRESYDIVLIDTPPV
LAVSDAQVVATRCDGVLLVVNAKSVKRRYVIKAKEALEFVHARVLGVALNQVPSSEANPYYEYSQEVRS
>gnl|bykdb|A0A0U2XZ07 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planococcus kocurii] (length=233 residues).
MARKKKVLQETARKLIAFTTPRSFVAEQFRTLRTNINFSSPDAEVHTLVITSAAPSEGKSTTAANLAVVFAQEGKKVLIV
DGDMRKPTTHYTFRMGNTIGLSSVLTRQNTIDEVIRPTAVEHLDLMTCGPIPPNPAELLASRSMTTLIDQLKNRYDLIIF
DAPPVLSVTDGQILANKCEGTILVVSSGNTEKDMAVKAKEAIESSNSRLIGAVLNNFALPKDNYYYQYYGTKE
>gnl|bykdb|A0A0U3NLF2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Carnobacterium sp. CP1] (length=247 residues).
MLAFLKGKHTRTVKQGNPSELEMVTHPASRISEQYRTLRANIQFSSVDNVLKTFVVTSAESGAGKSTIASNLALSFVSQG
MKVLLIDADMRKPVIHNLFKLTNRDGLTTLLSTKGLDEDRVIHKIGSSNLSVLTCGPVPPNPSELMASKRMQQLMNDLKK
RFDLIIVDVPPIIAVADAQIMANMADGTIFVIRKGISTKDSVMKAKELLEMSKATIIGSVFNGTVENEDMNSSYYGVEKK
GHHDSFY
>gnl|bykdb|A0A0U3PB70 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Carnobacterium sp. CP1] (length=234 residues).
MFKKKTKETNGERPSLITLTRPSSVIAEQFRTIRTNIQFSMIDQDLKTVVVTSAGPGAGKSTISANLAVTFASQGKKVLL
VDADMRKPTVHKTFRLPNHDGLTTLLTEKDVNISDIAHRAPTEGLFIITSGVIPPNPSELLASKRMDKLMNELDQIFDLI
IFDMPPVVAVTDAQVMASKVDGTIFVIPKGLTNKDMVLKSKDLLDKVHANVIGAIFNRVEMSGDNYYYYYGEKE
>gnl|bykdb|A0A0U3U526 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=186 residues).
KIGEGKSTTSTNIAWAFARAGYKTLLIDGDIRNSVMLGVFKARDKITGLTEFLSGTTDLSQGLCDTNIENLFVIQAGSVS
PNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGVVIDAAIITRKCDASILVTEAGEINRRDIQKAKEQLEHTGKPFLGV
VLNKFDTSVDKYGSYGNYGDYGKNKK
>gnl|bykdb|A0A0U4P935 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Aerococcus urinaeequi] (length=245 residues).
MFNFKSKKKQQKIENEQKLGSPIVTYFEPMSAIAEQYKTIRTNIEFAQIGSSINSIAVTSSISMEGKSTTTVNLANTYAQ
TGKKVLIVDADLRKPTLHKTFKLNNNVGLTTALVNDEYSLESVIQYSEDFDLYLLPSGPIPPNPAELVGSQEFSALLDQI
TELFDLVIFDTPPLHSVTDGQIIASKVDGTILVVRQNYVRRDQVVEAKVSLDNVKANLIGYILNDVPVNKNKGYGYYEYY
TEKDS
>gnl|bykdb|A0A0U4VW34 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Aerococcus urinaeequi] (length=249 residues).
MFKNKRKHFDKMNAEQRRGASLITVTQPNDVISESFRQIRTNIQFSMVDHDFKSIMFTSSGVWEGKSTVTANTAAVMAQQ
GLRVLLVDADLRKPTVAKTFNINTTVGLTSLLTDRDANIMDTVNYVADANIYILAAGPIPPNPSELLGSNRMAELIGELE
EMFDLVIFDTPPILAVTDAQVVATRVDGVIVVVRSGIANKNEVRKTKDLLDVVNANVIGAVYNGEDANKLGYGYGYGYGY
GYGQSETSK
>gnl|bykdb|A0A0U5JLQ6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus reuteri] (length=247 residues).
MSLFHRTQKQSTDTMDNGAKLITVAHPKSPISEQFRTIRTNINFMAIDKPIKTLAMTSANVSEGKSTVTDNVAVVWAQTG
QKVLLIDSDLRRPTLHATFNKSNQHGLTTILTSGTNSVDLREIIQPSGVENLDILTAGPIPPNPAELLNSQRMKTLLDTV
KGIYDMVIVDVPPMLEVTDTQILSRHLDAIVLVVKQEQTQKLAIKRAVELLNLAHANLLGYVMNDVNADGDAAYGYGYGY
GYGENTK
>gnl|bykdb|A0A0U5JMM0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus reuteri] (length=250 residues).
MSLFHRTQQQSTDTMDNGAKLITVAHPKSPISEQFRTIRTNINFMAIDKPIKTLAMTSANVSEGKSTVTDNVAVVWAQTG
QRVLLIDSDLRRPTLHATFSKSNQHGLTTILTSGTNSVDLREIIQSSGVENLDILTAGPIPPNPAELLNSQRMKTLLDTV
KGIYDMVIVDVPPMLEVTDTQILSRHLDAVVLVVKQGQTQKLAVKRAVELLNLAHANLLGYVMNDVNAEGDAAYGYGYGY
GYGYEEETNK
>gnl|bykdb|A0A0U5JSZ6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. C105KSO15] (length=233 residues).
MRKVTFRRKDKLDFKANEAFKTLRSNILFSGKDIKVLTLTSSTPNEGKTSISFQLASSFAAADNRVLFVDADIRKSVIAG
RYKVDGNTYGLTHYMTGQRTMEEVICQTDIKNMDIILAGPVSPNPTELLGGPLFAQLLEEQRDNYDYIIIDAPPLGSVID
AALIARYVDGAIIVVESAVISYKMLQRVKEQLEKSECRILGVVLNKVDMEHDAYYGNYYGKYYGKYYGNYGES
>gnl|bykdb|A0A0U5K170 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus reuteri] (length=248 residues).
MSLLHRTQQQSTDIMDNGAKLITVAHPKSPISEQFRTIRTNINFMAIDKPIKTLAMTSANVGEGKSTVTHNVAVVWAQTG
QRVLLIDSDLRRPTLHATFNKSNQHGLTTILTSGTNSVDLREIIQPSGVDNLDILTAGPIPPNPAELLNSQRMKTLLDTV
KGIYDMVIVDVPPMLEVTDTQILSRHLDAVVLVVKQGQTQKLAVKRAVELLNLAHANLLGYVMNDVNADGDAAYGYGYGY
GYGEDTNK
>gnl|bykdb|A0A0U5KEL8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus delbrueckii subsp. bulgaricus] (length=261 residues).
MAFGRKKHLDKDTMKNGVKLITLANPQSVISEQFRNIRTNINFMNVDKEVKTIVFTSAMASAGKSTVSANVAITMAQAGK
KTILIDADLRRPTMHATFNVSNSNGLTTLLTSRSMEMDANSVIRESGVENLSILTAGPIPPNPSELLSSKHMLDLIEDLK
QEYDMVVLDLSPILDAGETQQLTSSLDGTILVVRQAHSQKSAVKRAVELLKLTKSPILGYVMNDVDADGDDGYGYGYGYG
YGYGYGYGEEDEKKGLFGRKK
>gnl|bykdb|A0A0U5KTX0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus reuteri] (length=240 residues).
MDNGAKLITVAHPKSPISEQFRTIRTNINFMAIDKPIKTLAMTSANVSEGKSTVTDNVAVVWAQTGQKVLLIDSDLRRPT
LHATFNKSNQHGLTTILTSGTNSVDLREIIQPSGVDNLDILTAGPIPPNPAELLNSQRMKTLLDTVKGIYDMVIVDVPPM
LEVTDTQILSRHLDAVVLVVKQGQTQKLAVKRAVELLNLAHANLLGYVMNDVNADGDAAYGYGYGYGYGEDTNNAVCKIK
>gnl|bykdb|A0A0U5NZQ9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. C105KSO13] (length=228 residues).
MQEIVLRGLKKDYRSNEAYKTLRTNIEFSGEDNKAIVLTSCTPNEGKSTVSLALADSLAEAGKKVLFVDADLRKSVLTGR
HKVTGPIKGLSHFLAGQAKVSDIMYQTQEPGLVVMFAGVVPPNPAELLGQYKFKSLIESAKKVYDYIIIDAPPLGSVIDS
AIIAKQCDASVLVIAANTISYKFARAVKEQLEKSDCPILGVVLNKVDMKQNKYYGKYYGKYYGEYGKK
>gnl|bykdb|A0A0U5PAU7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. C105KSO14] (length=243 residues).
MSQFVTLNRIMKDDYHYNEAIKTLRTNIQFCGNGIKTIMLTSSLPDEGKSDITFAMASSLAQIGKKVVMVDADIRKSVLV
SRYHLEREVSGLSQYLSGQRSLENVLYDTNIENLSIIFAGPYSPNPADLLEESLFGDMISKLKEKYDYIIVDTPPMGNLI
DGAIVARQCDGAVMVIESGSISYRLEQRVKGQLEKSGCRILGVVLNKVNMKRNGYYSKYYGKYGKYSKYGHYGKYDRYGK
AEA
>gnl|bykdb|A0A0U9HL79 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Tepidanaerobacter syntrophicus] (length=244 residues).
MKQIQQQLNSNGLMVMDDPKSLVSEAFRLLRTNLQFMGVDKPLKRIVVTSSNPGEGKSFTIANLAMSIAATGSRVLLIDA
DLRKPRIHKIFLLENYRGLSSILAGDISADFVPQEAGIENLHIITSGPVPPNPAELLGSSKMKQFLNKVSSMYDIVLLDS
PPVNSVADTSILSTSVDGVILVVEAGSTPREAAILAKQQLEKVKAHILGVVLNKVKQTGSGYYYYYYYYGESGGHEKKRK
KRRS
>gnl|bykdb|A0A0V8BJS7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactococcus lactis subsp. lactis] (length=231 residues).
MAKNKRSIDNNRYIITSVNPQSPISEQYRTIRTTIDFKMADQGIKSFLVTSSEAAAGKSTASANLAVAFAQQGKKVLLID
GDLRKPTVNITFKVQNRVGLTNILMHQSSIEDAIQGTRISENLTIITSGPIPPNPSELLASSAMKNLIDSVSDFFDVVLI
DTPPLSAVTDAQILSSYVGGVVLVVRAYETKKESLAKTKKILEQVNANILGVVLHGVDSSDSPSYYYYGVE
>gnl|bykdb|A0A0V8EXX2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactococcus lactis subsp. lactis] (length=231 residues).
MSKKNEKLDSNRYLITSVNPKSPISEQYRTIRTTIEFKLADQGLKSFLVTSAEAGAGKSTTISNLAVTFAQQGKKVLLID
ADLRKPSVHMTFRLQNRSGLTNVLTRQISVNDAMQGTNFSENLAIISSGPVPPNPSELIGSAAMKNLIDSVTEAFDIVLI
DTPPLSAVTDAQILSRYIGGAVIVVRANQTKKESVTKAKKLLDQVNANILGVVLHGVEASDSAYYYYYGAE
>gnl|bykdb|A0A0V8J4Y3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Fictibacillus enclensis] (length=229 residues).
MRKTIKDLTQRSLITHNNPKSPISEQYRTIRTNIQFSSIDTHYQSIMVTSSSPGEGKSTTVANLAVVLAQQGKSVLLIDG
DLRKPTVHYTFKVSNIQGITNVLTRQISLEDAAVQTSVEDLSVLPSGPIPPNPSELLNSKSMEMLVEEAKSKYDYVLFDT
PPVLAVTDAQILANRCDGVVLVTSSGKTEKEAAIKAKELLDNANAKILGVVLNQKEMNENSYYYYYGAN
>gnl|bykdb|A0A0V8JJ77 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. SGD-V-76] (length=235 residues).
MVRKKQGNDKALTAKRRLVAHTNPKLPIAEQYRTVRSNIQFSNLDEDIRSLVMTSSGPGEGKSTTAANLAIVYAQQGKRV
LLIDADLRKPTAHFSFRLENYVGFTNVLTRKAKLLDAVHETNIPNLSVLTSGPIPPNPSELLASKNMDALLDEMYETFDF
ILFDTPPTLAVTDAQVLANKVEATILVISSGKTEREAAQKAKELLLNAKARLLGVILNNRKIEDGGHYYYYYGTN
>gnl|bykdb|A0A0W1B4F5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus etheri] (length=228 residues).
MSQLPNKQRHLITVTNPRSPVSEAFRALRTNIDFSSVDETIQVIMVTSSGPEEGKSTVSANLAAAYAQADKKVLLIDADL
RKPTAHKTFSLSNRFGLSSLLSQQAVLEDTVQDSGVSNLSIMTSGPIPPNPAEMMASNRMSTLLQDLRQRYDVILIDTPP
LLAVTDAQIMASKSDGVIMVVSYGKVKRDIAVKAKANLDRVGAKMLGVVLNNVKRKASEGYYYYYYGN
>gnl|bykdb|A0A0W1JR47 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Desulfitobacterium hafniense] (length=230 residues).
MRRYSIETLANPKSTVSEAYRTLRTNIQFANVDNVIKKILFTSAGPGEGKSSTVANLAVSIAQSGKSVLIIDGDLRNPTQ
HKIFNVPNTHGLSTTLVEEIHSLTHSVKTFTEGLELLPAGPIPPNPAELLGSKKMKQLLFDAAKAYDIILIDSPPTIAVT
DSSVLAQSVDGVVLILAAGEVKQEYALRAKEQLEKVGAKIIGTVINKVELKTKEHYYYYYYHGENRSQSI
>gnl|bykdb|A0A0W7TNU4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruthenibacterium lactatiformans] (length=241 residues).
MMAKKSKPIRREFVLMNKNTSFQYQEAYKSLRTNLNFMAMGKACKKLIFTSAIPGEGKSSVALNLAVSLAETGSRVLVID
CDLRKPIIHRYLKIDNSAYKGIISALADGSLAESIINMKGLGLHVMVADAIPPNPVELLGSPRMKNLIDELDKHYEYIIF
DTPPVSVVTDAAVLSQYADGVILVVRQNYATFDEVGLAKKNLDAVNANILGAVLNGFDTKSTEKKNGYYYSYNYSYENAD
R
>gnl|bykdb|A0A0W7YJR0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lysinibacillus sp. F5] (length=232 residues).
MFFKRKTKKIPMARKLITVSDMSSIPSEQYRTIRANIKFSQPNRDVKTILVTSSIAGEGKSTNAANIGVVFSQEGKSVLI
VDADMRKPTLHHTFYLDNILGLSSVLSRQSALQEVIQETFVEGVDIISSGPIPPNPTELLASETMTSLLAEVKNIYDIII
LDAPPLLFLSDAQILSNKCDGTLLIVNTGAVGQADVIKSKSILTVSKANILGVILNNYKIKGNTYEHYYGKE
>gnl|bykdb|A0A0X1TJ17 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Turicibacter sp. H121] (length=238 residues).
MSSELITITNPKSPIAEAYRTLRTNIQFSNVDEDLKVICVTSSGPSEGKTTTSCNLAETFAQSGKRVLLIDGDLRKPRVH
KVFKISGTKGLTNLLAGQLSLEEVTSYVGSDLTVIPCGPIPPNPSELIASNRMKELVANLRQQYDMVIIDAPPVGVVTDS
AILSTIVDGTLLVVASGKTEIDGAKRAKQLLENVNARILGVVMTMIPVTKKGYYGYQYYSYEEEVQTTRRKRSFFSKK
>gnl|bykdb|A0A0X8FEU3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Aerococcus urinae] (length=235 residues).
MFGRKKKTEIKKPADRPGLVVVDNPTSAMAEQFRTIRTNIQFSMLDKELKTFNITSPGPSSGKSFLAANIAAAFASDDKR
VLLLDADMRKPTVHKTFGVLNDRGLTNLLTDNRLEIHQVIKKSYVPNLFYLTCGAIPPNPSELLASKRMQELMEQLRNVF
DIIVLDCPPVLAATDAQVVSARADGTVVVVPYGQCSKDEVKESQALLDKVNTNVLGVIMNRTERTEDYYYYYEEE
>gnl|bykdb|A0A0X8GYC0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Erysipelothrix larvae] (length=244 residues).
MISFKKRNKQVKKNKTYILSNKSPFAYLEGYKSLRTNLSFLTFSGEVKTILVTSSVPNEGKSTVSINVARTLSMAGHKVL
LIDADLRAPVIQKYLNVNYKITSGLSSVLASKAQIKDAIYKSPSLEMDVIFSGPIPPNAVELLSRDRAKTSIETLRKRYD
YIIIDSPPAGVVTDSVVLSQHVDGVLYVVRQNHAEKELVKNAMKDLVSMEANILGIIFNDYIDERSKRKGSRDKYSYYYQ
SGNK
>gnl|bykdb|A0A0X8H0Y4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Erysipelothrix larvae] (length=244 residues).
MFRKKAMLSASNHNKIDILDDNSSFSFVEGYRSLRTNLSFMTYSGDVKTILVSSSLPGEGKSSVSVNLARSLSMAGKKVL
LIDADLRSPSVHKYLRIRKKVQDGFSTVLAGRTKLEDAIYMFPPLEIDVMLSGSIPPNASELLSREHTGEIMSELKEKYD
VVIIDTPPAGVVTDAVVLSRYVDGLLFIVKQNYAEIDLIKHALKSFEQTGTKVLGVVMSDYKSTKDTRGSGSYAYDYTYG
VDSK
>gnl|bykdb|A0A0X8H118 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Erysipelothrix larvae] (length=257 residues).
MSKKKRKSSRVHPTQTDIIDPKSPFQFIEGYRSLRTNLGFTTFNGEVKTILVTSALMGDGKSSVSINLARIMSMSGKKVL
LIDGDMRSPSIHKYLKIRSKVKEGFSSVIAGRTTVNEAIYSFPALEIDVMLSGPIPPNASELLSHEHTKKVLDELRGKYD
MVIVDTPPAGIVTDAVVLSNYVDGVLFVVKQNYAEKEVVKGTLKAFSGTESKILGVVMNDYSISKNLSRYRSYEYRYGYG
YGYGYGYGHGAGDDSEQ
>gnl|bykdb|A0A0X8JZA8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. oral taxon 431] (length=227 residues).
MAKLELSQQKLNSVKKAEEYYNALRTNIQLSGNNLKVIAVTSVDPSEGKSTTATNVAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTDYLAGTQDLSNGLCETNVENLFMIQSGAVSPNPTALLQSDKFGSMIETLHKYFDYIIVDTAPIGVVI
DAAIIVQKCDASILVAEAGVAKRREIQKAKSQLEHTGTPFLGVILNKFDVQRERYGSYGSYGSYGKK
>gnl|bykdb|A0A0X8KHR5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. SDLI1] (length=226 residues).
MGFRKKKSRRGLAQISVLHHKSLVAEQYRTIRTNIEFSSVQTHLRSILVTSSVPGEGKSFSAANLAAVFAQQEKKVLLVD
ADLRKPTIHETYQLENVQGLTNVLVGNASLDETVQKTLIDNLYVLTSGPTPPNPAELLSSKAMGELIQEMYSRYSLVIFD
SPPLLAVADGQILANQTDGSVLVVLSGKTKMDTVQKAKDALQQSKAKLLGALLNKKKIKKTEHYSY
>gnl|bykdb|A0A0X8KK58 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. SDLI1] (length=213 residues).
MSEPKSINSEQYRTIRTNIEFSSVDTEVKSLLITSAGPEEGKSTTAANLAVVFAQQGKKVLLIDADLRKPTVHFTFKLDN
GTGLTSLLLKQIPFQKAVLRAEEANLDILTSGPIPPNPAELLSTGAMRDLLSEAALVYDKVILDTPPVLAVADTKILGSY
TDGAIMVISSGKTDKEKAAKAKEALDYCPCKLLGAVMNGKKQTKHSDYAYYGQ
>gnl|bykdb|A0A0X8KKT5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Gemella sp. oral taxon 928] (length=231 residues).
MAEISVLNNEKIVDSSIKEYYNALRTNVQFLGKDIKVIAITSTSENEGKSTVSINLAISLAELGLKTVLIDADTRKSVMA
GRFKFKNKINGLTNYLSGVSPIEDIIYETDVNNLNIIPAGQVPPNPTGLLQNRNFNVMIDVFKEYYDYIIIDTPPIGAVV
DAAIISQKCDGFAIVVESNKIKKKVLEKSKEQLEKAGSKFLGVILNKVDVKEVTYGGYGAYGGYGEYGKEN
>gnl|bykdb|A0A0X8PS69 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus gallinarum] (length=234 residues).
MAKKQERTGTQTHAVSLITLIDPSSPISEQYRTIRTNIQFASSADKQIKTIVVTSSGPGEGKSTTSANLAVVFAKSGQRV
LLVDADMRKPTVYKTFSLNNASGLSTVLSTSTSVLEAAQKTVIDNLSVLTSGPKPPNPSELLGSARMNQVMEEAKNLYDV
VIFDMPPVVAVTDAQIMASKADGTILVVRENVARKESLTKARDLLNMVQARIIGVVYNGAEHSKDSGYYYYYGN
>gnl|bykdb|A0A0Y0NR49 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MPTLEITQKKLEIVKKAEEYYNALRTNIQLSGDNLKVISITSVKPGEGKSTTSTNIAWAFAHAGYKTLLIDADIRNSVMS
GVFRFSEKITGLTEFLSGTTDLSQGLCDTNVENLFVIQAGSISPNPTALLQSENFRTMIDTLRKYFDYIIVDTAPIGIVI
DAVIVTQKCDASVLITAVGEVHRRDVQKAKEHLEQTGKPFLGVVLSKLNTSIEKYSSYGGYGNYGNK
>gnl|bykdb|A0A0Y1WAI3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=248 residues).
MPLLKLVKSKADFAKKTEEYYNAIRTNIQFSGANFKVIAVSSVQPGEGKSTTSVNLAISFASVGLRTLLIDADTRNSVLS
GTFKSNEPYKGLSNFLSGNASLGEVICETDVPGLHVLSSGPVPPNPTSLLQNDNFVQLLEIVRAQYDYVIIDTPPIGLVI
DAVIIAHQADASLLVTAAGRIKRRFVTKAVEQLQQSGSEFLGVVLNKVDLAIDKYGSYGSYGSYGSYGEYGGDKHTENKS
RKHRRKRG
>gnl|bykdb|A0A0Y3JII9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MAKLELSQQKLNTVKKAEEYYNALRTNVQLSGNNLKVIAVTSVDPSEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSRERITGLTDYLAGTQDLSNGLCETNVDNLFVIESGVASPNPTALLQSDNFEIMIETLRKYFDYIIVDTAPIGVVI
DAAIVVQKCDASILVVEAGVAKRREVQKAKSQLEQTGKPFLGVVLNKFDIQREKYGSYGGYGNYGKR
>gnl|bykdb|A0A0Y9AUF9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=228 residues).
MSKKENTTTTLFVYEKPKSTISEKFRGIRSNIMFSKANGEVKRLLVTSEKPGAGKSTVVSNVAITYAQAGYKTLIIDGDM
RKPTQNYIFNEQNNNGLSNLIIGRTTMSEAITTTEIDNLDLLTAGPVPPNPTELIGSERFKELVNLFNERYDIIIVDTPP
VNTVTDAQLYARAIKDSLLVIDSEKNDKNEVKKAKTLMEKAGSNILGVILNKAKVDKSSSYYHYYGDE
>gnl|bykdb|A0A0Z0KIU0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=230 residues).
MTNTRRSTSSLIVHEQPKSPISEKFRGIRSNIMFANPDSAVQSIVITSEAPGAGKSTIAANLAVAYAQAGYKTLIVDGDM
RKPTQHYIFNLPNNEGLSSLLLNWSTYQDSIISTEIEDLDVLTSGPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPP
VNTVTDAQLFSKFTGNVVYVVNSENNNKDEVKKGKELIEATGAKLLGVVLNRMHKDKSASYYAYYGTDES
>gnl|bykdb|A0A0Z8DFU7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MAKLEIARTKKELVNKTEEYFNAILTNIQLSGADIKVVGITSVQTNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMS
GFFKPVTKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKISPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQRCDAMVLIAEAGSVKRSSLKKVKEQLDQTGTPFLGVILNKYDIITEKYGEYGNYGNYGKKA
>gnl|bykdb|A0A0Z8E9B6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGHVKRSSLKKVKEQLVQTGTPFLGVILNKYDIANEKYSEYGNYGHYGKKA
>gnl|bykdb|A0A0Z8EWW1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMS
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGHVKRSSLKKVKEQLDQTGTPFLGVILNKYDIANEKYSEYGNYGHYGKKA
>gnl|bykdb|A0A0Z8LFC4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MAKLEIARTKKELVNKTEEYFNAILTNIQLSGADIKVVGITSVQTNEGKSTMAASLAIAYARSGYKTVLVDADIRNSVMS
GFFKPVTKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKISPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQRCDAMVLIAEAGSVKRSSLKKVKEQLDQTGTPFLGVILNKYDIITEKYGEYGNYGNYGKKA
>gnl|bykdb|A0A0Z8MR63 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGSDIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGHVKRSSLKKVKEQLDQTGTPFLGVILNKYDIANEKYSEYGNYGHYGKKA
>gnl|bykdb|A0A0Z8NNQ6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMS
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVLVAEAGYVKRSTLKKVKEQLDQTGTPFLGVILNKYDIATEKYGEYGNYGNYGKKA
>gnl|bykdb|A0A0Z8RBW7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MAALEIARKKKELVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLALAYARSGYKTVLVDADIRNSVVS
GFFKPMTKITGLTDYLAGTTDLSQGLCDTDIPNLTAIESGKVSPNPTALLQSKNFENLLATLRRYYDCVIVDCPPLGLVI
DAAIIAQKCDAMVLVAEAGNVKRSSLKKVKEQLDQTGTPFLGVILNKYDIATEKYGEYGNYGNYGKKA
>gnl|bykdb|A0A0Z8U8Q6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKKELVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMS
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLIATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVLVAEAGNVKRSSLKKVKEQLDQTGTPFLGVILNKYDIATEKYGEYGNYGNYGKKA
>gnl|bykdb|A0A0Z8XL71 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARKKKELVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAATLALAYARSGYKTVLVDADIRNSVVS
GFFKPMTKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDCVIVDCPPLGLVI
DAAIIAQKCDAMVLVAEAGNVKRSSLKKVKEQLDQTGTPFLGVILNKYDIATEKYGEYANYGNYGKKA
>gnl|bykdb|A0A101D6X9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Thermoanaerobacter thermocopriae] (length=235 residues).
MVVARNPIVADPKSPFAEAFRALRTNLQFTSVDRKVKSILITSSLPNEGKSTIVKNLSYSVALTGSKVIVIDADLRNPTV
HKTFNLSNSRGLTNLLIDEGDYEAYLNVDTSYSNLHILTSGPIPPNPAELLGSNRMKKLLSSIQENYDYVFIDSPPVVIV
TDAVVLAPVVDGVILVIQAGKTEIGAVSRAKEILESVKANILGVVLNRVKESHGGYYYYYYYDDNKPQHRKRRKR
>gnl|bykdb|A0A101H909 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridiales bacterium 38_11] (length=225 residues).
MKDIIVHKQPKSPVSEAYRGIRTNISFDNVDKSFKSILVTSPKEGEGKTTTLCNLAMTFALSSNSVIIVDTDLRRPKLHK
LMEISNINGLTDILLKGDDYRKYINSSVHPNLDLITSGTIPDNPSEILGSDAVKRLIEELKKDYDYVFLDTPPVVPVNDA
IIMSTYVDRVILVLASGEVEQEVAIKAVRDLQKVGAKILGTVLNKVPINKQKYNYYYYYSNELGE
>gnl|bykdb|A0A101XY67 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. DMB5] (length=228 residues).
MSQQPNKQRHLITVTNPRSPVSEAFRALRTNIDFSSVDERIQIIMVTSSGPEEGKSTVTANLAAAYAQADKKVLLIDGDL
RKPTAHKTFSLSNRYGLSSLLSQQSELRDVLQDSGVPNLSIMTSGPIPPNPAEMMASNRMSTVLQELRQQFDVIMFDTPP
LLAVTDAQIVASKSDGVIMVVSYGKVKRDIAVKAKANLDRVGAKMLGVVLNNVKRKASEGYYYYYYGN
>gnl|bykdb|A0A109MUB5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus simplex] (length=225 residues).
MRSKDKKQVNLIAQNNPKSPITEQYRLIRTNIQFASVDEDIQTIVVTSAEPNDGKSTTSANLAIVLAQEEKKVLLVDADL
RKPSVHYAFSLSNIQGLTSVLTKKMSIEKAVMKTAVPNLEILTSGPIPPNPSELLNSRAIEATIHHLKEMYDYIIFDTPP
VLVVPDSQIVANKCDGVIMVVSSGKTNKQSAVKAKELLTKANTTVLGVVLNGVETDNSNYYYYQS
>gnl|bykdb|A0A109MW30 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus simplex] (length=224 residues).
MTEAKKRSSISMLKSKSPVVEQYRTIRTNLQFSAVEKDIRSMIFTSANPGEGKSTTSINVAAVFAQQGKRILIIDADLRK
PSVHTNFNMENFLGLTNIITKQNQLQEAIQSSIYPNLDVLTSGPIPPNPSELLGSNGMENLLEEAKMNYDLVILDTPPVN
AVTDAQILANMTDGVVLVVSSGSTEIQQAKKAKELLQKADAKLLGAILNKKKQKYSDEYYYYGK
>gnl|bykdb|A0A109RC47 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Aerococcus christensenii] (length=257 residues).
MFNWKKRQMDKKNKVQRLGVGLMTVNDPNHVVSEQFRTIRTNIQFAVEEFQLKTLMFTSSGPFEGKSTVAANVATTMADL
DGVRVLMIDGDLRKPTVHKTFDLHSRRGLTTYLTDRTVSYMDVCEYIPEVNLYVMPAGPLPPNPAELLSSKRMNDLLSDV
SEVFDIVIIDAPPLLPVTDAQIIASRTDATIFVLREGVATYSNVQKSKGLLDSVNARVIGAIYNGADVSAMDAYYGYGYS
DEEIELEEFKSEEDHAL
>gnl|bykdb|A0A109RE50 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Aerococcus urinae] (length=251 residues).
MFNFKQRKIDKKNKEQRRGVSLITASDPNHVISEQFRTIRTNIQFAIDAYHLKTLMFTSSGPWEGKSTIAANVATTMAHL
DGVRVLMIDCDLRKPTVHKTFDIHSRKGLTTYLTDCDVDYMDVAQYVAEVNTYVIPAGPIPPNPAELLSSQRMSDLLEDV
TAVFDLVIIDAPPLLPVTDAQIIASRTDASVFVLREGVASYQDIQKSKRLLESVDANVIGAIYNGADGQGMNAYYGYGYR
DEDIDSEDLQS
>gnl|bykdb|A0A109UGJ1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Erysipelothrix larvae] (length=241 residues).
MFRKKVKKNKLNIFEGTHIIHDESPFAYLEGYKSLRTNLSFLTYGGEVKTILVTSSVAHEGKSTIAINLARSLAMAGNYV
LLIDGDLRAPVIQKYLKITNNINNGLSSVLANKIPAEEAIYKYPAMEIEIMFSGPIPPNAVELLSKGRAKRLIGELRERY
DYIIIDSPPSGIVTDAKVLSQSVDGLLYVVRQNFAEKDLIKRTTKDYIASGTNILGVVFNNFTQDNFARKRKFNNYYSSE
D
>gnl|bykdb|A0A110A1P4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus mitis] (length=227 residues).
MAKLELSQQKLNTVKKAEEYYNALRTNVQLSGNNLKVIAVTSVDPSEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSRERITGLTDYLAGTQDLSNGLCETNVDNLFVIESGVASPNPTALLQSDNFGIMIETLRKYFDYIIVDTAPIGVVI
DAAIIVQKCDASILVVEAGVAKRREVQKAKSQLEQTGKPFLGVVLNKFDVQREKYGSYGGYGSYGKR
>gnl|bykdb|A0A110G364 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MIFKRKKREKRDLSCISVLNPHSVIAEQFRTIRTNIEFTSIQTRLKSILVTSSLPKEGKSFTAANLAAVFAQQKKRVLLM
DADLRKPAIHEYFDLSPHTGLTNVLLNNCSLEEAILPTPIEHLELLPSGTIPPNPAELLSSSVMKQLFYEIEQQYDMVIV
DSTPLLPVADAKILANRTDGSILVVLSGKTKIAAVKKSKEVLEGTTGKLLGAMLNGKKVKKGRHYMY
>gnl|bykdb|A0A116JV85 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=231 residues).
MATLEIARTKKELVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMS
GFFKPITKITGLTDYLAGTTDLSRGLCETNIPNLTVIESGKISPNPTALLQSKNFENLLATLRRYFDYVIVDCPPLGMVI
DAAIIAQKCDAMVLVAEAGHVKRSAVKKVKEQLEQTGTPFLGVILNKYDIATEKYGDYGNYGNYGNYGKKA
>gnl|bykdb|A0A116KHG7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMS
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGNVKRSSLKKVKEQLDQTGTPFLGVILNKYDIATEKYSEYGNYGNYGKKA
>gnl|bykdb|A0A117J2D7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Megasphaera sp. DJF_B143] (length=232 residues).
MAEIDFITQYDSRSPISEAYRSIRTNLQFSGAGQDLKAVAFTSVLPNEGKSTTVANLAIVMGQDNKKVLLIDCDLRKPVV
HRRFELPNKGLTNCFAENIPLYQVIRKNVFPNLDIVTSGPIPPNPAELLGSSRMMDLLEEVDEDYDYIFLDMPPVLVVTD
AAIMGSKVDGVVLVLASGEVSPEEARQAKSLLEKGKANILGVVLNKMPYTHRHSHYYYYYYDEDHIKHKHHK
>gnl|bykdb|A0A117LAK6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Caldanaerobacter subterraneus] (length=234 residues).
MVVARNPIVADPKSPFAEAFRALRTNLQFTSVDRKVKSILITSSLPNEGKSTIVKNLSYSVALTGSKVIVIDADLRNPTV
HKFNLSNSRGLTNLLIDEGDYEAYLNVDTSYSNLHILTSGPIPPNPAELLGSNRMKKLLSSIQENYDYVFIDSPPVVTVT
DAVVLAPVVDGVILVIQAGKTEIGAVSRAKEILESVKANILGVVLNRVKESHGGYYYYYYYDDNKPQHRKRRKR
>gnl|bykdb|A0A120DJ23 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus crispatus] (length=261 residues).
MALFRKKRGTDDTIKHGAKLITVADPRSAVSEQFRTIRTNINFMAVDEEISTLAFTSANISEGKSTVTANVAITYAQAGR
KTLLIDGDLRRPTLHSTFNVKNNTGLTTVLTSEADEINLNDVVEESGIDNLSILTSGPIPPNPAELIGSRRMETFIELVK
SHYDMVIIDLAPVLEVSDTQELASHLDGVVLVVRQGVTQKAGITRAVQMLKFAKARILGYVMNDIRAENGGYGYGYGYGY
GYGYGAEKKKGLFGRKKSDDQ
>gnl|bykdb|A0A120IAT4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Aerococcus urinaehominis] (length=243 residues).
MFNRKAKKIEALNAEQKKGASLITVTKPNNPVSEMYRTLRTNIQFSVVDSELKSMMVTSSGPFEGKSMTTANLAAVMADQ
DMRVLLVDADMRKPTVQKTFDIHTTEGLTSLLTERDKQPMDVIKYVPETNVYVLTAGPKPPNPAELLSSQRMKDIFEELK
TIFDLIIFDTPPVLAVTDAQIIANMVDGVVMVVRQNVAQVDNLHKAKQLLEKAQANVLGVVYNGIENSKDAAYGYGYGYG
VDE
>gnl|bykdb|A0A120LLF8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus gallinarum] (length=213 residues).
MRSMKENYSIISEQVKLIRENVDYLCQQQDAQTILITSGESGTGKSTVSANLAVAYAQKGNRTLLIDADLRKPTQHYLFS
QEMHVGLSNYIRRDISIESCVQQVILEDCEFSIITSGAIMSNPNDLLASSKMTAALQEVKQLYDVVIIDTPPVNVVSDAL
ILAKKVDGVLLVIHADKTNKQSAKNAVKKLRLVNANILGVVANGTDTGENYYY
>gnl|bykdb|A0A122HCY9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=229 residues).
MTNTRRSTSSLIVHEQPKSPISEKFRGIRSNIMFANPDSAVQSIVITSEAPGAGKSTIAANLAVAYAQAGYKTLIVDGDM
RKPTQHYIFNLPNNEGLSSLLLNWSTYQDSIISTEIEDLDVLTSGPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPP
VNTVTDAQLFSKFTGNVVYVVNSENNKDEVKKGKELIEATGAKLLGVVLNRMPKDKSASYYAYYGTDES
>gnl|bykdb|A0A122MPK3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=228 residues).
MSKKENTTTTLFVYEKPKSTISEKFRGIRSNIMFSKANGEVKRLLVTSEKPGAGKSTVVSNVAITYAQAGYKSLIIDGDM
RKPTQNYIFNEQNNNGLSNLIIGRTTMSEAITTTEIDNLDLLTAGPVPPNPTELIGSERFKELVNLFNERYDIIIVDTPP
VNTVTDAQLYARAIKDSLLVIDSEKNDKNEVKKAKTLMEKAGSNILGVILNKAKVDKSSSYYHYYGDE
>gnl|bykdb|A0A125YRQ1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis ATCC 35037] (length=230 residues).
MPTLEIAQKKLDLARKAEEYYNALRTNIQLSGNNLKVIAITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSQGLCETNVENLFVIQAGSVSPNPTALLQSENFATMIDTLRKYFDYIVVDTAPIGVVI
DAAIITQKCDASVLVTAAGETNRRDVQKAKEQLEQTGKPFLGIVLNKLNTSVEKYGSYGAYGNYGNYGKK
>gnl|bykdb|A0A126UPY1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=225 residues).
MAMLEIARTKREGVNKTEEYFNAIRTNIQLSGVDIKVVGITSVKSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPMTKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKSFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGNVKCSSLKKVKEQLEQTGTPFLGVILNKYDIATEKYGEYGNYGKKA
>gnl|bykdb|A0A127DA97 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus simplex] (length=225 residues).
MRSKDEKQVNLIAQTNPKSPITEQYRLIRTNIQFSSVDKEIKTIVITSSEPNDGKSTTAANLAIVLAQEEKKVLLVDADL
RKPSIHYAFNLSNIHGLTSVLTKKMDLRKTILNSNVSNLDILTSGPIPPNPSELLNSKAIETAIEELKQMYDYIIFDTPP
VLIVPDSQIVANKCDGVIMVVSSGKTNKQSAVKAKELLVKANTSLLGVVLNGVETDNSHYYYYQT
>gnl|bykdb|A0A127EFH2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium perfringens] (length=217 residues).
MLILESNSQSVAAESYRTLRTNIQYSSFDNPVKSIVITSSEPGEGKSTTSANLALSFAQDGKRVIIIDCDLRKPVVHKNF
GISNSIGLSEFLIGKAEFSKVVYKHESGLHVLPSGLVPPNPAEMLASRAMEHLLTQLEEKYDYIILDTPPVNAVTDSKIL
STKVDGTILVVKYGYTKKDAVVEAVKGLRAVKANIIGTVFNGEEIQRGKYYHYYKKD
>gnl|bykdb|A0A127TU31 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. A12] (length=231 residues).
MATLEIVKSKLAAMTQAEEYFNALSTNIQLSGTNIKVVAISSVQPNEGKSTISTNLATAFARAGYRTLLIDADIRNSVMT
GVFKSQGRVAGLTEVLSGKSEISQAIATTDYPKLDVLLSGQVSPNPTGLLQSKNFEVIIEALRNHYDYIVVDTPPIGMVI
DAAIIAQRCDGSLIVTAAGAVSRKAVQKAKEQLEQTGTSFLGVVLNKFDIQLEKYGSYGNYGNYGNYGKKR
>gnl|bykdb|A0A127W2Q4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Sporosarcina psychrophila] (length=234 residues).
MFNKKKKPIQTVARKLVTYDSPKSVVSEQFRTVRTNINFSMPDKDLKTLLFTSSTPGEGKSTSASNVAIVFAEEGKKVLL
VDADMRKPTMHYTFHKTNSTGLSNLLTRKWELKDVVIETEIEGLHIVTSGPIPPNPAELLGSKTMDSLIEEFIAGYDIVV
FDAPPLLSVADAQILSNKCDGTILVISSGTAEKDSVIKAKEALVSSKANILGTLLNNFVLEKEHHYYQYYGTGE
>gnl|bykdb|A0A132P8E8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus faecium] (length=232 residues).
MARTQKQKAAQTHAVSLITLTNPSSPIAEQYRTIRTNIQFASAAGQQIKTIVVTSSGPGEGKSTTAANIAVVFAKSGQRV
LLVDADLRKPVVYKTFQLNNARGLSTALSSSGSVADVIQRTPVENLSILPSGPKPPNPSELLSSPRMDQILDEARQLFDV
VIFDMPPVVAVTDAQIMSSKTDGTLLVVRENTSRKESLNKAKELLEMVQARVLGVVYNGAEHSKDAGYYYGN
>gnl|bykdb|A0A132TVW4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus riograndensis] (length=228 residues).
MSQQPSKQRHLITVTNPRSPVSEAFRALRTNIDFSSVDEQIQIIMVTSSGPEEGKSTVTANLAAAYAQADKKVLLIDGDL
RKPTAHKTFSLSNRAGLSSLLSQQADLEDVVQDSGVANLSIMTSGPIPPNPAEMMASNRMSAVLQELRQRYDMILFDTPP
LLAVTDAQIVASKSDGVIMVVSYGKVKRDIAAKAKANLDRVGAKMLGVVLNNVKRKASEGYYYYYYGN
>gnl|bykdb|A0A133CEM5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus faecium] (length=232 residues).
MARTQKQKAAQTHAVSLVTLTNPSSPIAEQYRTIRTNIQFASAAGQQIKTIVVTSSGPGEGKSTTAANIAVVFAKSGQRV
LLVDADLRKPVIYKTFKLNNASGLSTVLSSSGSVADEIQRTPVDNLSILPSGPKPPNPSELLSSPRMDQILAEARQLFDV
VIFDMPPVVAVTDAQIMSSKTDGTLLVVRENTSRKESLTKAKELLDMVQARVLGVVYNGAEHSKDAGYYYGN
>gnl|bykdb|A0A133KEQ7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerococcus tetradius] (length=217 residues).
MSKKNTYYSASMYDEAIRSIRTNIQFSSLDKKNNIIAVTSTKPSEGKSTVIYKLAKSFADNGERVILIDCDLRSPSLYEI
AGINDNVGVTNYLTGKVSIQRAINKDRDQANLDLIFTGPVPPNPAEILASQVFKKFIEDLSEVYDYVFIDTPPVGLFTDA
SIVSTLCDGVIFVIKSSDTKKEDITLALDNLKKVDAHILGAVLTYVPMKDKRYGNYY
>gnl|bykdb|A0A133KZW2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus coagulans] (length=231 residues).
MAPKKTKLLNTRRKLIAKLNPTSPISEQFRTIRTNISFSSVDNDLQLLMVTSSGPGEGKSTIVGNLAVVFAQQGKRVLLV
DADLRHPTVHYTFGMTNTFGLTTVLTKQGTLEDTAVKTDVDHLHVLTSGPIPPNPAELLSSRAMKEFLKEAKEQYDIILL
DTPPVLAVTDAQVLTNQCDGTILVVSSGKAEVDAVKKSKDLLESANANLLGVVLNNKKTQNTHYYYYYGKD
>gnl|bykdb|A0A133LDL3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerococcus hydrogenalis] (length=223 residues).
MKENKMAKKRGYYNTKSIFDEAIRSVRTNIQFSDIDDKKRVIAMTSSKPSEGKTTVLYSIAKSFAENGNSVVLLDFDLRI
PKVGKVAGIETNMGLTNVITGKVELNRALIKDQNEDNLFVMLSGPVPPNPAEILASNHVKELIKELSQRFDYVFLDTPPV
GLFTDASIVSTYCDGVIFAIKSNDTKKEEVSHALENLKKVNGKVLGAILTFADLKESTYKGYY
>gnl|bykdb|A0A133MSB7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium perfringens] (length=217 residues).
MLILESNSQSVAAESYRTLRTNIQYSSFDNPVKSIVITSSEPGEGKSTTSANLALSFAQDGKRVIIIDCDLRKPVVHKNF
GISNSIGLSEFLIGKAEFSKVVYKHESGLHVLPSGTIPPNPAEMLASRAMEHLLTQLEEKYDYIILDTPPVNAVTDSKIL
STKVDGTILVVKYGYTKKDAVMEAVKGLRAVKANIIGTVFNGEESQRGKYYHYYKKD
>gnl|bykdb|A0A133MZD0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus faecium] (length=237 residues).
MKKESRENMKKKKIAASPVPLVALADQSITAEKYRTIRSNIQFAAIDRELNTLVITSSGPDEGKSITAANLAVVFANSGK
QVLLVDADLRKPTVALSFQLPHNEGLSNLLSERERIADDYITETHIENLWILPSGPKPPNPSEVLGTKRMEEIIEELILD
FDLVIFDMPPVATVTDAQILAAKTDGTLLVVRERKTKKQELLKAKELLQIAKANILGVVYNGTKKESDLTYYYQSFE
>gnl|bykdb|A0A133N3N4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus faecium] (length=232 residues).
MARTQKQKAAQTHAVSLITLTNPSSPIAEQYRTIRTNIQFASAAGQQIKTIVVTSSGPGEGKSTTSANIAVVFAKSGQRV
LLVDADLRKPVVYKTFQLSNASGLSTALSSSGSVADVIQRTPVENLSILPSGPKPPNPSELLSSPRMDQVLAEARQLFDV
VIFDMPPVVAVTDAQIMSSKTDGTLLVVRENTSRKESLTKAKELLEMVQARVLGVVYNGAEHSKDAGYYYGN
>gnl|bykdb|A0A133Q0D7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus lugdunensis] (length=231 residues).
MTKKNEKRKNLNTPLFTEDNSKSIVSEKVRGIRSNIMFSGVEEVKSIIVTSEKPAAGKSIISANIAITYAQAGYKTLIID
GDMRKPTQHYHFETTNYDGLSNLIIGKSNFDKSIIKTRVKNLDLMTAGPTPPNPSELIGSAAFENILRDLNEIYDFILID
TPPVISVTDAQVYLRYVPECVMIIDVQNNNKNEVKKAKELIEKVGGRVIGAVLNKTPKEKSSSYYYYGDDE
>gnl|bykdb|A0A133QRZ3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus simulans] (length=237 residues).
MIKENSQMKKKSKAINNPLMTHYDPKSVISEKFRGIRTNIMFSTANDDVKTLVITSEKPGVGKSLVSANIAVTYAQAGYK
TLLIDGDMRKPTQHYMFNTSNIDGLSNLIISKSYFEKAITKTEIDNLDLLTSGPIPPNPSELIGSIQFQNHLEELKEIYD
FIIIDTPPVNTVTDAQLFSEISGYAALVINVKNNDRKSILKSKELIENTGAKVLGVVLNKTEHEKNSSYYAYYGEES
>gnl|bykdb|A0A133S3A9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus mitis] (length=227 residues).
MPTLEIAQKKLEFIKKTEEYYNALCTNIQLSGDKLKVISVTSVNPGEGKSTTSINIAWSFARAGYKTLLIDGDIRNSVMS
GVFKSREKITGLTEFLSGTTDLSHGLCDTNIENLFVVQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTAPIGIVI
DAAIITQKCDASILVTAMGEANKHDVQKAKQQLEQTGKPFLGVVLNKFDVQREKYGSYGGYGNYGKK
>gnl|bykdb|A0A133ZSJ0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Gemella haemolysans] (length=237 residues).
MAQINLLTNKNIVDPKNEEYYNALRTNIQFLGKDKKVIVITSTSENEGKSTVSINLAISLAKLGLKTILVDADTRKSVMA
GRFKFKNKISGLTNYLSGVSPIEDVIYETDIQHLNVIPAGQVPPNPTGLLQNKNFNIMVEVFREYYDYVIIDTPPVGQVI
DAAIVAPKADGVVMVVEANRVKKKVVEKAKEQLEKGGAEFLGVILNKVNSNELGYGGYYGHYGGYGNYGANKKTDKK
>gnl|bykdb|A0A135WN68 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. JH7] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLENCVQTTSVENLNFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASVLVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLHYYYGVN
>gnl|bykdb|A0A135WPN8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Sporosarcina sp. HYO08] (length=236 residues).
MFVFKKKPKIIQAAARKIVTFTNPRSVVSEQFKTIRTNINFSMPDQKLEALMFTSASPNEGKSTVASNVAIVFAQEGKKV
LLVDADMRKPTTHYTFKTANAHGLTNVLTNQSTWQEVITETPISGLDILPCGPIPPNPAELIGSQKMVLLIEQLKQAYDL
IIFDTPPILSVTDAQILSNKCDGAILVINSGTSEKESVQKAAEALQNSKANVIGTVLNNYKLAKDHYYYQYYGNAE
>gnl|bykdb|A0A135YX31 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pasteurianus] (length=243 residues).
MPQLELVRAKAQMVKSMEEYYNSIRTNVQFSGRDLKVITLTSAQAGEGKSTTSVNLAISFARAGFRTLLIDADTRNSVMS
GTFKSNERYQGLTSFLSGNAELSDVICDTTIDNLMIIPAGQVPPNPTSLIQNDNFKTMIETVRGLYDYVIIDTPPLGLVI
DAAILAHYSDASLVVAKAGVDKRRTITKLKEQLEQSGSIFLGVILNKYDIHLDNYGAYGSYDGYGTYGAKEERSKKGKGR
RRK
>gnl|bykdb|A0A136BDP7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNVEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSTYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A136G1M4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus intestinalis] (length=227 residues).
MVFRKKKARRGLAQISVLHNKSIVAEQYRTIRTNIEFSSVQTNLRSILVTSSVPGEGKSFSAANLAAVFAQQQEKKVLLV
DADLRKPTINQTFQVENVTGLTNVLVGNASLSETVQKTPIDNLYVLTSGPTPPNPAELLSSKAMGDLISDIYEQFSLVIF
DSPPLLAVADAQILANQTDGSVLVVLSGKTKADTVLKAKDALEQSNAKLLGALLNKKKMKKSEHYSY
>gnl|bykdb|A0A136GD61 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus intestinalis] (length=238 residues).
MALRKSRGSWIRRNVIAMTEPKSLNSEQYRTIRTNIEFASVDRQMKSVMITSACPGEGKSTTAANLAVVFAQQGKKVLLI
DADLRKPTVHTAFHFENMIGLTTVLLKKSSLEQAVQASNATHLDVLTSGPIPPNPAELLSSKWMNELADEVCAAYDMVIF
DTPPILAVADAQILGNVADGSVLVISSGKTEKEQAAKAKEALESCKSKLLGAIMNGKKLSKHSEYGYYGNKENFIQNK
>gnl|bykdb|A0A136Q761 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Christensenella minuta] (length=296 residues).
MDIDYKKQALEAFNTIQTNIGFLGIDHDIRTIMVTSSIKGEGKSTVTSNIANSYAFSQKRVLLVDCDMRNPTVHRVLELP
NRKGLADLIMAGREGQDAGDYITHYGPYFDVLTAGHRPPNPTELLGSKRMEALIGLFSGQYDYVILDTPPVLLVPDAIAL
HPYVDGILLVVRHGYTTKEVLEDCKKAWEVAGTKPSACILNAIPDMQKRYSYYGYYDYEETQPAKGRGKNRRQPVIKREE
RQEKDMYTSIAKEAKEPHSRKDIHGAEPAEPEFIRKANTSGQGFQRQADRTKRKLH
>gnl|bykdb|A0A139CI15 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Candidatus Frackibacter sp. T328-2] (length=241 residues).
MEEVEVMSDETKRRVQSRDRELVVRHNPKSPLAESYRTLRTNIRFLSPDDPLQTIAMTSSTPSEGKSITIANLAISMTQN
GQEVIIIDTDLRKPMQHRFFKMTNFAGLSNILTNEIELKEGIRETGVERLKLVSSGSVPPNPSELLSSKKMTEVIEEVEE
LADIVLLDCPPIIAVSDPMVIANKVDGVILVVASHETEDKALVKAKEMLDKVQANIIGTILTKYRVGESKGYYSGYYHYY
G
>gnl|bykdb|A0A139M8X6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis] (length=227 residues).
MPTLEISQEKLDLVKKAEEYYNALCTNLQLSGDDLKVLSITSVNPGEGKSTTSTNIAYAFARAGYKTLLIDGDIRNSVMS
GVFKTRDKITGLTDFLSGTTDLSQGLCDTTIENLFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGVVI
DAAIITRKCDASILVTEVGETNRRDIQKAKEQLEHTGQPFLGVVLNRFDTSVDKYGSYGSYGDYGKK
>gnl|bykdb|A0A139MJ02 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. DD04] (length=236 residues).
MPRLELSRSRKASIEKTEEYYNALRTNIQLSGDNLKIIALTSVQPNEGKSTTSTNLAIAFARAGYKTILIDADIRNSIMS
GVFKSKEKITGLTDYLAGKTDLSQGLCETDVENLFVIESGQTSPNPTALLQGKNFDSMMNVLRKYYDYVIVDTPPIGLVI
DAAIIAQKCDASILVTEAGVVKRKLVQKAKEQLEQTDTPFLGVILNKYNVAMDKYGSYGIYGAYGNYGNYGKENTK
>gnl|bykdb|A0A139MZ47 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus gordonii] (length=231 residues).
MATLEIIKNKLAEMHQAEEYFNALSTNIQLSGSDIKVVAVSSVQPNEGKSTISINLSLAFARAGYRTLLIDADIRNSVMT
GVFKSQRKVEGLTEVLSGNADISRALADTDYPNLDVFLSGQVSPNPTGLLQGKNFEVIMGVLREHYDYIVVDTPPIGMVI
DAAIIAQRCDGSFLVSASGAVSRKAVQKAKEQLEQTGTPFLGVVLNKYDVSGDRYGVYGAYGNYGAYGKKH
>gnl|bykdb|A0A139N523 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus cristatus] (length=232 residues).
MPILELAKKKKISISRVEEYYNALRTNIQLSGENIRVIAVSSTFPGEGKTTTSTNLALTFAKAGHKTLLVDADIRNSKML
GGVFKSDGKVTGLTEYLSGTTDLSQGLCETDEPNLFVVTSGQISPNPTALLQSDRFATMMNVLRRHYDYIIVDTPPIGMV
VDATLISRVCDASLLVVAPKEVKRKMVQRSKMQLEQSSTPFLGVVLNKYNVEADKYGFYGSYGHYGDNLSKE
>gnl|bykdb|A0A139N761 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus gallolyticus] (length=245 residues).
MPQLELVRAKAQMVKSMEEYYNSIRTNIQFSGRDLKVITLTSAQPGEGKSTTSVNLAISFARAGFRTLLIDTDTRNSVMS
GTFKSNERYQGLTSFLSGNAELSDVICDTSIDNLMIIPAGQVPPNPTTLIQNDNFKAMIETVRGLYDYVVIDTPPLGLVV
DAAILAHHSDASLLVTKAGADKRRTITKLKEQLDQSGSIFLGVILNKYDIHLDKYGSYGSYGGYGSYGSYGKNTGKKLKS
KGMKE
>gnl|bykdb|A0A139N9M2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. DD10] (length=230 residues).
MPTLEIAQKRLDLFQKAEEYYNALRTNIQLSGNNLEVVTISSVKPGEGKSTTSINIAIAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTDFLSGNADLSNGLCDTNVENLFVIQSGQVSPNPTALLQSENFVTMLTTLRRYYDYIIVDTAPIGVVI
DAAIISQKCDATMLVTDSGETRRREVQKAREQLEHTGTPFLGVVLNKYDTKLEQYGSYGNYGSYGNYGKK
>gnl|bykdb|A0A139NX96 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis] (length=227 residues).
MPTLEIAQKKLDLARKAEEYYNALRTNIQLSGNNLKVISVTSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSQGLCETNVENLFVIQAGSVSPNPTALLQSENFATMLDTLRKYFDYIIVDTAPIGIVI
DAAIITQQCDASVLVTAAGETNRKDVQKAKIQLEQTSKPFLGIVLNKLNTSAEKYGSYGEYGSYGKK
>gnl|bykdb|A0A139P2I7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis] (length=227 residues).
MPTLEIAHKKLEQARKAEEYYNALRTNIQLSGNNLKVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSQGLCDTNVENLFVIQAGSISPNPTALLQSENFKTMLDTLRKYFDYIIVDTAPIGVVI
DAAIITQKCDASILVTAAGETNRRDIQKAKEQLEQTSKPFLGIVLNKLNTSVEKYGSYGAYGSYGKK
>gnl|bykdb|A0A139PA78 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. DD11] (length=231 residues).
MATLELVRKRRNLIKLTEEYYNALSTNVQLSGASIKLVEVTSVTANEGKSTTATNLAAAFARTGHRTLLVDADIRNSVMS
GVFKSQSKVSGLTDFLTGQAELQTILNDTDIDNLDVILAGPVSPNPTGLLQSRQFETLLANLRPRYDSIIVDTSPIGLVI
DAAIIAQKCDASLLVTEAGSVKRKAVMKAKEQLEQTGTPFLGVVLNKYNIDLERYGSYGAYGSYGNYGKSN
>gnl|bykdb|A0A139PFC1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis] (length=224 residues).
MPTLEISQAKLELAKKAEEYYNALCTNLQLSGDDLKVFSITSVKPGEGKSTTSTNIAWAFARAGYKTLLVDGDIRNSVMS
GVFKTRDKITGLTEFLSGTTDLSQGLCDTNIENLFVVQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGVVI
DAAIITRKCDASILVTAAGETNRRDIQKAKEQLEQTKKPFLGIVLNKFDTSVDKHGSYGDYGKK
>gnl|bykdb|A0A139PL27 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis] (length=227 residues).
MPTLEITQKKLELVKKAEEYYNALRTNIQLSGDNLKVISITSVNPGEGKSTTSTNTAWAFARAGYKTLLIDADIRNSVMS
GVFRSNEKITGLTEFLSGTTDLSQGLCDTNVENLFVIQAGSISPNPTALLQSENFRTMLDTLRKYFDYIIVDTAPVGIVI
DAVIVTQKCDASVLITAVGETHRRDVQKAKEQLEQTGKPFLGVVLNKLNISAEKYSSYGGYGNYGKK
>gnl|bykdb|A0A139PRD1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis] (length=230 residues).
MPTLEIAQKKLDLARKAEEYYNALRTNIQLSGNNLKVISVTSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSQGLCETNVENLFVIQAGSVSPNPTALLQSENFATMIDTLRKYFDYIVVDTAPIGVVI
DAAIITQQCDASVLVTAAGETNRRDVQKAKEQLEQTSKPFLGVVLNKLNTSVEKYGSYGAYGNYGNYGKK
>gnl|bykdb|A0A139Q1J5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis] (length=230 residues).
MPTLEIAQKKLDLARKAEEYYNALRTNIQLSGNNLRVIAITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSQGLCDTNVENLFVIQAGSISPNPTALLQSENFATMLDTLRKYFDYIIVDTAPIGVVI
DAAIVTQKCDASVLVTAAGETNRRDVQKAKEQLEQTGKPFLGIVLNKLNTSVEKYGSYGAYGNYGNYGKK
>gnl|bykdb|A0A139Q5Z0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis] (length=233 residues).
MPTLEIVQKKLDLARKAEEYYNALRTNIQLSGNNLKVISITSVKPSEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSQGLCDTNVENLFVIQAGSISPNPTALLQSENFATMLDTLRKYFDYIIVDTAPIGVVI
DAAIVTQKCDASVLVTATGETNRRDVQKAKEQLEQTGKPFLGIVLNKLNTSVEKYGSYGAYGNYGNYGNYGKK
>gnl|bykdb|A0A139QEL2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus constellatus] (length=230 residues).
MPRLELAKNKEKALKKSEEYYNALRTNIQLSGENIKVIAVTSVQSGEGKSTTSTNLAIAFARSGYNTLLIDADIRNSVMS
GVFKTRDKITGLTDYLAGAADLSNGLCDTNVENLFVIEAGQISPNPTALLQSKNFGMMIDILRNHYDYIIIDTPPIGIVI
DAAIIAQKCDASALVVESGNVKRKALQKAKGQLEQTGTPFLGVILNKYDTQLEKYGSYGNYGDYGNYGKK
>gnl|bykdb|A0A139QRC6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis] (length=230 residues).
MPTLEIVQKKLDLARKAEEYYNALRTNIQLSGNNLKVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSQGLCDTNVENLFVIQAGSISPNPTALLQSENFATMLDTLRKYFDYIIVDTAPIGVVI
DAAIVTQKCDASVLVTAVGEANRRDVQKAKGQLEQTSKPFLGIVLNKLNTSVEKYGSYGAYGSYGNYGRK
>gnl|bykdb|A0A139QYP0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis] (length=230 residues).
MPTLEIVHKKLDQARKAEEYYNALRTNIQLSGNNLKVIAITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEYLSGTTDLSQGLCETNVENLFVIQAGSVSPNPTALLQSGNFATMIDTLHKYFDYIIVDTAPIGVVI
DAAIITQKCDASVLVTAAGETNRRDVQKAKEQLEQTSKPFLGVVLNKFNTSVEKYGSYGAYGNYGNYGKK
>gnl|bykdb|A0A139R9K2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus mitis] (length=230 residues).
MPTLEIAQKKLDLAKKAEEYYNALRTNIQLSGNNLQVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLVDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSHGLCDTNVENLFVVQAGSISPNPTALLQSENFSTMIDTLRKYFDYIIVDTAPIGIVI
DAAIITQKCDASVLVTAAGEANRKDVQKAKDQLEQTNKPFLGVVLNKFNTSAEKYGSYGEYGSYGNYGRK
>gnl|bykdb|A0A139RC40 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus infantis] (length=227 residues).
MAKLELSQQKLNSVKKAEEYYNALRTNIQLSGNNLKVIAVTSVDPSEGKSTTATNVAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTDYLAGTQDLSNGLCETNVENLFMIQSGAVSPNPTALLQSDKFGSMIETLHKYFDYIIVDTAPIGVVI
DAAIIVQKCDASILVAEAGVAKRREVQKAKSQLEHTGTPFLGVILNKFDIQRERYGSYGAYGSYGKK
>gnl|bykdb|A0A139RPG0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis] (length=227 residues).
MPTLEIAHKKLEQARKAEEYYNALRTNIQLSGNNLKVVSITSVKPEEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSQGLCDTNVENLFVIQAGSVSPNPTALLQSENFATMLDTLRKYFDYIIVDTAPIGIVI
DAAIITQQCDASVLVTAAGETNRKDVQKAKSQLEQTSKPFLGIVLNKLNTSAEKYGSYGKYGSYGKK
>gnl|bykdb|A0A140DXM2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Faecalibaculum rodentium] (length=243 residues).
MAKKKKNVSNNSSRRTNRNDQLNLEEVYRQLRTNIEFSQMDSELRVLNVLSTHPNEGKSSVASNLAKIFADKYEKVLLID
CDLRTPSLHKMLRTSNGEGLTNLLTHYRQDDPLLEQDEIQELELDDQSSLFFLSAGSRVPNPTEIISSRRFASLINSARS
QFDQVIIDCPPAFAVSDAVPISNLSDGTLFVLSAKETDKNDAREAVDDLKRNGANLIGTVMTKVPGFMSRHYYGYGYGDR
NER
>gnl|bykdb|A0A140F3G6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus thermophilus] (length=243 residues).
MPLLKLVKSKVDFTKKTEEYYNAIRTNIQFSGAQIKVIAISSVEAGEGKSTTSVNLAISFASVGLRTLLIDADTRNSVLS
GTFKSNEPYKGLSNFLSGNADLNETICQTDISGLDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPIGMVI
DAVIIAHQADASLLVTAAGKIKRRFVTKAVEQLEQSGSQFLGVVLNKVDMTVDKYGSYGSYGSYGEYGKKSDQKEGHSRA
HRR
>gnl|bykdb|A0A140F3G8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus thermophilus] (length=249 residues).
MPLLKLVKSKVNFAKQTEEYYNAIRTNIQFSGAQIKVIAISSVEAGEGKSTTSLNLAISFASVGLRTLLIDADTRNSVFS
GTFKTNEPYKGLSNFLSGNADLNETICQTDISGLDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPVGLVI
DAVIIAHQADASLLVTAAGKIKRRFVTKAVEQLEQSGSQFLGVVLNKVDMTVDKYGSYGSYGSYGSYGSYGEYRKKTDQT
EGHSRAHRR
>gnl|bykdb|A0A140LCR7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Fervidicola ferrireducens] (length=235 residues).
MEERELELFIMNDPKSVISEAFRVLRTNLQFSSIDKPVKKVVVTSSMPQEGKSTVAANLAVSIASTRSKVLLVDADLRRP
KLYKLFRLENYKGLSNFLAEDLPLESVITKMANLHIITSGPIPPNPAEILGSSKMKKFLDEMATKYDMILLDAPPVNSVA
DAAILSTLVDGVILVVETGVTAREAAIAAKQQLEKVNAKILGVVLNKIKQDKNGGYYYYYYYYGEEGTKKRKKKR
>gnl|bykdb|A0A142D4A0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Geobacillus sp. JS12] (length=232 residues).
MARKPAASIRKAERKLITVENPKSPIAEQYRTIRTNIQFSFIDAPLRSLIVTSTGPGEGKSTTAANLAAVFAQQGKKTLL
IDADLRKPTVHYTFRLNNYMGLTNVLTGSAPLLPTCQETEIDHLSILTSGPIPPNPAELLSSKAMAQCLEQLYETFDLVI
FDTPPVLAVTDAQILANQCDGTVLVIESGGTEIEAAVKAKELLEAANAKLLGVVLNKRKHRDGGYYYYYQYK
>gnl|bykdb|A0A142KRY7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus oris] (length=247 residues).
MGLFKHRYTESTDTMDNGAMLITLADPKSGPAEQFRTIRTNIHFMSVDRPLKTVAFTSSGISEGKSTVTANVAIAWAQEG
KRVLLIDADLRRSTLHATFGLSNQKGLTTVLTGDSNEVDLSNVVQKSGVENLEVLTAGPVPPNPSELLSSQRMQSLIDGV
REVYDLVVLDVPPMLQVTDTQVLSSNLDGVILVVRQGVTQKAAIRRAVEMLKISQANVLGYVMNDVYDADAGYGYGYGYG
YGYEDER
>gnl|bykdb|A0A143MMM1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Geobacillus subterraneus] (length=230 residues).
MARKKQIRKAERRLITVDNSKSPIAEQYRTIRTNIQFSFIDAPLRSLIVTSTGPGEGKSTTVANLAVVFAQQGKKTLLID
ADLRKPTVHYTFRLNNYMGFTNVLTGSAPLLPTCQETDIDNLFVLSSGPIPPNPAELLSSKAMAQCLEQLYETFDLVIFD
TPPVLAVTDAQILANQCDGTVLVIESGRTDIEAAVKAKELLEAANAKLLGVVLNKRKHRDGGYYYYYQYK
>gnl|bykdb|A0A143PCJ0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus condimenti] (length=230 residues).
MKQKDNQKHQLITLHEPKSVISEKFRGIRSNLLFSSADETIKGIVVTAEKPSAGKSTIASNLAITYAQAGYKTLIIDGDM
RKPTLHYIFNKMNNHGLSSTIINNIKLEDSIEETEIENLDILTSGPIPPNPSELIGSSNFNEIISTLKDRYNFIVLDTPP
VNTVTDAQIYSKYITHSILVIDAEKNNRTEITKAKSLLDRVDSKILGVVLNRTPKDKSSSYYAYYGSEDK
>gnl|bykdb|A0A143PZ28 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus reuteri] (length=249 residues).
MSIFHRKKSNANNDTMNNGAKLITVAQPKSPISEQFRTIRTNINFMAIDKPIKTLALTSANVSEGKSTVTDNVAVVWAQT
GQRVLLIDADLRRPTLHATFNKSNREGLTTILTSSDNSVDLRKIVQPSGVESLDILTSGPIPPNPAELLNSQRMKTLIES
VKSIYDMVIVDVPPLLEVTDTQVLSHFLDAIVLVVKQGQTQKLAVKRAVELLNLAHANLLGYVMNDVNTDGDAGYGYGYG
YGYGTDSAQ
>gnl|bykdb|A0A143Q1W1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus reuteri] (length=247 residues).
MSLFKRKQQHSTDTMDNGAKLITVAHPKSPISEQFRTIRTNINFMAIDKPIKTLAMTSANMSEGKSTVTYNVAVVWAQTG
QRVLLIDSDLRQPTLHATFNKSNQHGLTTILTSGTNSVDLREIIQSSGVENLDILTSGPIPPNPAELLNSQRMKTLLDTV
KGIYDMVIVDVPPMLEVTDTQILSRHLDAIVLVVKQGQTQKLAVKRTVELLNLAHANLLGYVMNDVNADGDAAYGYGYGY
GTDGDDK
>gnl|bykdb|A0A143WVN9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridiales bacterium CHKCI006] (length=493 residues).
MDEKELQQEEEVEIDLWVLFRDFFMGCVKFWWLVVLLAVIGAASMLFKDTGFYTPMYRSQATFTVTTNTSEDSNASYNFY
YDSATAQQLSLTFPYILSSDLLTDAIMEDMGTTSINGSISASVISDSNMITMSVISSDPQAAHDILESAIKVYPDVARFV
IGPTRFNMIDAPTLPTEPYNQPHYTVNFAKGALIGAGIGFAFIIVYAFLRKTVHKEEELRQSINLKCIASIPNLKQKRRK
KQRKQPLPSILDRRIDPYFIENMDSLYLRIMREMNERKGKTLLITSTVSGEGKSLISLNLAYELAKNKRHVLLIDADLRK
QDLREQLHLPTDGEGLESLQDGVEAAVKSINYLEDSGIYFLGGSHISKDPSGLLSSKEMDTFMKYMKEYMDFVIIDAPPC
EGFEDALILENYADGVLYIVKQDYVQKRRIIDSISMLAETQADLIGYVFNGVSHMMRGYGYGHYGSYGYYQRYGRYGKSY
GYGHDQEKANAAE
>gnl|bykdb|A0A143X881 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridiales bacterium CHKCI006] (length=222 residues).
MEQQIIEIRNISSSTNTDEAFRTLRTNLMYIDDLKVITISSSSPNEGKTVTAFNLAYQFAKLGKRVVLVDADMRRSSLRS
YLMLKDKVSGLSEALSRQSRNYLFPTNVDNLFVILSGKNPPNPSELLSSPIFDQLISALKENFDYVIIDTAPMAVSMDAT
IVGRKSDGLVMVIRNEMTRKKNLRRIRADLERNGVRLVGAVLNRVKKNQIDYGDYRYEKYYE
>gnl|bykdb|A0A143XEF5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Eubacteriaceae bacterium CHKCI004] (length=240 residues).
MKQIDMNIRALPYAVEEAMNRLRVNIKFCGKNTKKILVISSVPNEGKSTVSVHLWKMLAEAGFPTVLVDLDLRKSVLKDR
LEFKSEGEIQGLDYYLSGLSEYQNVVYETNISNGYIVPVSNLLENPSALLEDPRMGELLDRLAEDYRYVIIDSPPLDSVA
DGALIASLCDGAILVVRSGMTSRRLVKQSVQQLERVRCRLLGMVLNRVETKSRAYQKYYGKYGNYYSDYYGGHTSEKGDS
>gnl|bykdb|A0A143XF22 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridiales bacterium CHKCI001] (length=511 residues).
MLFIKSGSRLVIVMKDMKEDRDMKEDRKGIKNREDEIEIDLVLLFKDFWKSFTRLWWVVLMLIFLGSGGFFAYNYFGYEP
IYECGATFTVATGDGENGSYNFYYNSSTADQLSKTFPYILDSNFFRSTLLERLGKDRLNGSITSETIDNSNMVTMKVHSP
NPQDAREILDVALEIYPETARFVLGSIQFNLLDEPETPTKPYNQIGTRQSLVLGGGVGGLLGMFLLGLSAFFRKTVRTPE
EMNKITSLRCLASVPQVRFKARKKKKKQKIFVLDKRLSHSYRESLKALQLRLENSMKKNQGKVLLISSTDSGEGKSTLAV
NLGELFAAQGKKVLLIDGDLRKQEDAEIIGIRDGAGLQDVVIEDKEATEMVQKIKENGIWFLGSRRPVKQPASILSSFRV
REFILAMKEEMDYVIIDTPPCEIFQDAGILADYADNILYVVKYDYVSQRRVWEGISFLGGHSAKFLGYVFNSYPEFASEY
GYGRYGYGKYGYGRQSYGKRKIYGEGGDEND
>gnl|bykdb|A0A143XF26 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridiales bacterium CHKCI001] (length=457 residues).
MNQELFRFDEISIRGLCLELFRNLWMILLIGAALWLGVTGLHNLTYKPQYTSYSTLVVILKGQDSAYSSLSVAKQMADVF
GIVFQSEVLREKIIEDTGENIQGTINCEPVSETNLLVLSSTCQNPRQAYLFIHSALKHYEEVAKDVFANATLQIVQEPEV
PSTPSNTSLFMDRRSLITGAGVVAMTAIMCLFYILRFTVKNLISARRLLDGKIRGVIPYERKRISGNRRWVKKALLLNSP
SVSMDFAEASRRAETQIEYHMRRNQQKILLVTSISENEGKSTVAANIALALAEKHKKVLLVDSDLRKPAQYKVFEEDQKG
RDSLNQLLKEKGDWREKIYYNKISQLWELFQFHSVEEPAAVLSGAFLEKLAGEWKKEMDYIIMDCSPVSISTDAEHLMKM
ADTVLLVVRQDWSDVRVINDTVDMIWQSGCDFSGFVLNAFYKEWIQTGYSYEGYERG
>gnl|bykdb|A0A143XH99 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridiales bacterium CHKCI001] (length=234 residues).
MQKVDVTSKYSDNYQVNEAFKALRTNILFCGSDIKVIIVTSCQPSEGKSSVSVETAISMAQMGKKVLLIDADLRKSVMAA
KYHIGSEVKGLSELLSGLATLEQVLCATTTENLHMIFSGPVPPNPAELLGGKQIQVLLENLRDVYDYIIIDSPPLGSVID
SAVVAGFCDGAILVVAADRIKYSFAQGVKEQFEKSGCKILGAVLNRVEMKKSAYGKYYSGHYGRYYGKSASPYK
>gnl|bykdb|A0A143XPH3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridiales bacterium CHKCI001] (length=497 residues).
MSQRRIEKRQVGQTMQIYDNETKTNDTQEYIDIVKVLDEIWTEFLRHLGSITILFFLVVILVCSYSWFGYEPMYEAYSTF
VVSSNQTTEADIALAARLANSFEHAFTDSGLRDKIVDELRMDWEDDFKVDVSATTLEDTNFITITVNSDDGIIAQTILEL
IEENYPDIAKQIVGNITLTSIDATGILTEPTNPFSWITIILQGSLAGLVVIVVILYIYVSNKKTIHSAGDIKRHLNASCI
GTVPITSFKKRKKNADPLLVITNDRVQQSYKEAIHTLRIRIERVMEKEEKKVILVTSSLPNEGKSTIAVNLALSIASRGK
KVLLIDGDLRAPSVYKYFTKEQMKKKKGLSDILLNNGSIKDAVFSPSIQNLDVILGGERIEDPSEILAGEQLHLLLEEVK
KSYDYIIFDSSPAAMLSDTTAIAGIMDAVLFVIRQDYTKIQYAQEGLALLNESGILSLGCVMNYAEAGLNHYGYGYYGSR
YSKYRYSKYERYYGKDN
>gnl|bykdb|A0A147K4J4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus coahuilensis p1.1.43] (length=243 residues).
MREIDDTEVTKLARKKKTTMMDSRRKLISQISPKSPITEQYRTIRTNIQFSAVDQEVRSLLVTSSFPGEGKSTTSANLGV
VFAQQGKKVLFVDADLRKPTVHYTFNVNNLFGLTTVLTKQKSLIETVQGTKIEGLDVLPCGPIPPNPAELLGSRGMEEFL
REAYETYDLVIFDTPPVLAVTDAQILANQCDGTILVVSAGTTEIEGAQKAKELLTSAKAKLLGVVLNNKSNKSTNYYYYY
GTK
>gnl|bykdb|A0A150B1P3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSMYDL
VIFDMPPILAVTDAQIMANQCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A150BQL4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDLNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTYSERLEKCVQTTSVENLNFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A150CGM3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=234 residues).
MALNSLFKKKQNHRQRRQLIAHQQPQSPISEQYRNIRTNIEFASVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKK
VLLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTNVDNLYFLACGPIPPNPAELLGSKSMKELLGQAYSMYD
LVIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGTN
>gnl|bykdb|A0A150D9K2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKQNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A150F8N9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus nakamurai] (length=226 residues).
MGFRKKKTRRGLAQISVLHHKSLVAEQYRTIRTNIEFSSVQTHLRSILVTSSVSGEGKSFSAANLAAVFAQQEKKVLLVD
ADLRKPTIHETYQLENVQGLTNVLVGNASLGETVQKTLIDNLYVLTSGPTPPNPAELLSSKAMGELIQEIYNQYSLVIFD
SPPLLAVADGQILANQTDGSVLVVLSGKTKMDTVQKARDALQQSKAKLLGALLNKKKIKKTEHYSY
>gnl|bykdb|A0A150FSI8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Clostridium] paradoxum JW-YL-7 = DSM 7308] (length=243 residues).
MQNIIVFKDPKSPISEAYRNIRTNILFSNIDENLQTILITSAGQSEGKSTTIANIAASLAELGKKIILLDCDFRRPSVHK
KFNITNNKGITDILLNNYDYKDCIQRIVEGFDIITCGQIPPNPSEIISSNKLKRLVEDLKKDYEYILIDAPPVGIVSDAA
ILSTFIDGVILLASCGETQIEHIKKAKETLENVGAKILGVVLNKLEVEKNRAYGYYAYYYQDEENTKGKGAKNTKGKRAK
KKK
>gnl|bykdb|A0A150KCA4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus coagulans] (length=231 residues).
MAPKKTKLLNTRRKLISKLNPTSPISEQFRTIRTNISFSSVDNDLQLLMVTSSGPGEGKSTITGNLAVVFAQQGKRVLLV
DADLRRPTVHYTFGMTNTFGLTTVLTKQGTLLETVAKCDVENLHVLTSGPIPPNPAELLSSKAMKEFFKEAKEQYDIILL
DTPPVLAVTDAQVLTNQCDGTILVVSSGKAEVDAVKKAKELLVSANANLLGVVLNNKKTQNTHYYYYYGKD
>gnl|bykdb|A0A150M3A2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Parageobacillus caldoxylosilyticus] (length=231 residues).
MARSNQKQTKKLERSLITIEDPKSPISEQYRTIRTNVQFSFVDAPMRSLMVTSTGAGEGKSTTTANLAVVFAQQGKKVLL
IDADLRKPTVHYTFRLNNYTGLTNVLTNSAPLLPSCQETRVENLYVLTSGPIPPNPAELLSSKAMEQCIQQLYNEFDLLI
FDTPPVLAVTDAQILAHQCDGTVLVIESGGTEIEAAVKAKELLEAANAKLLGVVLNKRKYRQGQYYYYQYK
>gnl|bykdb|A0A150M5B9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Caldibacillus debilis] (length=231 residues).
MAKKKGKRMQHQRRGLIAKQDPKSPITEQYRTIRTNIQFSAVDQEIRSIVVTSTAPGEGKSTTIANLAIVFAQQGKRVLL
IDADLRKPTVHITFQFTNTIGLTNVLTKQASVLDAVRKTDVENLYVMTSGPIPPNPAEILASQSMHDLLVEVEKHFDYVL
FDAPPILAVTDAQILASLCDGTLFVVSSGKTERDYAVKAKELLLAANGKLLGAILNNKKEAKQSYYYYYGS
>gnl|bykdb|A0A150MNR1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Geobacillus stearothermophilus] (length=232 residues).
MARKPAASIRKAERRLIAADNPKSPIAEQYRTIRTNIQFSFIDAPLRSLIVTSTGPGEGKSTTTANLAVVFAQQGKKTLL
IDADLRKPTVHYTFRLNNYMGLTNVLTGSAPLLPTCQATEIDHLSILTSGPIPPNPAELLSSKAMAQCLEQLYETFDLVV
FDTPPVLAVTDAQILANQCDGTVLVIESGGTEIEAAVKAKELLEAANAKLLGVVLNKRKHRDGGYYYYYQYK
>gnl|bykdb|A0A150MZI7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Parageobacillus toebii] (length=232 residues).
MARRDRKKIQKIERSLITMEDPKSPISEQYRTIRTNVQFSFVDKTMRSLMVTSAGPGEGKSTTTANLAIVFAQQGKKVLL
IDADLRKPTVHYTFRLNNYTGLTNVLTNSAPLLPSCQETSVENLYVLTSGPIPPNPAELLSSKTMEQCMQQLYNEFDLLI
FDTPPVLAVTDSQILANQCDGTILVIESGGTEIEAAVKAKELLEAANAKLLGVVLNKRKHREGGYYYYYRYK
>gnl|bykdb|A0A150NAZ6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Geobacillus stearothermophilus] (length=232 residues).
MARKPAASIRKAERKLIAADNPKSPIAEQYRTIRTNIQFSFIDAPLRSLIVTSTRSGEGKTTTAANLAVVFAQQGKKTLL
VDADLRKPTVHYTFRLNNYMGLTNVLTGSAPLLPTCQATEIDHLSVLTSGPIPPNPAELLSSKAMAQCLEQLYETFDLVV
FDTPPVLAVTDAQILANQCDGTVLVIESGGTEIEAAVKAKELLEAANAKLLGVVLNKRKHRDGGYYYYYQYK
>gnl|bykdb|A0A150W8N4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planococcus maritimus] (length=231 residues).
MLKQTASKRPLARKLVARIKPNSVISEQYRTIRTTINFSLPGNEMKTLLFTSASKEEGKSTTSANMAIVFAESGKKVLLV
DADMRKPTLHHTFHLNNHMGLSNLLIGKGELEQSVRDSGIQGLELLTSGQIPHNPAELLDSPMLDRLIEKMKERYDLIIF
DSPPILSVSDSKIMANKCDGTVLVVNTGKTEKQSAIKARDSLTTSKAYIVGVVMNNYKLSKDHYYSYEYNY
>gnl|bykdb|A0A150W912 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planococcus maritimus] (length=232 residues).
MAKKKQLQQTARKVVTYTTPRSFVSEQFRTLRTNVNFASPDVELRSIVVTSAAPGEGKSTTSANLATVFAQEGKNVLLVD
GDMRKPTTHYTFHMPNTIGLSNVLTRQATVENAIRPTTIERLDLMTCGPIPPNPAELLASNAMGMLIADLKKRYDVVIFD
APPVLSVTDGQVLANKCDGAILVVNSGTTEKEMAAKAKEAIEASNSKLIGAVLNNFVLAKDSYYYQYYGNAE
>gnl|bykdb|A0A150Y6F8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus sp. DSM 100440] (length=230 residues).
MKEIALNLKSMQDYRINESYKQLRTNIEFSGEENKIIAVTSCTPSEGKSTVSLSTAYSLAEAGKKVLFIDADLRKSVLTG
RYKISGEMKGLTHFLSGQGDLSEILCKTNEKGLFVIFAGPVPPNPAELLGSKKFAALLKEARNIYDYIIIDTPPLGSVID
SAIVSAVCDAAILVISANTISYKFARSVKDQLAKTGCNILGVVLNKVSMKQNKYYGKYYGKYYGHYGSDK
>gnl|bykdb|A0A150Y6N2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus sp. DSM 100440] (length=501 residues).
MAEKNGYQKVDSGSYRKLDGDDVIDLGTLFWNIIQGFLKFWWLVILLMAIGAGAFYLKASRIFYMPMYQSSATFTVLTGG
ASTADSGNGTYNFYYDTTTAGQLARTFPYILSSSLLTDAIKEDLGVEAVNGSISAQAISESNMITMSVISQSPEDAKAIL
ESAIKVYPDIARFVIGDTRFNIIDEPTMPDEPYNKPSYRAQIKKGGLYGAGAGILLICLYAFFKKTVQKPEELKSAMSLT
CIANIPEAPRKLRKQKDQRWIRMKDDRTPQAFKENIQSLQIRISRELEERGGKLLLITSTMPEEGKSTLAYNLAAAAASH
GVKVLFVDADLRKQEDRKHLTGEIGRGLASVVTGKCTLEEAVRNEEETGIDFLGGSRPIKKVQQILNHSRFEAVLQEMKE
RWDLIILDAPPAEMFEDASILAERADGILYIIRYDMVQKRRILDCIQGLEDAKAPLLGYAFNGIPVHRGGYGYYGYGRYG
YGYYGYGSYSYEDRKKRGAHD
>gnl|bykdb|A0A151A3H8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus kloosii] (length=228 residues).
MAKKKRTVSPLYVHDKPKSTISEKFRGIRSNIMFSNPENEISSLLVTSEKPISGKSTITANIAVTYAQAGFKTLIIDGDM
RKPTQHYIFDINNNYGLSNLIINKATYSESIKETKVENLAVLTSGPTPPNPSELIASNNFNNIYNELLNHYDFIVIDTPP
INTVTDAQIYAQIVGNCALVIDAEKNNRNEVKKAKDLIGKSSGKLIGAILNKMPFDKTSSYYYYYGED
>gnl|bykdb|A0A151A429 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus kloosii] (length=228 residues).
MFKKTVKNTSNLFVHHNPKSVISEKFKTIRSNIMFSNATKSILITSEKPLSGKTTISSNIGVTYAQAGYRTLIIDGDMRK
PSQHYVFNLSNSAGLSNLIINKATYKEAIKSTEIENLHVLTSGIVPPNPSELIGSKRFIEIYKTLEEIYDFIIIDTPPIN
AVTDAQLFAQVAKHSILVIDVQRNDRDEVKKAKDLLDAAGAKIIGAILNKASLDNTSDYYYYYGKDKQ
>gnl|bykdb|A0A151AK51 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium colicanis DSM 13634] (length=232 residues).
MLIVEKEPKSIAAEAYRTLRTNIQYSSFDKDIKTILVTSSGPSEGKSTTTGNLALTMAQSDKKVLIVDCDLRKPTVHKKF
SISNEKGLSNYLIGEVELDDVIVKYSENLYLLTSGTIPPNPAEMLSSKKMKEFLDLMKEKFDTVIIDSPPVLAVTDAQIL
STEVEGVLLVAASGQTEKEALIRAKELLLKVKANILGVILTRVPQDSGKGGYTYYYYYGDGDDNHKKRRKKK
>gnl|bykdb|A0A151B3D9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium tepidiprofundi DSM 19306] (length=234 residues).
MLIVEKNPKSYISEAYRTLRTNIKYSSYDDEIKSILITSTSPYEGKSVTVSNLAVSMVQDGKKVLIVDCDLRRPTIHKKF
GISNLNGLSNYLVGEISFEDAIVERGENLYIMSSGIVPPNPSEMLSSNKMKEFLNFKRDEFDLIILDSPPVLAVTDAQVL
STMVDGVILVVESGKTEKEALVKSKEHLDKVKANIIGVVINKIPVNKGKGYGYYYYYYYEHEKDYRKRRKRSVK
>gnl|bykdb|A0A151G0P6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus plantarum] (length=235 residues).
MKLRRRVANMHTGIQLTTLTAPMSVVTEQVKTIRTNLNYAMVGKPLKTLMITSAIQGEGKSTVGSNLAVEYAKKGLQVLL
VDADLRRPTIHQTFAISNQRGVSSWLSGQLTDVNEAIYPVLDHLFVMPSGPKPPNPAELLASDRMTEFLTVATRKLDLVI
VDAPPILPVTDARILAGQVDGTILVVRQNFVEKVAVRQAVSALKNARAQLLGTILNDVDIKTHGYGYGYYGTETN
>gnl|bykdb|A0A151G3Z0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus plantarum] (length=242 residues).
MFKRKEQNITTTAPINLTTINEPMSVITEQIKTIRTNINFAATDHKLRTLMVTSAMLGEGKSTVSGNLAVEYAKEGMQVL
LVDADLRRPTIHKTFGLKNHKGLSSWLANQMDDVNDAIHPVIGNLFVMTSGPKPPNPAELLGSNKMTEFLTSATRKLDLV
IVDAPPILPVTDSQLLANKVDGTVLVVRQGVAQKAAVRDAVNSLKKSQANILGTVLNDVRDGSHHGYYGYNSGYGYYSDE
DK
>gnl|bykdb|A0A154B0T6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. GZT] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDKNIHSLMITSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERFDKCVQKTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSMYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSEATEKETALKAKGLLESAKGKLLGVVLNDREREHGLYYYYGAK
>gnl|bykdb|A0A158LLW9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae GA49447] (length=229 residues).
MPTLEISQAKLELVKKAEEYYNALCTNLQLSGDDLKVFSITSVKAGEGKTTTSTNIAWAFARAGYKTLLIDADMRNSVMS
GVFKSRERITGLTEFLSGTTDLSQGLCDTNIENLFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIVVDTPPVGVVI
DAAIIMQKCDASILVTKAGETKRRDLQKAKEQLEQTGKSCLGVVLNKLDTSVEKYGSYGSYGNYRKQKK
>gnl|bykdb|A0A158RSW8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNVEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSMYDL
VIFDLPPILAVTDAQIMANQCDASILVVRSESTEKESAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A158SMM3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus fermentum] (length=250 residues).
MGLFKHRYTKSTDTMNNGVMLITLADPKSGPAEQFRTIRTNIHYMSVDRPLKTVAFTSSGKSEGKSTVTANVAIAWAQEG
KRVLLIDADLRRSTLHATFGLNNQKGLTTVLTGDSKEVDLSNVVQKSGVENLEVLTAGPVPPNPSELLGSQRMQSLIKGL
REAYDIVVLDVPPMLQVTDTQVLSSNLDGVILVVRQGVTQKAAIRRAVEMLKISQANVLGYVMNDVYDDDAGYGYGYGYG
YGYGYEGDEE
>gnl|bykdb|A0A160H5Q6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSEHLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A160IQQ0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Fictibacillus phosphorivorans] (length=233 residues).
MSRKLKKSIGDLTQRSLITHRNPKSPIAEQYRTIRTNIQFSSIDKELKTLMITSSGPGEGKSTTVANLAVVLAQQEKRVL
LIDTDLRKPTVHYTFKVSNIYGVTSILTRQTTLRETIVSSKIPNVDVLPSGPIPPNPSELINSKSMNDLIEEASRMYDYV
LFDTPPLIAVTDGQLLAHHVDGVILVVSSGKTEIESATKAKELLENANAKIIGAVLNEKAARKEKYYYYYGSN
>gnl|bykdb|A0A160LH46 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis subsp. israelensis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A161QKR1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus trypoxylicola] (length=233 residues).
MYKLARRELKSPTKKRALIANERPKSPITEQYRTIRTNIEFSSVDQELKTLLVTSSGPGEGKSTTAANLAIVLAQNGNDV
LLVDTDLRKPTVHHTFGILNTRGLTNLLMKTEVIEDVIQTSKVERLSILPSGPIPPNPAELLNSKTMELTLESFKSKYDI
IVLDTPPVMAVTDAQVLGNKVDGSILVVSNGKTDRNQAVKTKELLSQTSSKLLGVVFNNKEVKKGNYYYYYGE
>gnl|bykdb|A0A161WDE2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium magnum DSM 2767] (length=237 residues).
MEKPDIISVKSPKSPIAEAYRTLRTNIQFSSFDNKIQTIVVTSSGPGEGKSTTASNLAVVMAESGSKTILIDCDQRKPRL
HKVFLTTNERGISDLLVGKVKFEEAVQETKVPNLSILTSGTRPPNPSELLGSSKMRAFIDALKERYEYIIIDTPPIIAVT
DAQLLASHADGSLLVIASSQAEREAAVKAKELLQKVNAKILGVVLNKLEVQEKGYYGYYYHYYYGNDGGKKKKKKGK
>gnl|bykdb|A0A162G753 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus plantarum] (length=242 residues).
MFKRKEQNITTTAPINLTTINEPTSVITEQIKTIRTNINFAATDKNLRTLMVTSSMIGEGKSTVSGNLAVEYAKEGMQVL
LVDADLRRPTIHTTFGLENHKGLSSWLANQMDNVNDAIHPVIGNLFVMTSGPKPPNPAELLESNKMKEFLTSATRKLDLV
IVDAAPILPVTDSQLLANKVDGTVLVVRQGVAQKAAVRDAVNSLKKSQANILGAVLNDVRDGSHHGYYGYSSGYGYYSDE
DK
>gnl|bykdb|A0A162G8A0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus plantarum] (length=239 residues).
MALFKKKKQLDSSSMKNGVGLITVTKPTSSIAEQFRMIRTNVQFSSADRQLKTLLFTSADPSEGKSTISSNVAVTWADQG
NKVLLIDSDLRRPTVARSFRVSNSQGLTTILTAKQANLSESIHETEVPNLYVLPSGPVPPNPSELLNSSKMDQLLKVLKE
QFDIIILDVPPANKVTDAQILASKVDGVILVVPQGIALKGAVLRARDLLKKVNANLIGAVLNRVTDAASGGYYGTDDKK
>gnl|bykdb|A0A162JEX6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium coskatii] (length=239 residues).
MEKPDIITVKNPKDPIAEAYRTLRTNIQFSSFDKKIQTIMLTSSGPGEGKSTTCSNLAVVMAESGSKTIIIDCDQRKPRL
HKIFLTSNEIGLSDVLAGKVEFEDAVKETVIENLNLLTSGTRPPNPSELLGSKKMENFLQDLKEKYEYIIIDTPPVVAVT
DAQLLSRYADGCLLVIASSQVEKEAAVKAKELLVKVNANVIGVVLNKLEIKEKGYYGYYYHYYYGSDGTKIKKKEKRKK
>gnl|bykdb|A0A162RDJ9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium magnum DSM 2767] (length=257 residues).
MENIDIITIKNPRSPIAESYRTLRTNIQFSSFDKKIQTIVITSSGPSEGKSTTSSNLAVVMAQNGNKTILIDCDQRKPKL
HKVFLTSNQKGLSDLLVGNSVFEEAVEKTEIENLDILTSGTRPPNPSELLASTKMKNFIENLREKYDCIIIDTPPVIAVT
DAQIVSRYADGCLLVVASAQAEREAAMKAKELLVKVDAKIIGVVLNKLDIKEKGYYGYYYTDYSDEGEKKTVKRRSRKNK
KQRLSLSFFSRLKKSVN
>gnl|bykdb|A0A162RDU1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus subtilis] (length=237 residues).
MALRKNRGSRMQRNVIAMTEPKSLNSEQYRTIRTNIEFASVDRQMKSVMITSACPGEGKSTTAANLAVVFAQQGKKVLLI
DADLRKPTVHTAFFLENTVGLTSVLLKKSSMEQAVQASNEKHLDVLTSGPIPPNPAELLSSKWMKELAYEACAAYDMVIF
DTPPILAVADAQILGNVADGSVLVISSGKTEKEQAAKAKEALATCKSKLLGAIMNGKKLSKHSEYGYYGTKDNFMQK
>gnl|bykdb|A0A163IZH1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus marisflavi] (length=223 residues).
MSTRRKLVTHDNPQSPISEQYKTIRTSINFSSIDQQIRSIMVTSSGPGEGKSTTAANLAVVFAQEGKNVLLVDGDMRKPT
SHYTFNVTNTFGLTSALSRQKTLREVVHQTDIKNLDLLTCGPVPPNPAELLSSRSMEELLNDIYQDYDLVVFDTPPLLAV
TDAQVLANKCDGTVLVLSSGTTEVDSAKKAKELLDTTNGKLLGVILNNREIKDTSYYYYYGKK
>gnl|bykdb|A0A163XF05 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Geobacillus sp. 15] (length=232 residues).
MARSNRQQFKRLERSLITAEDPKSPIAEQYRTIRTNIQFSFIDRPLRSLIVTSTGPGEGKSTTVANLAVAFAQQGKKTLL
IDADLRKPTVHYTFRLNNYMGLTNVLTGSAPLLPTCQVTEIDHLSILTSGPIPPNPAELLSSNAMAQCLEQLYETFDLVI
FDTPPVLAVTDAQVLANQCDGTVLVIESGGTEIEAAVKAKELLEAANAKLLGVVLNKRKHRDGGHYYYYQYK
>gnl|bykdb|A0A164AFP2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Aeribacillus pallidus] (length=232 residues).
MAPRAKGMKQKQRTLITALNPKSPISEQYRTIRTNIQFSSVDHEIRSIMITSTGPGEGKSTTAANLAVVFAQQRKQVLLI
DADLRKPTVHYTFRLQNIHGLTSVLLRNATLQEAVSVSEVDHLDVLTSGPIPPNPAELLSSRSMVELLKEAYDHYDIVII
DSPPLLAVADAQILANQVDASIMVVASGKTEREAALKGKESLLSAKSKLLGVVLNGKPQKDSHYYYYYGGKN
>gnl|bykdb|A0A164M5B9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLQFLACGPIPPNPAELLGSKSMQELLAQAYSMYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A165H699 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bhargavaea cecembensis] (length=238 residues).
MARRKKSSKKQLEQRARKLVVAANPRSVVSEQFRTLRSNITFSAVDKEMKTILVTSALPGDGKSTISANLATLFAQDGKR
VLFIDADMRKPTVQYTFSLTNAAGLSTVLTQQRLAGEVIRESEISPNLHIMTSGPIPPNPAELLGSRSMAVLMNEMAQQY
DLIVFDAPPVLSVTDAQLLANKVDGTLLVVNTGVTEKENIEKAKEQLGNAQARILGAVMNNFEMDKDHYYYQYYGTEE
>gnl|bykdb|A0A165MJW8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus plantarum] (length=242 residues).
MFKRKEQNTTTTAPINLTAINEPMSVITEQIKTIRTNINFAASDRKLRTLMVTSAMLGEGKSTVSGNLAVEYAKEGMRVL
LVDADLRRPTIHKTFGLKNQKGLSSWLGNQLEDVNDAIHPVIGNLFVMTSGPKPPNPAELLGSNKMTEFLTSATRKLDLV
IVDAPPILPVTDSQLLANKVDGTVLVVRQGVAQKAAVRDAVRSLKKSHANILGSVLNDVRDSSHHGYYGYDNGYGYYSNE
DK
>gnl|bykdb|A0A165PSY8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus plantarum] (length=242 residues).
MFKRKEQNIATTAPINLTTINEPMSVITEQIKTIRTNINFTATDHKLRTLMVTSAMLGEGKSTVSGNLAVEYAKEGMQVL
LVDADLRRPTIHKTFGLKNHKGLSSWLANQLDDVNDAIHPVIGNLFVMTSGPKPPNPAELLGSNKMTEFLTSATRKLDLV
IVDAPPILPVTDSQLLANKVDGTVLVVRQGVAQKAAVRDAVNSLKKSQANILGAVLNDVRDGSHHGYYGYNIGYGYYSDE
DK
>gnl|bykdb|A0A165QRX0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus elgii] (length=226 residues).
MSKSAKRRPVIAHSHPKSPVSESYRTLRTNIQFSSVDRLCKTLMVTSSSPMEGKSTTINNLAVVYAQSNKKVLLIDADLR
KPTAHHTFHLSNRYGLTDMLTSQCTLDMAVKVTDIPNLEVMTSGSIPPNPSEILASQKMTGLLEELQQRYDIVLLDTPPV
LAVSDAQIIATKCDGVILVVDSGKVKRDLVQKAKNSLEFVQANLLGVVLNRIARPSGNAYYYYGNE
>gnl|bykdb|A0A165R6Z3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus plantarum] (length=226 residues).
MHTGIQLTTLTAPMSVVTEQVKTIRTNLNYAMVGKPLKTLMITSAIQGEGKSTVGSNLAVEYAKKGLQVLLVDADLRRPT
IHQTFAISNQRGVSSWLSGQLTDVNEAIYPVLDHLFVMPSGPKPPNPAELLASDRMTEFLTVTTRKLDLVIVDAPPILPV
TDARILAGQVDGTVLVVRQNFVEKVAVRQAVSALKNARAQLLGTILNDVDIKTHGYGYGYYGTETN
>gnl|bykdb|A0A165S7H4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus plantarum] (length=242 residues).
MFKRKEKNIATTAPINLTTINEPMSVITEQIKTIRTNINFTATDHKLRTLMVTSAMLGEGKSTVSGNLAVEYAKEGMQVL
LVDADLRRPTIHKTFGLKNHKGLSSWLANQLDDVNDAIHPVIGNLFVMTSGPKPPNPAELLGSNKMTEFLTSATRKLDLV
IVDAPPILPVTDSQLLANKVDGTVLVVRQGVAQKAAVRDAVNSLKKSQANILGAVLNDVRDGSHHGYYGYNSGYGYYSDE
DK
>gnl|bykdb|A0A165VAR0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus plantarum] (length=229 residues).
MTNMSTSIQLTALTAPMSVVTEQIKTIRTNLNYSMVGKPLKTLMITSAVQGEGKSTIGGNLAVEYAKKGMQVLLVDADLR
RPTIHQTFGVSNQRGLSSWLSGQLVDVNDAIHPVLDHLFVMPSGPKPPNPAELLASDKMTEFLTVATRKLDLVIVDAPPV
LPVTDARILAGQVDGTVLVVRQNFVEKVAVRQAVNALKNARTQLLGTVLNDVDIKTNGYGYGYYGTDTN
>gnl|bykdb|A0A165VCE6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus plantarum] (length=242 residues).
MFKRKEQNITTTAPINLTTINEPTSVITEQIKTIRTNINFAATDKNLRTLMVTSSMMGEGKSTVSCNLAVEYAKEGMQVL
LVDADLRRPTIHTTFGLKNHKGLSSWLANQMDNVNDAIHPVIGNLFVMTSGPKPPNPAELLGSNKMTEFLTSATRKLDLV
IVDAAPILPVTDSQLLANKVDGTVLVVRQGVAQKAAVRDAVDSLKKAQANILGAVLNDVRNGSHHGYYGYNSDHGYYSDE
DK
>gnl|bykdb|A0A165WR08 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Aeribacillus pallidus] (length=232 residues).
MAPRAKGMKQKQRTLITALNPKSPISEQYRTIRTNIQFSSVDHEIRSIMITSTGPGEGKSTTAANLAVVFAQQGKQVLLI
DADLRKPTVHYTFRLQNIHGLTSVLLRNATLQEAVSVSEVDHLDVLTSGPIPPNPAELLSSRSMVELLKEAYDQYDIVII
DSPPLLAVADAQILANQVDASIMVVASGKTEREAALKGKESLIAAQSKLLGVVLNGKPQKDSHYYYYYGGKN
>gnl|bykdb|A0A166AYJ7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus badius] (length=234 residues).
MVLKKQKHKSLGQTKRKLITDVDPKSPISEQYRTIRTNILFSAVDRDIQSLLITSAGPGEGKSTTAANLAIVFAQQGKDV
LLVDADMRKPTMHYTFNFTNTIGLTNVLAKQKSISTAVKETEIQNLSVLLSGPIPPNPAELLGSRVMAEFLQEACRLYDL
VIFDTPPVLAVTDAQVLANQCDGTVFVVNSGQTEVDSAVKAKELLQAAKAKLLGVVLNNRKIKETNHYYYYGNK
>gnl|bykdb|A0A166FN74 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus collinoides] (length=244 residues).
MALFRRKKKQSDDSIINGVKLVTAVEPKNVVSEQFRTVRTNIDFSSVDKQIKTLLFTSSGMSEGKSTVSANTAVTWAQQG
KKILFIDADLRRPSVQSSFDLVNGRGLSSVLSNNLDFHEVTQQTAIDNLEVITSGPIPPNPAELLNSNRMKRLLDSVEAE
YDLVLLDVPPLLSVTDTQVLAARVDGVVLVVRQGVAQKTAITRAVELLQMVHANLLGYVLNDMVPRDGYGYGYGYGYGYG
YGHE
>gnl|bykdb|A0A166HK45 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus collinoides] (length=243 residues).
MNIFHHQRKKLSTDTLRNGVKLITDVDPKDVVSEQFRTVRTNINFSAVNQKLKTIIFTSSAVSEGKSTVSANLAVIWAQQ
GQKVLFIDSDLRRPTLHTTFGLLNTSGLSTALSTDIDFNSVVQKTEIDDLSVITSGPIPPNPSDLLASNRMKELIFYFKT
TYDVIILDVPPLLSVTDTQIIAAQVDGVVLVVRQGLAQKLAIKRSTELLKMVKANLLGYVLNDVAPKNGYGYGYGYGYDN
KHE
>gnl|bykdb|A0A166MVD6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus plantarum] (length=226 residues).
MHTGIQLTTLTAPMSVVTEQVKTIRTNLNYAMVGKPLKTLMITSAIQGEGKSTVGSNLAVEYAKKGLQVLLVDADLRRPT
IHQTFAISNQRGVSSWLSGQLTDVNEAIYPVLDHLFVMPSGPKPPNPAELLASDRMTKFLTVATRKLDLVIVDAPPILPV
TDARILAGQVDGTVLVVRQNFVEKVAVRQAVSALKNARAQLLGTILNDVDIKTHGYGYGYYGTETN
>gnl|bykdb|A0A167GCZ6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus crassostreae] (length=229 residues).
MRRSINNSGLIASVNPESPISEVYRLLRTNIHYSSIDQALKTIMVTSSQAGEGKTTTISNLAITYAQEGRNVLLIDMDMR
KPSLHRIFSQPNHHGLSTVLTGQTSVQDAIHETMINQLSLLPSGPVPVNPSDLIDSIAMREMLDQLIHQYDIILMDTPPV
LAVTDSVIASTLCDGVIMVVAAGKVKKVHLKKAKEQLDHVNARMLGVVLNRINRDDQPDFYMNYYGMKG
>gnl|bykdb|A0A168B4Z3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus macquariensis] (length=229 residues).
MRQSATKPKLIMNINSRSPISEGYRNVRTNIQFSSWKQKLQVMAVTSTQAGEGKTTTISNLAVSYAQEGKRVLLIDADLR
HPSVQDIFHLANKMGLSNILAYQCSADELIRITDIDNLSIVTAGPIPPNPTELLSSGRMHEVVESWKGDYDIILIDTSPI
MAVADGIIVASICDGVILVVQAGKVKQEYIQKSKERLEHVKAHIIGVVLNNKKLNKSESNQYNYYSHLD
>gnl|bykdb|A0A168DR31 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus macquariensis] (length=229 residues).
MSRLIPKKLITESYPKSPISEGYRMLRTNIEFSTIDYKLQVIMVTSSKPSEGKSTTSANMAVAFAQSNKRVLLIDADLRK
PSQHHLFGTSNRVGLTTILFKQKELSEVIQPTNTENLWIIHAGPTPPNPSELLSSKQMATLLSTVRGMYDVIIIDTPPIL
SVTDAQIVATQSDGVVLVIDSGKVKKDVALKAKASLEHVNAKLIGVVLNNINRNESDSYSYYYGEKNDA
>gnl|bykdb|A0A168IKM0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus macquariensis subsp. defensor] (length=224 residues).
MRQSINKSHNLVTSIRPKSPISEAYRTLRTNILFSSVDDKIRTIMVASAQAGEGKTTTVSNLAIAYAQEGKKVLLIDTDL
RKPLLHQVFNISNYAGLTNVLTNQYELQDVVRETLIDHLDVITSGPIPPNPSEMLSSRKMKTVLDEVKDLYDVILFDTPP
VLAVTDALIVSSLCDGVILVVSTAKKGLVKKAKANLEHVNTRFLGVVLNNVTMGKEIPYYYGES
>gnl|bykdb|A0A168IZS0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus macquariensis subsp. defensor] (length=229 residues).
MRRSATNPKLIMNINRRSPISEGYRNVRTNIQFSSWKHKLKVMAVTSTQAGEGKTTTISNLAVSYAQEGKRVLLIDADLR
HPSVQDIFHLTNKMGLSNILAYQCSSDEVIRITDIENLSIVTAGPIPPNPTELLSSGRMHEIVESWKGDYDIILIDTSPI
MAVADGIIVASICDGVILVVQAGKVKQEYIQKSKERLEHVKAHIIGVVLNKKKLNKSESNQYNYYSHLD
>gnl|bykdb|A0A168JW46 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus antarcticus] (length=230 residues).
MSRLIPKKLITESYPKSPISEGYRMLRTNIEFSTIDYKLQVIMVTSSKPSEGKSTTSANMAVAFAQSNKRVLLIDADLRK
PSQHHLFGTSNRVGLTTILFKQKELSEVIQPTNTENLWIIHAGPTPPNPSELLSSKQMATLLSTVRGMYDVIIIDTPPIL
SVTDAQIVATQSDGVVLVVDSGKVKKDVALKAKASLEHVNAKILGVVLNNINRNHSDSYSYYYYGEKNDA
>gnl|bykdb|A0A168K545 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus macquariensis subsp. defensor] (length=229 residues).
MSRLIPKKLITESYPKSPISEGYRMLRTNIEFSTIDYKLQVIMVTSSKPSEGKSTTSANMAVAFAQSNKRVLLIDADLRK
PSQHHLFGTSNRVGLTTILFKQKELSEVIQPTNTENLWIIHAGPTPPNPSELLSSNQMATLLSTVRGMYDVIIIDTPPIL
SVTDAQIVATQSDGVVLVIDSGKVKKDVALKAKASLEHVNAKLIGVVLNNINRNDSDSYSYYYGEKNDA
>gnl|bykdb|A0A168NYT6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus glacialis] (length=229 residues).
MRRSINDSSLIVSMNPESPISEVYRLLRTNIHFSSIDQALKTIMVTSSQAGEGKTTTISNLAITYAQEGKNVLLIDMDMR
KPSLHRIFSQSNRQGLSTVLTGDTSVQDAIQETMVSHLSLLPSGPIPGNPSDLIDSTAMREMLEQLQQEYDVILMDSPPV
LSVTDSVIASTLCDGVIMVVAAGKVKKVHLKKAKGQLDHVNARLLGIVLNRMNRDNQSNFYMNYYGMKG
>gnl|bykdb|A0A168PU73 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus antarcticus] (length=229 residues).
MRRSANNPKLIMNINRRSPISEGYRNVRTNIQFSSWKHKLQVMAVTSTQAGEGKTTTISNLAVSYAQEGKRVLLIDADLR
HPSVQDIFHLTNSTGLSNILAYQCSADEVIRVTDIDHLSIITAGPIPPNPTELLSSGRLHEIVESWKGDYDIILIDTSPI
MAVADGIIVASICDGVILVVQAGKVKQEYIQKSKERLEHVKAHIIGVVINKKKLNKSESNQYNYYSHRE
>gnl|bykdb|A0A172TH66 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus swuensis] (length=230 residues).
MRQSTSNQILITESNPHSPISEAYRSLRTNIQFSAIDTSVQVVMVGSAVPGEGKSTTAANLAIVYAQEGKKVLLMDCDLR
KPTVHARFAVHNRNGLTNVLSGNFTAKDIYRDTGVENLTVITSGPIPPNPSEMLASKKMTSLMEQFREEFDMIVLDTPPI
LAVTDALIVSSFSDGVLLVINSTTTKRSLVQKAKSSLDHVHANMLGVVLNNKKRADADTEYYYYYGADAK
>gnl|bykdb|A0A173QTL9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerostipes hadrus] (length=471 residues).
MSKEYESKTEHKENLIDIAGLFDDLIKGIIQMKWRFLIILVICGAVFCGYKRLTYSPYYVASSTFTINSSITSENSNTYI
ENATANQMAKSFPYILKSGAFKEVLAQDLGLQSVPGTIEAEVMENTNLFTLKVTANNPKMAEKILKAVVKNYPSVAEFVI
GSSQLTLMDESGVPTTPANPFSYRHEIQIGVLIGILLCILLDVLLALGKNTVKKEEDFKRLFHAKSLGIMPRAKFHKKRT
QTQELIVLDNPRIPRSFLEAARTVRRRIERAQKETGMKSFLVTSAMPGEGKSTVSANIAISLAMKGYKVILVDADLRNPS
TAKVLGMNEQELGTLEVMKGEVNIDDAVQQYKNTSVKVLAGSIPIQDTSTVLSGKNMRQFVKELEAEADFVIIDTPPSGL
LSDAAIVAQYVDGAVFVIRQDYTDVDRILEGMEILSGSGAEITGCILNDVNVRTSESQHYMNSYRTKGETL
>gnl|bykdb|A0A173RAN1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Eubacterium] rectale] (length=241 residues).
METVVINQIKDQSYTMKESLRALKTSISFSGKGVKSILFTSSVPNEGKTTVVMDLARSMADSKKSVLVVDTDMRKSVLVG
RLRAKVESGGKIYGLSHYLSGQVSLDKVIYATNIKGVFILFAGHEVPNPTELLETEEFRELIEFGEKNFDYVLVDTPPTG
AAIDAAVVGKNVDGAVIVAAQNVTSSRAIINTKRTLEDSGVKILGAVLNKCKFEESKYGHYYGNYYGNYYGNYYGRDEDE
K
>gnl|bykdb|A0A173RVC7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia hydrogenotrophica] (length=227 residues).
MQAKIVLPNEELEYGAAEAIKTLRTNIMYSEDVKAIMLTSTMPSEGKSTVSLELARSFAALGKNTVLMDCDMRKSYLVRR
LGIQEKIQGVSEYLSKQSMKIVYRTSDPNLSIIFSGSYPPNPSELLSGIRFESLMETLRDAYDYIIVDAPPMGDLVDGAI
ISRQVDGTLLVVRNDFVKTKAVKKVKQQIEQNGGRVLGVALNRIKKNQKGAYPYGKKYYSYEYKKEK
>gnl|bykdb|A0A173S539 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerostipes hadrus] (length=238 residues).
MKKLVMDLPEINDYRMVEGLNQLKTNLAFCGKDIKVITMTSSVPNEGKSSISLSLSRTLAESGKKILMVDADLRKSVMAA
RYHIQGIDKGLSHYLTGQAEVEDIIYETEVEGLCITVAGPLSPDPTSILDSEQFEQFIENVRDMFDYVIIDAPPLGVVID
AVIIGKYTDGAVIVIEQGVIKRKIVQDVIKQLKRGEVRILGAVLNKVDERIGAYGNYEYKYSYSYYGESDTEKNHPNT
>gnl|bykdb|A0A173SFJ6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Coprococcus eutactus] (length=250 residues).
MKKLNIEFQELPYAVEEAMNRLRINIKFCGKNTRKILITSSMPNEGKSSVAINLWKMLAEAGFPAVLVDVDLRKSVIKDR
HHIKDADKLPDLGYFLSGQSEMEDVIYETQVENAYIVPCMNLLENPSALLEDARFAELLDKLAETYRYVIIDSPPLGSVA
DAAQIASLCDGAALVVRAGETSRSLIKQSFQQLDQVGCTLLGVILNRAQTTGRAYKKYYGKYGKYYSQYGYGYGTYGKEA
AAASDSTPSK
>gnl|bykdb|A0A173SH42 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Ruminococcus] torques] (length=241 residues).
METVVINQIKDQSYTMKESLRALKTSISFSGKGVKSILFTSSLPNEGKTTVVMDLARSMADSKKSVLVVDTDMRKSVLVG
RIRAKLESGGKIYGLSHYLSGQVSLDKVIYATNIKGVFILFAGHEVPNPTELLETEEFKELIEFGEKNFDYVLVDTPPTG
AAIDAAVVGKNVDGAVIVAAQNATSSRAIINTKRTLEDSGVKILGAVLNKCRFEESKYGHYYGNYYGNYYGNYYGRDDDE
N
>gnl|bykdb|A0A173SIU2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerostipes hadrus] (length=238 residues).
MKKLVMDLPEINDYRMVEGLNQLKTNLAFCGKDIKVITMTSSVPNEGKSSVSLSLSRTLAESGKKILMVDADLRKSVMAA
RYHIQGIDKGLSHYLTGQAEVEDIIYETEVEGLCITVAGPLTPDPTSILDSEQFEQFIENVRDMFDYVIIDAPPLGVVID
AVIIGKYTDGAVIVIEQGVIKRKIVQDVIKQLKRGEVRILGAVLNKVDERIGAYGNYEYKYSYSYYGESDAEKNHPNT
>gnl|bykdb|A0A173T2J7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Turicibacter sanguinis] (length=238 residues).
MDNALITVHQPKSPITEAYRTLETNLNFSSLDREMKTLTITSPGASEGKSTTSANLGMTFSQTGKKTLLVDCDLRCPRLH
QLFELPNVKGLSQVLCLKESLDEMKQSINEHLDVLTTGPLPPNPVEFLNSKGMQTFIKEVREQYDRIIFDTPPVGILTDA
AIVGAHTDGTLLVVATGKSDIELTLKSKENLNNVKANLLGVVMTMMPIQSKQYYHYYHSYGLDVKKPKRRFGFRKAKA
>gnl|bykdb|A0A173TJV3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Ruminococcus] torques] (length=484 residues).
MENNRENASAQTETEFEPISLVCDILKNWWVILLGALAGAMLFYVASSLKYVPNYHTQATFVITSRANANAYNNLSSANS
MAETFQKILESTIMKKTICEKLDMDKLDADISANVVKGTNMLTLSVTAHSPKDSIDIIKTVMDNYTSISYYTVGTTVLDV
LEDPKIPYAPVNPPQNGEMAKKGFFLGMAVCMLLFAIWSYMHNTVKQEREVEKKLDARSLGAISYEWKYKTIKEWIKHRK
KAVLVDNPLASFRFVESFKMLAARVEYHMSKINGKILVVTSVCENEGKSSVAGNLAITLAKKGKRVILIDGDIRCPAQYL
LLGMSPKKENELGEFLNGRTGANNILLNTERKRLGFIGGKVSYSASTEMLGNRQLPVLIEACSKIVDYVIIDTPPSGMIG
DAQIFAQHADAVMVVARQNVTLAEDINEMMDDFRDNHTKVLGVVLNGVMTFQSIADSPVGDHYSRYSRYGRYGRYGKYTN
NKEV
>gnl|bykdb|A0A173TLV7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Eubacterium] rectale] (length=237 residues).
MELVKFGKLKEQSYTMKESLRALKTNIQFCGDDIRTLLVTSSVPNEGKSTVALDLARSLTESGNRVLFIDTDMRKSVLAG
RLRATAASGGEICGLSHYLSGQRRLEEVMYGTEIPGLFMIFAGPSVPNPTEILEKKYFQELLNFGKEHFNYIIIDCAPIG
AAIDAAVVAKYCDGAIIVIGQGMASARMIQSVKKQLEASGVRILGAVLNKVNNKKNSHVSGYYGNYYGSYYGRSDKA
>gnl|bykdb|A0A173U1X9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Coprococcus comes] (length=237 residues).
MKKVNLSIEKKSYGVRESIRTLRTNLQFCGDDKRVILVTSCVPREGKSSVSVALAESIADMGKSVILVDADIRNSVMASK
LQITGADKGLSHFLSGQCVLADVIMATNIPKFHILLSGPEAPNPTELLESERFTGMLESMKNVYDYIIIDCPPLGLVIDA
AIIGHQSDGAIIVVEAGKVKYRLVQNVKDQLENSGVSVLGVVLNKVERKNQKGYYNKYYGSQKYEDYYGHNEETKNA
>gnl|bykdb|A0A173UW43 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerostipes hadrus] (length=471 residues).
MSKEYESKTEHKENLIDIAGLFDDLIKGIIQMKWRFLIILVICGAVFCGYKRLTYSPYYVASSTFTINSSITSENSNSYI
ENATANQMAKSFPYILKSGAFKEVLAQDLGLQSVPGTIEAEVMENTNLFTLKVTANNPKMAEKILKAVVKNYPSVAEFVI
GSSQLTLMDESGVPTTPANPFSYRHEIQIGVLIGILLCILLDVLLALGKNTVKKEEDFKRLFHAKSLGIMPRAKFHKKRT
QTQELIVLDNPRIPRSFLEAARTVRRRIERAQKETGMKSFLVTSAMPGEGKSTVSANIAISLAMKGYKVILVDADLRNPS
TAKVLGMNEQELGTLEVMKGEVNIDDAVQQYKNTSVKVLAGSTPIQDTSTVLSGKNMRQFVKELEAEADFVIIDTPPSGL
LSDAAIVAQYVDGAVFVIRQDYTDVDRILEGMEILSGSGAEITGCILNDVNVRTSESQHYMNSYRTKGETL
>gnl|bykdb|A0A173V3I7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Eubacterium ramulus] (length=239 residues).
MQELILEEKTTLSPVMKEIYRRLRTNLEFTGIENKVICLTSCMENDGKSSVSFNLAKILAENDKRVLFIDADMRNSVLMN
RTGIPDDLKGLSHYLAGKNAASEVIYATNYKNFYVIPTGRFPKNPTELLNKPAYEVLIEGMKQTFDYVIIDTPPLGSVVD
AALIAKTADASVLVISANAVSRRMANSVKEQLINANPNFLGVILNKADEGTKHYGYGKRYGSKYGYGYGYGRYGQNPKE
>gnl|bykdb|A0A173WD57 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia obeum] (length=234 residues).
MKEVNIYRQELDYSANESYKSLRTNLLFCGEDKKVIAVTSCTPNEGKSTVSLNLALSLADSGKKVLFIDADLRKSVLMGR
TEVEGEEIKGLSHLLSHQETIENVICATNVPRFHIIYAGIVPPNPAELLGGKYFKRFLSAIRKVYDYVIIDTPPLGSVID
SAVIADECDGSIIVMESGVISYRFAQDVKGQLEKCNCPILGVILNKVDMSKQGYYGKYYGKYYGKYGDKKTEKK
>gnl|bykdb|A0A173XUJ1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Dorea longicatena] (length=240 residues).
MVKSKKKESSFKTYKKILGKDSSFKLKEAYSKIRTKLMFTENEDGGTVYAVVSTDMNEGKTLNSINIATSFAMAGKRTLL
IDCDMRNPAVHCYLRLSEVSGLSEILARIEKKINIVHTEQENLFVLKAGVVPPNPSELLGGRLFGELIAQFRKRFDYIIL
DMPPVGVVADAAIVSSYVDGYVFVVRTMYKDLGEIRKAMEMLQSVQGKIAGFVLNDVEGKNDTDHTYGKYGYDYGSRNNE
>gnl|bykdb|A0A173Y3J1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerostipes hadrus] (length=472 residues).
MSKDYAEHRENRENLIDIAGLFDDLVKVAFQLKFKFLITIIVCGVIFCGYKRFTYSPYYIASSTFTISSSISSENSNTYI
ENATANQMAKSFPYILQSGAFKQVLAEDLGMQSVPGTIEAEVMENTNLFTLKVTESSPELAQKVLESVVKNYPSVAEFVI
GSSQLTLMDESGVPTAPANPFSYKHELEIGAAIGILLCVFLDVLLALGKNTVKKEEDFKRLFHVDSLGVLPHAKFHKKRT
QVEELIVLDNPRLPRSFLEASRTVRRRIERAQKETGMKSFLVTSAMPGEGKSTVSANIAISLAMKGYKVILVDADLRNPS
TAKVLGMQEQELGTLQVLKGEVKIEDAVQPYKDTSVMVLAGSSPIQDTSTVLSGENMRQFIKELEAKADFVVIDTPPSAM
LSDAAIVAQYVDGAVFVIRQDYTEADRILEGMEILSSSGAQITGCILNDANVKGNSSQHYKNSYRLKGEVKV
>gnl|bykdb|A0A173Y428 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerostipes hadrus] (length=235 residues).
MKKVTMNLPEVKDYRLTEGLNQLKTNLAFCGKDIKVIIITSSVPNEGKSSVAFDLSKTMAEGGKKILMVDADLRKSVLAA
KYHIQGIDKGLSHYLTGQAEIEDIIYETETEGFYLSVAGPLSPDPTSLLDSDQFQKFIDKVREDYDYVIIDAPPLGVVID
AVIIGKYCDGAVLVIEQGVIKRKVVQDVIKQLKRGEVRILGAVLNKVDERIGAYGAYDYKYSYSYYGDSDAEDRH
>gnl|bykdb|A0A173YTJ8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Turicibacter sanguinis] (length=238 residues).
MSSELITITNPKSPIAEAYRTLRTNIQFSNVDEDLKVICVTSSGPSEGKTTTSCNLAETFAQSGKRVLLIDGDLRKPRVH
KVFKISGTRGLTNLLAGQLSLEEVTSYVGSDLTVIPCGPIPPNPSELIASNRMKELIANLRQQYDVVIIDAPPVGVVTDS
AILSTIVDGTLLVVASGKTEIDGAKRAKQLLENVNARILGVVMTMIPVTKKGYYGYQYYSYEEEAQPTRKKRSFFSKV
>gnl|bykdb|A0A173Z681 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia obeum] (length=236 residues).
MKKLNLTDKRNPDYFYSEAIKTLRTNIQLSGQSIKTILVTSCYPNEGKSDIVLSLAQELGSIGKKVLLLDADIRKTAYAG
RLGVEEEVKGLSQLLSGQVGLQEVIYSTNFPNMDIIFGGPSAPNPSGLLSENIFKVFLKEIREYYNYILIDTPPIGTVID
AAVIGRCCDGAVFLIEPGNVRYRDAQKAFKQLERSGCRILGAVMNKIDTSDDKYYSSYYKHYGEYYRRSDEEAQIK
>gnl|bykdb|A0A173Z6F0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Coprococcus comes] (length=237 residues).
MKKVNLSIEKKSYGVREAIRTLRTNLQFCGDDKRVILVTSCVPREGKSSVSVALAESIADMGKSVILVDADIRNSVMASK
LQITGADKGLSHFLSGQCVLADVIMATNIPKFHILLSGPEAPNPTELLESKRFTGMLESMKNVYDYIIIDCPPLGLVIDA
AIIGHQSDGAIIVVEAGKTKYRLVQNVKDQLENSGVSVLGVVLNKVERKNQKGYYNKYYGSQKYEGYYGHNEETKNA
>gnl|bykdb|A0A173ZEP4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Coprococcus eutactus] (length=250 residues).
MKKLNIEFQELPYAVEEAMNRLRINIKFCGKNTRKILITSSMPNEGKSSVAINLWKMLAEAGFPAVLVDVDLRKSVIKDR
HHIKDADKLPDLGYFLSGQSEMEDVIYETQVENAYIVPCMNLLENPSALLEDARFAELLDKLAETYRYVIIDSPPLGSVA
DAAQIASLCDGAALVVRAGETSRSLIKQSFQQLDQVGCTLLGVILNRVETTGRAYKKYYGKYGKYYSQYGYGYGTYGKEA
AASSDSTPSK
>gnl|bykdb|A0A174A2W9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerostipes hadrus] (length=471 residues).
MSKEYESKTEHKENLIDIAGLFDDLIKGIIQMKWRFLIILVICGAVFCGYKRLTYSPYYVASSTFTINSSITSENSNSYI
ENATANQMAKSFPYILKSGAFKEVLAQDLGLQSVPGTIEAEVMENTNLFTLKVTANNPKMAEKILKAVVKNYPSVAEFVI
GSSQLTLMDESGVPTTPANPFSYRHEIQIGVLIGILLCILLDVLLALGKNTVKKEEDFKRLFHAKSLGIMPHAKFHKKRT
QTQELIVLDNPRIPRSFLEAARTVRRRIERAQKETGMKSFLVTSAMPGEGKSTVSANIAISLAMKGYKVILVDADLRNPS
TAKVLGMNEQELGTLEVMKGEVNIDDAVQQYKNTSVKVLAGSTPIQDTSTVLSGKNMRQFIKELEAEADFVIIDTPPSGL
LSDAAIVAQYVDGAVFVIRQDYTDVDRILEGMEILSGSGAEITGCILNDVNVRTSESQHYMNSYRTKGETL
>gnl|bykdb|A0A174AMP7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Ruminococcus] torques] (length=240 residues).
MAEQKVIMTDPRQEDYFYQEAIKTLRTNIQFAGMDVKTILFTSCYPNEGKSDITFQLSQEIGKLGKKVLLLDADIRKSIL
ASRYGVGKQVQGLSNYLSGQASIAEIIYRTNYENMDIIFSGSFAPNPSELLGQEAFGTLLGAVREHYDYIIVDTPPIGSI
IDAAIVAKQCDGAVLVFESELVSSKEAARVKEQLLMTGCRLIGAVLNKVDVKKNKYYHRYDYYYHGYQEKKEVTKKNKEK
>gnl|bykdb|A0A174B337 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia obeum] (length=236 residues).
MKKLNLTDKRNPDYFYSEAIKTLRTNIQLSGQSIKTILVTSCYPNEGKSDIVLSLAQELGSIGKKVLLLDADIRKTAYAG
RLGVEEEVKGLSQLLSGQVGLQEIIYSTNFPNMDIIFGGPSAPNPSGLLSENIFKVFLKEIREYYNYILIDTPPIGTVID
AAVIGRCCDGAVFLIEPGNVRYRDAQKAFKQLERSGCRILGAVMNKIDTSDDKYYSSYYKHYGEYYRRSDEEAQIK
>gnl|bykdb|A0A174BC88 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerostipes hadrus] (length=236 residues).
MKKLVMDLPEINDYRMVEGLNQLKTNLAFCGKDIKVITMTSSVPNEGKSSVSLSLSRTLAESGKKILMVDADLRKSVMAA
RYHIQGIDKGLSHYLTGQAEVEDIIYETEVEGLCITVAGPLSPDPTSILDSEQFEQFIENVRDMFDYVIIDAPPLGVVID
AVIIGKYTDGAVIVIEQGMIKRKIVQDVIKQLKRGEVRILGAVLNKVDERIGAYGNYEYKYSYYGESDTEKNHPNT
>gnl|bykdb|A0A174CVN6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Hungatella hathewayi] (length=266 residues).
MQKVEFKKIPQLDFRTNEAFKTLRTNITFCGDDQRVILFTSTVPNEGKTSVVFQLARSFAEDGKRVLLLDADMRKSVLMG
HYRVDRETRGLSHYLVGQESAENVTYNTNIENMEVIFAGPSTPNPAELLGNVRFEEMLGEQRGNYDYILIDTPPLGSVID
AAIIARNVDGAVIVVESGVISYKMVQKVKGQLEKSGCRILGAVLNKVDQENKGYYSGYYSKYYGKYYGYGASGSSDKAEK
SEQNTEVNTVSVSSEEKQAKRSRRRK
>gnl|bykdb|A0A174E477 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium disporicum] (length=231 residues).
MFITKKMPKSLSAEAYRSLRTSIKFSSVDRPIKTLVVTSSIMGEGKSTVAGNIANILSQDGARVLMIDCDLRKPSMHYNF
FVTNGEGLTDLLVGNSDLKSVMKKVDDSLFLITAGTVPPNPSEILGSHGMEKLLEELSVNFDYIVLDTPPVLPVTDALLL
SAKADGTLIVVKSRVTKEKMVKETYDKLIDVRANVIGTVLNGCDKSIDNKYYGYYGDFKKHKEKKFKIKRK
>gnl|bykdb|A0A174F3S2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Fusicatenibacter saccharivorans] (length=521 residues).
MVTVTDTAPIAGQNDEREQKSMNRETYETYSAAEPEKIDLIAFLAEYFQAFQKFFFGVLALVILAGGGSFLTAKLRYQPV
YEAYTSFVVGSNRAVGYSYYDNVTAEQLGKTFPYLVTSGVLKDVVARDLGIGAVTSEIQASVMENTNLFTIRVRDASPET
AYRVMKSVITNYPEVAEYIIGATTLTVVDESGVPAVPVNSQDALRAGTYGAAAGLAAAFLLLFLYVRTRKTIHWADDIKK
LTNAAFLGNLPQAKIKKRSSVKEQTITICNPKVPDAFKEAVQLIRTRMENRIIGKSDCPVLLVTSAVPGEGKTTVAVNLA
EAFAKKKYRVVLLDGDLRNPSVMKCMGLIGRKERGIAAVLKGQMDWEEALTDCRDLTLKILPGAGSTQNPAGLLRSVRMK
TMIESLKEEADLLIIDTPPCGVLSDAALFGGIADGAVLVVHQGTTKDREVRRALEFFEDSQVPVCGYVLNGVQEGTTGYG
YSSYGGYGYGKYGYGYGKYGYGKEKERRNSDRTAREQGGKA
>gnl|bykdb|A0A174F9H9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Faecalicatena contorta] (length=233 residues).
MQEIVLKGMDKDFRSNEAYKTLRTNIEFSGADNKVIVFTSCTPNEGKSTVSLSVSSSLAEAGKKVLFIDADLRKSVLAGR
QKLTGAMKGLSHFLAGQAEVGDIMYKTQKAGLVVMFAGVVPPNPAELLGHKRFENLISSARKVYDYIIIDAPPLGSVIDS
AIIAKQCDAAVMVIASQAISYKFAKNVKKQLEKSECPILGVVLNKVDMKLNQYYGRYYGRYYGKYYGNYGNEE
>gnl|bykdb|A0A174GB62 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lachnospira pectinoschiza] (length=309 residues).
MQTINIETNQQDDYQVRESYRNLRTNIFLSGKDTKVVMFTSCGPNEGKSTVTMNLASSIADGGKRVLFIDCDLRKSVLVG
RYRVKKGVKGLTHFLSGQNTLEEVIYQTNVPDMDVILAGPVPPNPSELLDSPLFKETVRQMREKYDYVIIDTPPLGSVID
AAIVAQVCDGAVLVIAANQVSYKFAQNVMGQLKKTKIKIIGSVLNKVDLSENGYYGRYYGKYYGKYYGSYYGHYNSEESP
DKSFEKARKASSARKNTNNASKPVKRQAGSVGEVAARKKANAAGNNTGVRKKPSADEFDGDFLMDYDEK
>gnl|bykdb|A0A174GBQ1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Eubacterium] rectale] (length=237 residues).
MELVKFGKLKEQSYTMKESLRALKTNIQFCGDDIRTLLVTSSVPNEGKSTVALDLARSLTESGNRVLFIDTDMRKSVLAG
RLRATAASGGEICGLSHYLSGQSRLEEVMYGTEIPGLFMIFAGPSVPNPTEILEKKYFQELLNFGKEHFNYIIIDCAPIG
AAIDAAVVAKYCDGAIIVIGQGMASARMIQSVKKQLEASGVRILGAVLNKVNNKKNSHVSGYYGNYYGSYYGRSDKA
>gnl|bykdb|A0A174GPG9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia wexlerae] (length=236 residues).
MKKLNLTDKRNPDYFYSEAIKTLRTNIQLSGQSIKTILVTSCYPNEGKSDIVLSLAQELGSIGKKVLLLDADIRKTAYAG
RLGVEEEVKGLSQLLSGQVGLQEIIYSTNFPNMDIIFGGPSAPNPSGLLSENIFKVFLKEIREYYNYILIDTPPIGTVID
AAVIGRCCDGAVFLIEPGNVRYRDAQKAFKQLERSGCRILGAVMNKIDTSDDKYYSSYYKHYGEYYHRSDEEAQIK
>gnl|bykdb|A0A174GUR2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium disporicum] (length=228 residues).
MLVVNKLPRSLSAEAYKALRTNIKYASVDKKLQTIVVTSSQPGEGKSTVAGNLAYTLSKDGARVLLMDCDLRKPTLHKKL
DLINEKGVTDFLVHKCDIKLSIHEVEDNLFVMPSGSRVPNPSEILGSRAMEEFLNDLKRAYDYIILDTPPVIPVTDGLIL
AGKADGTILVARSRKTQERILKQSYRDLTNIGANIIGSVLTDLENTRYDKYHEYYGTGRMGFRNRKRK
>gnl|bykdb|A0A174H2B5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lachnospira pectinoschiza] (length=232 residues).
MQTINIERLRKLDYRANEAYKNLRTNIQLCGSDIKVIMLTSTTPGEGKSTVSFNLAVSLAEAGKKVIFIDADLRKSVLVG
RYKINTSVKGLTHFLSGINKFEEVMYATNVENFNVVFSGPVPPNPTELLGNKVFKTLIKVLRDLYDYIIIDTPPIGSVID
SAIVAQECDGVAYVMAANDVSYKYAQKGLEQIKKTDCKLLGVVLNKVDMDDNKYYGKYYGKYYGKYGEHANK
>gnl|bykdb|A0A174HZ21 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium symbiosum] (length=257 residues).
MHDEIVIEDLISPDERGMGELVLKGFEVNDYQYEEAMKTLRTNIQFSGSNIHAVMFTSSAPNEGKSETTFQLAASMAQLG
KKVLLIDADIRKSVLVSRYHLEHQVDGLSQYLSGQCKKEEVVYRTNIPNLNIIFSGPFSPNPAELLEGELFTKLIAWARE
CYDYILIDSPPMGSVIDGAVISRHCDGAILVIESGAISYRLLQKVKNQLEKSGCRILGTVLNKVDIKQGSYYYYGKYGKY
YGYGHENAKQGKEAKVL
>gnl|bykdb|A0A174HZA2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium symbiosum] (length=233 residues).
MDNEVFLKRTAIEDYQYNEAMKTLRTNIQFSGTGIQVVMLTSSVLGEGKSETTFHLAASLAQLDKKVLLIDADIRKSILV
TRYQLDRRVDGLSQYLSGQKKLEEVVYKTNLPNLTMIFSGPYSPNPAELLAEPLFDKLVAWARENFDYVIIDTPPMGNLI
DGAIISRNCDGAILVIESGNISHRLLQKVKGQLEKSGCRILGAVLNKVDVRQNSYYYYGKYGKYYGKEYSSEH
>gnl|bykdb|A0A174IF23 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Clostridium] clostridioforme] (length=243 residues).
MSQFVTLNRIMKDDYHYNEAIKTLRTNIQFCGNGIKTIMLTSSLPDEGKSDITFAMASSLAQIGKKVVMVDADIRKSVLV
SRYHLEREVSGLSQYLSGQRSLENVLYDTNIENLSIIFAGPYSPNPADLLEESLFGDMISKLKEKYDYIIVDTPPMGNLI
DGAIVARQCDGAVMVIESGSISYRLEQRVKGQLEKSGCRILGVVLNKVNMKRNGYYSKYYGKYGKYSKYGHYGKYDRYGK
AEA
>gnl|bykdb|A0A174ITE7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium disporicum] (length=217 residues).
MFIVEKSPKSVAAEAYRALKTNIQYSSFDKEYKTIVITSSNPGEGKSTTAGNLALTLAKGEAKVLLVDCDMRKPSVHKNF
RITNTYGISDILLQKKKVTEVAYSYNKNLSIITAGKVPPNPAEMLASKAMTAFLKEMKDHFDYIVLDTPPVQAVADAQIL
STKTDGTLVVVRAGVTKKDEVKNTINTLNKINANIIGTILHAVDNTRNKYQYYYGNE
>gnl|bykdb|A0A174IWY8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Eubacterium] hallii] (length=245 residues).
MKKLNLKIKDMPYAAEEALNRLRVNIKFCGKNTKKIVITSSVPNEGKSTVSVRLWKLLSEAGFPTVLVDVDLRKSEIQKK
YQVEGIKEGLNHFLSGLAEYEDVVYETNIPNGHIVPVTTLLENPSALLEDPRLGELLDRLAEDYRYVIIDTPPLDNISDG
ALIASMSDGAVLVVRCGETSKALVRQSLQQLDRVGCPVLGTVLNRAEIRSGAYKKYYNRYGKKYGDYYGAYYGGNTTEKK
AGIKE
>gnl|bykdb|A0A174J2H4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Eubacterium] rectale] (length=241 residues).
METVVINQIKDQSYTMKESLRALKTSISFSGKGVKSILFTSSVPNEGKTTVVMDLARSMADSKKSVLIVDTDMRKSVLVG
RLRAKVESGGKIYGLSHYLSGQVSLDKVVYATNIKGVFILFAGHEVPNPTELLETKEFKELIEFGEKNFDYVLVDTPPTG
AAIDAAVVGKNVDGAVIVAAQNVTSSRAIINTKRTLEDSGVKILGAVLNKCRFEESKYGHYYGNYYGNYYGNYYGRDDDE
K
>gnl|bykdb|A0A174KA18 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia obeum] (length=234 residues).
MKEVNIYRQELDYSANESYKSLRTNLLFCGEDKKVIAVTSCTPNKGKSTVSLNLALSLADSGKKVLFIDADLRKSVLMGR
TEVEGEEIKGLSHLLSHQETIENVICATNVPRFHIIYAGIVPPNPAELLGGKYFKRFLSAIRKVYDYVIIDTPPLGSVID
SAVIADECDGSIIVMESGVISYRFAQDVKGQLEKCNCPILGVILNKVDMSKQGYYGKYYGKYYGKYGDKKTEKK
>gnl|bykdb|A0A174KXI0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium disporicum] (length=229 residues).
MFVVEKKPKSVAAESYRTLRTNIQYSSFDKEYRTIVITSSEPGEGKTVTSGNLSLALAQGESKVLLVDCDMRKPTIHKNF
KISNQDGLTDLLLHKKTMEQVMVKYNENLTIIPAGRVSPNPSEMLGSRAMSAFLEEMKNHFDYIVMDTPPLGAVTDAQVL
STKVDATILVVKAGDTKRDVVMNSVNLIKKVNGNLIGTVLNGVEKSNNKYYYYYGSEEVAATAEKKKRK
>gnl|bykdb|A0A174L547 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Coprococcus comes] (length=237 residues).
MKKVNLSIEKKSYGVREAIRTLRTNLQFCGDDKRVILVTSCVPREGKSSVSVALAESIADMGKSVILVDADIRNSVMASK
LQITGADKGLSHFLSGQCVLADVIMATNIPKFHILLSGPKAPNPTELLESKRFTGMLESMKNVYDYIIIDCPPLGLVIDA
AIIGHQSDGAIIVVEAGKTKYRLVQNVKDQLENSGVSVLGVVLNKVERKNQKGYYNKYYGSQKYEGYYGHNEETKNA
>gnl|bykdb|A0A174LG87 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Catenibacterium mitsuokai] (length=290 residues).
MKGALASGAVLVFILALYYFFRDTVKSDKEAKQKLNARLYARIPFEKKKKRNPFKKNRKAILITSLKTSFFYRESINKLR
SKVEASSQKHGYTSFMITSAHENEGKSSVGANLALALAKNGHKTILVDMDFRKPSLNKIFELKTNTSLNNAIEGKAHWKS
QVVTLDHPGLDLLPCQQDLKNSEKLTGSNRLKAIVEELEEEYDYVIVDVSPAYLLNEPMTINEMMDATLFIVRQDYAEKD
MINETISRLTYVKNNVVGIVFNSRVYEPGTMRGTYGYRYGYNRYRTKGGE
>gnl|bykdb|A0A174LKL4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Fusicatenibacter saccharivorans] (length=493 residues).
MSRETYETYSAEPEKIDLIAFLAEYFQAFRKFFLGVLILVILMGGGSFLTAKLRYQPMYEAYTSFVVGSNRAVGYSYYDN
VTAQQLGKTFPYIVTSGVLKDVVARDLQVGAVTSQIEASVMENTNLFTIRVKDSSPDTAYRVLQSVITNYPEVAEYIIGA
TTLTVVDDSGVPVSPINSQDAVHAGMIGAAAGLAVALLLVFIYVRTRKTIRQADDVKKLTNAAFLGNLPEAKIKKRSNVK
EQTITICNPKVPDSFKEAMQLIRTRTEDGIGKADCPVLLVTSSVPGEGKTTVAVNLAEAFAKKKYRVVLLDGDLRNPSVL
KCIGLSERKGRGIIGVLKGQISLDEALTDYRDLSLKILPGVGSTQNPAGLLRSARMKTLIEELKEDADLLIIDTPPCGVL
SDASLLGGIADSAVLVVHQGTTKDREVQRALEFFEDSQIPVCGYVLNGVPEGATGYGYSTYGGYGYGKYGYGYGKYGYGK
EKEGRKSNQSVKE
>gnl|bykdb|A0A174LN64 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Fusicatenibacter saccharivorans] (length=233 residues).
MNQVVVKQEKSGYQIVEAYKSLRTNLQFCGEDKKVIAVTSCTPNEGKSSVSMQLGISLAESGKRVILIDADLRKSVLLGR
TKTQKSVRGLAHFLSGQATLEDVICSTNVKNFYMIYSGPFPPNPAELLGGKNFRSLLNALRKVYDYVIVDTPPLGSVIDS
AIVAEICDGSIMVIESGVISYRFAQEVKSQLERSNCPLLGVVLNKVDMQKQAYGKYGKYGQYKYGDYGQEEDD
>gnl|bykdb|A0A174M0R1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium disporicum] (length=216 residues).
MFVVEKQPKSIAAESYRTLRTNIQYSSFDKEYRTIVVTSSELGEGKTVTSGNLALALAQGENKVLLIDCDMRKPSIHKNF
RISNESGLSELLLHKKTMENISWKYNDNLTLIPAGKVPPNPSEMLGSRVMGTFLDEMKKHFDYIVIDTPPLGAVTDAQVL
STKVDGTILVVKAGSTKKDVVMNSVNLIKKVNGNLIGTVLNGVEKSKNKYYYYYGN
>gnl|bykdb|A0A174MT20 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Fusicatenibacter sp. 2789STDY5834925] (length=308 residues).
MQTVTFNSIEKLDFRTKESYKTLRTNLEFSGKDRKVISITSSTPNEGKTSVSFQLALSIAEGGKKVVLVDADLRKSVLKG
RYKTNAARYGLSHYLSGQASISDISCKTNIPDFYVIFSGPVPPNPSELLGNDAFRLLLEYLRKEYDYVIVDTPPLGSVID
GAVAAQHCDGTVIVVESGAISYKFAQKVKEQLEKVDCRILGVILNKVNMSGKGYYGAYYGKYYGKYYGKYYGNNEEGGLH
AAVVQKGTKGAKAVKGEGNLHSHDNKSIRESGKEKAAEEVVIAEDDMIQLDMDIVELAEDTELIEELK
>gnl|bykdb|A0A174NEJ4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Hungatella hathewayi] (length=236 residues).
MQKVLLRKHDKLDFRANEAFKTLRTNILFSGHDTRVITLTSSTPNEGKSSLSFQLAVSFAEADNRVLFIDADIRKSVLVG
RYKAEGNKFGLTHYLSGQKTIDDVICNTDINNMDMIFAGPVSPNPTELLSGDLFADLIGMAREEYDYVIIDAPPLGSVID
AALIARHVDGTIIVVESGAISYKMVQHVKEQLEKGECRILGVVLNKVDLDRDSYYGNYYGKYYGKYYGNYGEETKK
>gnl|bykdb|A0A174NGP8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Dorea longicatena] (length=236 residues).
MADVILKNLKEINDYRSNESYKTLRTNIEFSGSDKKVIVFTSCTPNEGKSTVTLQLAASLAEAGKKVLFLDADLRKSVLM
GRHRVAGEVKGLSHFLSGQVEIKDIILKTQEPNLYVAFAGVVPPNPSELLGNRRFEALLNGARQAYDYVIIDAPPLGNVI
DAAVIAKNCDASVLVVASREISYKYARVVKEQLELAGCPILGVVLNKVDLKQNKYYGNKYYSKYYGKYYGEYKKED
>gnl|bykdb|A0A174NV94 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Fusicatenibacter sp. 2789STDY5834925] (length=308 residues).
MQTVTFNAIEKLDFRTKESYKTLRTNLEFSGKDRRVISVTSSTPNEGKTSVSFQLAISIAEGGKKVVLVDADLRKSVLKG
RYKSNASRYGLSHYLSGQASISEICCKTNIPNFYVIFSGPVPPNPSELLGNDAFELLLEYLRKEYDYVIVDTPPLGSVID
GAVAAQHCDGTVIVIESGAISYKFAQKVKEQLEKVDCRILGVILNKVNMSGKGYYGAYYGKYYGKYYGKYYGNDEEGGLH
AAVVQKGTKAAKAVKGDTGERSHEGKNGSGSGKEKGLEENGYPEDDMIQLDIDMVQLVEDTETIEELK
>gnl|bykdb|A0A174QKU7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia obeum] (length=236 residues).
MKKLNLTDKRNPDYFYSEAIKTLRTNIQLSGQSIKTILVTSCYPNEGKSDIVLSLAQELGSIGKKVLLLDADIRKTAYAG
RLGVEEEVKGLSQLLSGQVGLQEIIYSTNFPNMDIIFGGPSAPNPSGLLSENIFKVFLKEIREYYNYILIDTPPIGTVID
AAVIGRCCDGAVFLIEPGNVRYRDAQKAFKQLERSGCRILGAVMNKIDTSDDKYYSSYYKHYGEYYHRSDEEAQIK
>gnl|bykdb|A0A174RA28 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia wexlerae] (length=235 residues).
MKKLNLTDKRKPDYFYSEAIKTLRTNIQLSGQSIKTILVTSCFPNEGKSDVVLSLAQELGSIGKKVLLLDADIRKTAYAG
RLGVEEEVKGLSQLLSGQVGLQDIIYETNFPNMDIIFGGPAAPNPSGLLSENIFKVFLKEVREYYNYILIDTPPIGTVID
AAVIGRCCDGAIFLIQPGSVRYRDAQKAFAQLERSGCRVLGAVMNKIDTSSDKYYSSYYKHYGEYYRRSDDESQK
>gnl|bykdb|A0A174RPZ9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Roseburia hominis] (length=381 residues).
MNSKNARAYVKKKMDISSTTYTATISTQQANIINFNVTADTKKEAYYAIGYLTEWYAGSTERYNFPYAINILDESSFSTA
PVNYNSHKGNFMKGALASGAVLVFILALYYFFRDTVKSDKEAKQKLNARLYARIPFEKKKKRNPFKKNRKAILITSLKTS
FFYRESINKLRSKVEASSQKHGYTSFMITSAHENEGKSSVGANLALALAKNGHKTILVDMDFRKPSLNKIFELKTNTSLN
NAIEGKAHWKSQVVTLDHPGLDLLPCQQDLKNSEKLTGSNRLKAIVEELEEEYDYVIVDVSPAYLLNEPMTINEMMDATL
FIVRQDYAEKDMINETISRLTYVKNNVVGIVFNSRVYEPGTMRGTYGYRYGYNRYRTKGGE
>gnl|bykdb|A0A174S915 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Fusicatenibacter saccharivorans] (length=521 residues).
MVTVMDTAPIAGQNDEREQKSMNRETYETYSAAEPEKIDLIAFLAEYFQAFQKFFFGVLALVILAGGGSFLTAKLRYQPV
YEAYTSFVVGSNRAVGYSYYDNVTAEQLGKTFPYLVTSGVLKDVVARDLGIGAVTSEIQASVMENTNLFTIRVRDASPET
AYRVMKSVITNYPEVAEYIIGATTLTVVDESGVPAVPVNSQDALWAGTYGAAAGLAAAFLLLFLYVRTRKTIHWADDIKK
LTNAAFLGNLPQAKIKKRSSVKEQTITICNPKVPDAFKEAVQLIRTRTKDRIIGKSDCPVLLVTSAVPGEGKTTVAVNLA
EAFAKKKYRVVLLDGDLRNPSVMKCMGLIGRKERGIAAVLKGQMDWEEALTDCRDLTLKILPGAGSTQNPAGLLRSVRMK
TMIESLKEEADLLIIDTPPCGVLSDAALFGGIADGAVLVVHQGTTKDREVRRALEFFEDSQIPVCGYVLNGVQEGTTGYG
YSSYGSYGYGKYGYGYGKYGYGKEKERRNSDRTAREQGGKA
>gnl|bykdb|A0A174SE81 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Fusicatenibacter saccharivorans] (length=234 residues).
MNQVVVKQEKSGYQIVEAYKSLRTNLQFCGEDKKVIAITSCTPNEGKSSVSMQLGISLAEIGKRVILIDADLRKSVLLGR
TKTEKSVRGLAHFLSGQASLEDVICATNIKNFYMIYSGPFPPNPAELLGGKNFRSLLNALRKVYDYVIVDTPPLGSVIDS
AIVAEICDGSIMVIESGVISYRFAQEVKSQLEKSNCPLLGVVLNKVDMQKQAYGKYGKYGQYKYYGEYGQEEDD
>gnl|bykdb|A0A174SQL9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium baratii] (length=217 residues).
MFIVSKDPKSIAAENYRILRTNIQYSSFDNEIKKILVTSSEPGEGKSTTAGNLALTFAQDGKKTIIIDCDLRKPTVHKKF
NISNTVGLSDVMLDYKNINKAIHNVDKNLYVLPAGKVPPNPSEMLGSKALDALLDELAKIYDVIVIDSPPLLAVTDAQIL
SKKVDGTVLVVRSNFTKKDAVLAAKEVLTKVKANILGTVLTRADEKKHGYYYYYYGN
>gnl|bykdb|A0A174SRI6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium baratii] (length=215 residues).
MLILEKQPKSIEAESYRILRTNIMYSSFDKEIKRILVTSAEPGEGKSITSGNLALAFAHDEKKVILIDCDLRRPSLHKKF
RISNNKGLSDAIINKDKLSDFIQKRTEYLDILTAGKIPPNPSEMLGSQAMSSLLDELSNIYDVIVLDSPPVLAVTDAQIL
STKTDGTILVVRGEKTKKDTVLAAKEVLTKVNANILGTVLNGGNKNKDNYYYHYE
>gnl|bykdb|A0A174TU68 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Turicibacter sanguinis] (length=242 residues).
MTSMPTIISLSNPKSPEAEAYRTLRTNLQFSTVDHELQTLLVTSSNASEGKTTTICNLAVSFAQIGKKVLIIDGDLRRPR
LHTYLNVSNVKGLSNVLTHQATLEEAMKETVLDIQVLTCGPIPPNPSELLNSNRLKQLLVELKSQFDIILIDTPPVGVVT
DAAILSTLVDGTLIVVASHQTESDQAVRAMKLLNNVGARILGSVLTKVPADRKGYYGYQYYEYTQEHESKKRTRRLKKAK
AR
>gnl|bykdb|A0A174UFK0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Hungatella hathewayi] (length=244 residues).
MQKVLLRKHEKLDFRANEAFKTLRTNILFSGHDTRVITLTSSTPNEGKSSLSFQLAISFAEADNRVLFIDADIRKSVLVG
RYKAEGNKFGLTHYLSGQKTIDDVICNTDINNMDMIFAGPVSPNPTELLSGDLFAELIQKAREEYDYVIIDAPPLGSVID
AALIARHVDGTIIVVESGAISYKMVQHVKEQLEKGECRILGVVLNKVDLDRDSYYGNYYGKYYGKYYGKYYGNYGEETKK
QDKK
>gnl|bykdb|A0A174UYE6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Hungatella hathewayi] (length=270 residues).
MQKVEFKKLPRLDFRANEAFKTLRTNITFCGDAQRVILFTSTIPNEGKTSVVFQLARSFAEDGKRVLLLDADMRKSVLMG
HYRVDQETRGLSHYLVGQESAENVAYRTNIENMDIIFAGPSTPNPAELLGNAKFEEMLCGAREHYDYVLIDSPPLGSVID
AAIIAKNVDGSVIVVESGVISYKMVQKVKGQLEKSGCRILGAVLNKVNQESKGYYGGYYNKYYGKNYGKYSGYGDGGSRG
RAEKSEEKTEMKTAAAGGEENQVKRSRRRK
>gnl|bykdb|A0A174V4X2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Dorea longicatena] (length=232 residues).
MQEIELKEIKKDYRSNEAYKSLRTNIEFSGEDNKVLVFTSCTPNEGKSTVTLALAQSLAEAGKKVLFIDADLRKSVLAGR
HKVHGQLKGLSHFLSGQTELGEVMYRVKDTNMVMIFAGVVPPNPAELLGGKRFESLLTSARKAYDYVIIDAPPLGSVIDA
AIIAKQSDASVLVISANTVSHKFAKVVKEQLEKSGCPILGVVLNKVDMAQNKYYGKYYGTYGDYGRVEEGKV
>gnl|bykdb|A0A174WTS1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Fusicatenibacter sp. 2789STDY5834925] (length=312 residues).
MQTVTFNAIEKLDFRTKESYKTLRTNLEFSGKDRRVISITSSTPNEGKTSVSFQLAMSIAEGGKKVILVDADLRKSVLKG
RYKSNAARYGLSHYLSGQASISDIFCKTNIPNFYVIFSGPVPPNPSELLGNDAFRILLEYLRNEYDYVIVDTPPLGSVID
GAVAARYCDGTLIVIESGAISYKFAQKVTEQLEKVDCRILGVILNKVNMSGKGYYGAYYGKYYGKYYGKYYGKYYGNNEE
GGLHAAVVQKGLKNGKAAKGEENTHSHEIKNGSDPVKEKIPEENQIPEDDMIQLDIDMVELTEDTEPIEKLK
>gnl|bykdb|A0A174XJN9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Hungatella hathewayi] (length=234 residues).
MECIELDHIGQFNRQYREEIKTLRTNIGFLSAAFTMIMFTSTAPNEGKTSTAFQLAVSLAEAGKKILFIDTDIRKSVLVH
KLNLSKKINGLSQALSGQIEPNEIIYKTSKENLSIIFSGPYAPNASELLDNDVCRQLMADLKDKSKYSFDYIIVDTPPLG
NVIDAAIVSKYCDGAVLVVEADRISSRWVRRARQQLEKTGIRILGVVLNKVNPEKGSYYYEKYGNYYNKYAGYY
>gnl|bykdb|A0A174XPP4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Fusicatenibacter sp. 2789STDY5834925] (length=308 residues).
MQTVIFNAIEKLDFRTKESYKTLRTNLEFSGKDRRVISITSSTPNEGKTSVSFQLAMSIAEGGKKVILVDADLRKSILKG
RYKTNASRYGLSHYLSGQANISDICCKTNIPNFYVIFSGPVPPNPSELLGNDAFRLLLDYLRKEYDYVIVDTPPLGSVID
GAVAAQYCDGTVIVIESGAISYKFAQKVKEQLEKVDCRILGVILNKVNMSGKGYYGAYYGKYYGKYYGKYYGNNEEGGLH
AAVVQKGMKGSRAVKGEGNGFPHETKGKPETEKEMGKEDTLTEEDDMIQLDIDVVELTEDMEQIEELK
>gnl|bykdb|A0A174Y0Y6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Ruminococcus] torques] (length=231 residues).
MAIQRVMMTDSRKEDVFYEEAIKTLRTNMQFSGVETKSIVITSCYPNEGKSDVAFQLAVEIGKMGKRVLIIDADIRKSSY
IKRYQIKQKTNGLSQYLSGQVALEEVIYSTNYRNLEIIFSGPYAPNPSELLEQGRFSRLIEETRKAYDYVLIDTPPIINM
SDAAIVAKQCDGAILVIESEAVSRRDAMKAKDQLTKSGCKLLGAVLNKVDMKKEKYYSKYNSYYYGKSKQE
>gnl|bykdb|A0A174Y5V4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Ruminococcus] torques] (length=255 residues).
MNQLNVNLPELPYAVSEAMNRLRINIKFCGKNTRKILLTSCQPNEGKSTISSYLWKMLAEAGFPTVLVDVDLRKSVMKTR
FQMDYDDDTTMGLNHYLSGMAEYEDVIYSTNIPNGYMVPCTQLLENPSALLEDVRFKELLNTLSENYRFVIIDSPPLGSV
SDGALIASLCDGAVLVVRAGTTPRTLIKQSLYEIQQSGCKLLGTVLNRADVKGRAYGKYGYGKYGYGYGYGYGYEPKDKK
NSSDSAAADKNSTGK
>gnl|bykdb|A0A174YNA0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Eubacterium] eligens] (length=236 residues).
MQEFSVKQSNLDFRTREAYKMLRTNIEFSGDNNKVIFITSSTPSEGKSTVSFELAMSFAQNGMKTLLIDADTRKSVMKNR
GKKGKIKYGLTHYLSGKNELKDVICVSDVPNFCMIFAGPVPPNPSELVGNDRFVKMVEEARATFDMIIIDTPPIGSVIDA
AVISKVCDGGILVIGAGDISYKFARKSKEQLEMTGCKLLGCVLNKVDMTGNSYYGKYYGKYYGKYYGKYYGHEDNN
>gnl|bykdb|A0A174Z985 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Ruminococcus] torques] (length=230 residues).
MAIQRVLMTDSRKEDVFYEEAIKTLRTNMQFSGVETKSIVITSCYPNEGKSDVTFQLAVEIGKMGKKVLIIDADIRKSNY
VKRFQVEQKVDGLSQYLSGQVNKEKILYSTNYSNVDFIFAGPYAPNPSELLEQELFSKLIEETRKGYDYVLIDTPPMLSM
SDASIVAKQCDGAILVIQNEAVSRKDALRAKDQLKKSGCKLLGAVLNKVDMKKEKYYNKYNSYYYYGSKE
>gnl|bykdb|A0A174ZLX6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Eubacterium] eligens] (length=236 residues).
MQEFSVKQSNLDFRTREAYKMLRTNIEFSGDNNKVIFITSSTPSEGKSTVSFELAMSFAQNGMKTLLIDADTRKSVMKNR
GKKGKIKYGLTHYLSGKNELKDVICVSDVPNFCMIFAGPVPPNPSELVGNDRFAKMVEEARATFDMIIIDTPPIGSVIDA
AVISKVCDGGILVIGAGDISYKFARKSKEQLEMTGCKLLGCVLNKVDMTGNSYYGKYYGKYYGKYYGKYYGHEDNN
>gnl|bykdb|A0A175C561 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Leuconostoc gelidum subsp. gasicomitatum] (length=254 residues).
MAFFRKRSQIGRDRLSTETMTKGARLITAAEPKNPVSEQFRTLRTNIEFASVAKGDVKTLLISSALPSEGKSTITANLAV
ACAQQGKKVLLVDADLRRPTVAVTFGITDNHGLTNYLADANSDIQAIIHKTSMDKLDVVTSGPVPPNPAELLGSGRMTTL
ISELRAHYDLVIFDVPPFLMVTDAQVLMSKMDGVAIVVSADKTTKGALQRTNDILKIAGSPVLGFIYNDMNRKKKGSAGY
GYGYGYGYGDTKAK
>gnl|bykdb|A0A175M618 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium botulinum B2 433] (length=236 residues).
MDRNLNLITIKEPKSPISEAYRTLRTNIQFSSFDEKISVIFVTSSTPGEGKSTTSANLAITMAQNGSETILVDCDLRKPN
VHKLFKLSNTRGLSNLLIEDNGIDKVIQQSGIENLHILTSGIKPPNPSELLSSKKMKKFIEMSKEHYDYIILDTPPVGVV
TDAQLVSQYSDGGILVTASGQVERELAIRAKQLLQKVNAKILGVVLNKVDTSSGNGYRYYNYYYEEDEKKKKRSKK
>gnl|bykdb|A0A176J4N3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. SJS] (length=231 residues).
MALKRKEKLQSRRRLISLLKPKSPIAEEYRTIRTNIQFSSVEKDIRSAIVTSSGPEEGKSTTIANLAIVFAQQGKKVLLV
DADLRRPTMHLTFSLDNRTGLTNVLTRQATLQQGVRHTEQENLDVLPSGPIPPNPSELLASQMMTTVLEEALAIYDFILF
DTPPVLAVTDAQVLANLVDGAILIADRGKTQIEHAKKAKEQLQNAQAKLLGVILNNKKRNKSKYGYYYGAN
>gnl|bykdb|A0A176TK17 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pediococcus parvulus] (length=251 residues).
MPLFRKKHKLDNESLKRGVGLVTVTDPNSVVSEQFRTIRTNIQFSSAEKKLQSIVITSAEPSEGKSTIGSNLAVVWAKQK
QKVILLDADSRRPTAHRTFNLLNAAGLSSYLTNNAVYEEIIQKTDIPNLSVISSGPVPPNPAELLNSHHVSTLLERLASE
YDMIIVDAPPINTVTDAQLLASKVDGVVLVVPQGIAEKGSVTHAVEQLKMVHAKLLGTVMNRFKADKAPGYYGGYYGGDY
GGYYGVDDKDD
>gnl|bykdb|A0A177KM93 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Domibacillus aminovorans] (length=236 residues).
MALKRKKKTTVAPGSAKRKLITYTDPKSPISEQYRTIRTNILFSSVDESLRSILVTSTSPGEGKSTTIANLAVVFANQGK
KVLLVDADMRKPTMHYTFGLQNTFGLTNILTKQTTLDATAVQSDIENLSILTSGPIPPNPAELLGSVSMKEFLEHSLEKY
DFVLFDTPPVLAVTDAQVLANQCEGTILVVNSGKTEIEGVQKAKDLLQSVKAKLLGVVLNNRTMKDSSYYYYYGKE
>gnl|bykdb|A0A177KZU6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Domibacillus aminovorans] (length=236 residues).
MALKGKKKTPAAPGSAKRKLITYTDPKSPISEQYRTIRTNILFSSVDQSLRSILVTSTSPGEGKSTTIANLAVVFANQGK
KVLLVDADMRKPTMHYTFGLQNTFGLTNILTKQTTLDATAVQSDIENLSILTSGPIPPNPAELLGSVSMKEFLENSLEKY
DFVLFDTPPVLAVTDAQVLANQCDGTILVVNSGKTEIEGVQKAKDLLQSVKAKLLGVVLNNRTMKDSSYYYYYGKE
>gnl|bykdb|A0A177SHW3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Exiguobacterium sp. KKBO11] (length=231 residues).
MAKKSKMNKDARKLITVTQPKSPVAEQYRTIRTNIEFMAVDREVQAILVTSATQGEGKSTTSSNLAVAYAQQGKKVLIID
TDMRRPTVHYTFRVANGLGLSSLLTRQAEKEKAILPTKVDNLSILTAGPIPPNPAELLSSRAMEHLTEQLREEFDIIIFD
APPLLQVADSRITSKLTDGVVLVVGCTTSDRQRVLKAKEQLELAEAKILGVVLNRRELTDDSAYQYYYSYE
>gnl|bykdb|A0A177ZII9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus galactosidilyticus] (length=231 residues).
MAKQNLKPQSGKRKLVAKANPKSPISEQYRTIRTNIEFSAVDEEIRTLMVTSSGPAEGKSTTTANLAVVFAQQGKKVLIV
DADMRKPTVHYTFGVTNTIGLTNVLTRQATLEDAARPTDVENLHVLSSGPIPPNPAELLGSKGMQLFFEKGKELYDMVIF
DTPPVLAVTDAQILANKCDGTVLVVASGKTELESAQKTKELLAAAQAKLLGVVLNNKKMEKTDYYYYYGTN
>gnl|bykdb|A0A178HI32 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Aerococcus urinae] (length=251 residues).
MFNFKQRKIDKKNKEQRRGVSLITAADPNHVISEQFRTIRTNIQFAIDAYHLKTLMFTSSGPWEGKSTIAANVATTMAHL
DGVRVLMIDCDLRKPTVHKTFDIHSRKGLTTYLTDRDVDYMDVAQYVAEVNTYVIPAGPIPPNPAELLSSQRMSDLLEDV
TAVFDLVIIDAPPLLPVTDAQIIASRTDASVFVLREGVASYQDIQKSKRLLESVDANVIGAIYNGADGQGMNAYYGYGYR
DEDIDSEDLQS
>gnl|bykdb|A0A178K546 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. CCUG 49591] (length=227 residues).
MPTLEIAQKKLDLAKKAEEYYNALRTNIQLSGNNLQVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLVDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSHGLCDTNVENLFVVQAGSISPNPTALLQSENFSTMIDTLRKYFDYIIVDTAPIGIVI
DAAIITQKCDASVLVTAAGEANRKDVQKAKGQLEQTNKPFLGVVLNKFNTSAEKYGSYGEYGSYGKK
>gnl|bykdb|A0A178TAJ5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Geobacillus stearothermophilus] (length=235 residues).
MARKPAASIRKAERKLITFDNPKSPIAEQYRTIRTNIQFSFIDAPLRSLIVTSTRPGEGKSTTVANLAVVFAQQGKKTLL
VDADLRKPTVHYTFRLNNYMGLTNVLTGSAPLLPTCQATEIDHLSVLTSGPIPPNPAELLSSKAMAQCLEQLYETFDLVV
FDTPPVLAVTDAQILANQCDGTVLVIESGGTEIEAAVKAKELLEAANAKLLGVVLNKRKHRDGGYYYWLFTTTCT
>gnl|bykdb|A0A178TM66 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anoxybacillus flavithermus] (length=233 residues).
MVLKKKKQVFERTMRSLITKTNPKSPISEQYRTIRTNIQFSVADRPLRSIMVTSSAPAEGKSTTVANLAVVFAQQGKKVL
LIDADLRKPTVHYTFRKDNYIGLTNVLTKQATLQTAVKETDVENLFVLTSGPIPPNPAELLGSATMEELLAEAYDQFNVV
LFDTPPVLVVTDAQILANQCDGTILVVHSGKTEIEAAQKAKELLLAAKGKLLGVVLNQKKQKESNYYYYYGNK
>gnl|bykdb|A0A179CLV7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus aviarius] (length=269 residues).
MGLFDRFKKNKTKLDEDSMKYGVALITRDDPKSGISEQYRTIRTNLKFSFLDPDFKILAVMSALPSEGKSTVSANLAVTW
AEEKKRVLLVDADLRRPTVHRTFKVSNRYGLSNIITSSASTVDISEMIDKTEVENLDVLTSGPTPPNPAELLGSERLSQL
LDFLRERYDFIILDAPPVDTVTDGQIVGTRADGVALVTPQGIATKDAVMRAVKLLQRVNANILGVIMNRFTAQEAGGYYG
GYYGNYYGGSYYGTDDSSSRKGSKKRGKK
>gnl|bykdb|A0A179T2A4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus litoralis] (length=233 residues).
MARKDRKQLFQLQNRSLISFTSPKSPIAEQFRTVRTNIQFSSVDEDLQTMIVTSSGPAEGKSTTTANLAVVFAQQGKRVL
LIDADLRKPTSHYTFRTENHVGLSNVLTRQATLDEAVKTTDQDNLWVLTSGPIPPNPSEILGSKGMQMLLEKAKNEYDVI
ILDSPPVLAVTDAQVLSNLTDGVVLVVSSGKTEIESAKKAKELLDSAKAKILGVVLNNKKVQDSQYYYYYGGK
>gnl|bykdb|A0A179XB34 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus rhamnosus] (length=250 residues).
MNFSLEKVLHRHKEDQETQKNGVMLVTFAEPKHVVSEQFRTVRTNIEFAGAALDQCQVIMFTSSAMSEGKSTVSANVAVT
WAQAGKKVLLIDADLRQPTVHATFRTLNLDGVTTVLTGKEKPDDVVEETFVDNMSIITSGPVPPNPSELLNSKRMAGLLE
WAREKYDIIVLDAPPVLAVSDVQVLVPKTDGVVVVANMGKTLKGDLKRTVEVLKLANAKILGSVERVKAKHGDRGYGYGY
GYGYGNESNK
>gnl|bykdb|A0A179YJI1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus rhamnosus] (length=250 residues).
MTLKFKKLFSHNHVDQETQKNGVFLVTFAEPKHVVSEQFRTVRTNIEFAGAALDKCQVIMFTSSAMSEGKSTVSANVAVT
WAQAGKKVLLVDADLRRPTVHATFRKLNLDGVTTVLTGKTKPDEVVEDTFVDNLSVITSGPIPPNPSELLNSKRMGQLLD
WTREKFDIIVLDAPPVLAVSDVQVLVPRSDGVVVVANMGKTLKGDLKRTVEVLKLAKAKILGSVERVKARRGDKGYGYGY
GYGYTTENQR
>gnl|bykdb|A0A181EI04 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=230 residues).
MTNTRRSTSSLIVHEQPKSPISEKFRGIRSNIMFANPDSAVQSIVITSEAPGAGKSTIAANLAVAYAQAGYKTLIVDGDM
RKPTQHYIFNLPNNEGLSSLLLNWSTYQDSIISTEIQDLDVLTSGPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPP
VNTVTDAQLFSKFTGNVVYVVNSENNNKDEVKKGKELIEATGAKLLGVVLNRMPKDKSASYYAYYGTDES
>gnl|bykdb|A0A192F4W5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus sp. AntiMn-1] (length=196 residues).
MFSNANSEIKSLLITSEKPSSGKSTVTANIATTYAQAGYKTLIIDGDMRKPTQQYIFDLTNFNGLSNFIIGKALSKDAIK
ETHIENLSVLTSGPVPPNPSELITSEKFTELFNKLSEEFDCILIDTPPVTTVTDAQLYAQNVRDCILIIDITANDKSEVK
KAKELLEKSGGKVIGAVLNKATIDKGSNYYYYYGDE
>gnl|bykdb|A0A192H246 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus backii] (length=248 residues).
MALFRRKEKKLEDKSMKYGVDLYTLSNPTSTIAEQFKTIRTNIQFSMIDRKLETLLVTSAGPSEGKSTVSSNLAVTWAGQ
GKNVLLVDADLRRPTVHQTFQVSNSQGLTTLLTNPKLNLDQAITETAIDHLYVLPSGPIPPNPAELLATERMNHLIEALK
EHFDLVLFDVPPVISVTDTQILASKVDGTILVTPQGIVEKAAILKAKELLDKVHARILGTVMNRVTPQNSGGYYGGYYGG
YYGTDDKK
>gnl|bykdb|A0A193D087 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis serovar coreanensis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTNSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSIYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A198A864 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. 1ZS3-15] (length=230 residues).
MRSMRTLINKHPLITESHPKSQVSESYRTLRTNIQFSSIDRSMKTLLVTSAQPGDGKSTTAANLSVAYAQEGKKVLIVDA
DLRKPTLHHYFGKSNRYGLTSAIVNRNQFDEFICETSIENLFLIPSGPIPPNPSELLMSQKMTVFLEEMAARFDVIIIDS
PPTLAVADAQILATKCDGVVMVIRDGKVKRDMARKAIHNLQRVQAKVLGVVLNNKRPKKSDGAYYDYYGD
>gnl|bykdb|A0A198ALD2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. 1ZS3-15] (length=229 residues).
MSNSTNKRPIITHQNPKSPISESYRALRTNIQFSSIDEELRVIMVTSAGPGEGKSTTLINLAVAYAQTDKRVLVIDGDLR
KPTMHHTLRVSNRWGLTNLLTNELTIREVLQDTFIPNLQIITSGPIPPNPSEILASKKMTSTIEELKQRFDVILIDAPPA
IAVTDSQIISSRSDGVILVVNSDRTKREAVLKAKQNLDNVRARILGVVLNNVDRKNKDAYYYYYYGESQ
>gnl|bykdb|A0A199QC01 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus paraplantarum] (length=242 residues).
MFKRKEQNTTTTAPINLTAINEPMSVITEQIKTIRTNINFAASDRKLRTLMVTSAMLGEGKSTVSGNLAVEYAKEGMQVL
LVDADLRRPTIHKTFGLKNQKGLSSWLGNQLEDVNDAIHPVIGNLFVMTSGPKPPNPAELLGSNKMTEFLTSATRKLDLV
IVDAPPILPVTDSQLLANKVDGTVLVVRQGVAQKAAVRDAVRSLKKSHANILGSVLNDVRDSSHHGYYGYDNGYGYYSNE
DK
>gnl|bykdb|A0A199QE22 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus paraplantarum] (length=235 residues).
MKLRRRVANMHTGIQLTTLTAPMSVVTEQVKTIRTNLNYAMVGKPLKTLMITSAIQGEGKSTVGSNLAVEYAKKGLQVLL
VDADLRRPTIHQTFAISNQRGVSSWLSGQLTDVNEAIYPVLDHLFVMPSGPKPPNPAELLASDRMTEFLTVATRKLDLVI
VDAPPILPVTDARILAGQVDGTVLVVRQNFVEKVAVRQAVSALKNARAQLLGTILNDVDIKTHGYGYGYYGTETN
>gnl|bykdb|A0A199QH59 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus plantarum] (length=242 residues).
MFKRKEQNMTTTAPINLTTINEPMSVITEQIKTIRTNINFAATDHQLRTLMVTSAMLGEGKSTVSGNLAVEYAKEGMQVL
LVDADLRRPTIHKTFGLKNHKGLSSWLANQMDDVNDAIHPVIGNLFVMTSGPKPPNPAELLGSNKMTEFLTSATRKLDLV
IVDAPPILPVTDSQLLANKVDGTVLVVRQGVAQKAAVRDAVNSLKKSQANILGAILNDVRDGSHHGYYGYNNGYGYYSNE
DK
>gnl|bykdb|A0A1A5VE64 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pediococcus acidilactici] (length=248 residues).
MFFKKKPKLDNESLKNGVGLITYNDPTSTIAEQFRTVRTNIQFSSVDKQLKSIVFTSSAPSEGKSTVSNNVAVTWADQGK
SVLIVDADMRRPTVHRTFRTSNAVGLSNLLAGTGSLDDAIHSTVVENLSVMPSGPIPPNPSELLGSSKMVNLLGVLTTKF
DLVIIDAPPVNTVTDAQVLAARADGTVLVVPQGIADKAGVRHAKQMLETVQANILGAILNRASAEKSTGYYGGYYGGYYG
GYYGTDDK
>gnl|bykdb|A0A1A5YS96 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus oryzae] (length=229 residues).
MSQSKNKRQLITLSNPRSPISESYRSLRTNIDYSAIDEKIQVIMVSSAGPGEGKTTTITNLAITYAQSERKVILIDADLR
KPTAHHNFSISNRWGLSSVLSQQCTLEESIQSSSVPGLDVITSGTIPPNPAEMLGSNRMNAVIQQLRDMYDIILIDTPPL
LAVTDAQIVATKSDGAIMVVDQGRVKRDIAKKAIQNLQTVNARILGVVLNNVKRKANEESYYYYYGAKE
>gnl|bykdb|A0A1A6AIM3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium ragsdalei P11] (length=240 residues).
MEKPDIITVKNPKDPIAEAYRTLRTNIQFSSFDKKIQTIMLTSSGPGEGKSTTCSNLAVVMAESGSKTIIIDCDQRKPRL
HKIFLTSNEIGLSDVLAGKVEFEDAVKETGVENLNLLTSGTRPPNPSELLGSKKMENFLQDLKEKYEYIIIDTPPVVAVT
DAQLLSRYADGCLLVIASSQVEKEAAVKAKELLVKVNANVIGVVLNKLEIKEKGYYGYYYHYYYGSDGTKIKKKKKKTKK
>gnl|bykdb|A0A1A7LXF3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Solibacillus silvestris] (length=235 residues).
MKKKKNGLKDSQIARKLVTFTETKSHIIEQFRTIRTNIKFSMPDEPLKTILITSSTPGEGKSTNAANLGVVFAQEDKRVL
IIDADMRKPTLHHTFKTFNKVGLSNILARRSALHDAVQETFIVGLDVITSGPIPPNPAELLSSQGLDALLQHVKNDYDII
ILDSPPLLSVTDAQILANKCDGTIMILNTGVVDKRAVKKAKALLSASHTKILGVVLNNYKTPNHFNYYNGYHYAE
>gnl|bykdb|A0A1A7LXJ0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Solibacillus silvestris] (length=237 residues).
MFNKFKRKKSQPTTLARKLITDSNPKSIVSEQFKTVRTNINFSMPDKDLKTLVVTSSTPGEGKSTNASNIAVVYAQSGKK
VLLVDGDMRKPTTHHTFGVRNVGGLSTVLIRQDTVEEVVHETHIEGLSLITSGPIPPNPAELIASKTMDHFIETVKGKYD
LVIFDAPPVLSVTDAQILSNKCESTILVINSGKAEKENVIKAKEMLIASKANIIGAVLNNYAIDKNHYYYQYYGAVE
>gnl|bykdb|A0A1A7T279 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus faecium] (length=227 residues).
MKVRETRLISIENRFSPITEQYRNVRTSIQFAASAGDPLKLLLVTSTEQEEGKTTLAANLAVVMSETNKKILLIDGDLRR
ATAGKYFNMRSSQAVGLSTLLNNGRSSLNEAIQRTQVKNLDFLPAGPIPPNPSELLNSLRLHELFSELEDQYDAIIVDSP
PLLVVTDAQIFSSKVDGVILVVRENRTKRNNLIKCKTLLERSKAHLIGVVYNGAKSMGAGNYKYYKY
>gnl|bykdb|A0A1A7UGI4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus faecium] (length=232 residues).
MARTQKQKAAQTHAVSLVTLTNPSSPIAEQYRTIRTNIQFASAAGQQIKTIVVTSSGPGEGKSTTAANIAVVFAKSGQRV
LLVDADLRKPVIYKTFKLNNASGLSTVLSSSGSVADEIQRTPVENLSILPSGPKPPNPSELLSSPRMDQILAEARQLFDV
VIFDMPPVVAVTDAQIMSSKTDGTLLVVRENMSRKESLTKAKELLDMVQARVLGVVYNGAEHSKDAGYYYGN
>gnl|bykdb|A0A1A9BK55 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=226 residues).
MPTLEISQAKLELAKKTEEYYNALCTNLQLSGDDLKVFSISSVKAGEGKTTTSTNIAWAFAHAGYKTLLIDADMRNSVMS
GVFKSRERITGLTEFLSGTTDLSQGLCDTNVENLFVIQAGSVSPNPIALLQSKNFSTMLGTLRKYFDYIVVDTAPIGIVI
DAAIIMQKCDASILVTKAGETKRRELQKAKEQLEQTGKSCLGVVLNKFDTSVDKYGFYGSYRKQKK
>gnl|bykdb|A0A1A9BK99 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=229 residues).
MPTLEISQAKLDFVKKAEEYYNALCTNLQLSGDDLKVFSITSVKLGEGKSTTSTNIAWAFAHAGYKTLLIDGDIRNSVML
GVFKARDKITGLTEFLSGTTDLSQGLCDTNVENLFVIQTGSVSPNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGVVI
DAAIITRKCDASILVTEVGEINRRDIQKAKEQLEHTGKPFLGVVLNKFDTSVDKYGSYGNYGDYGKNKK
>gnl|bykdb|A0A1A9E1L1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus agalactiae] (length=229 residues).
MTRLEIVDSKLRQAKKTEEYFNAIRTNIQFSGKENKILAITSVREGEGKSTTSTSLALSLAQAGFKTLLIDADTRNSVMS
GTFKATGTIKGLTNYLSGNADLGDIICETNVPRLMVVPSGKVPPNPTALLQNAYFNKMIEAIKNIFDYIIIDTPPIGLVV
DAAIIANACDGFILVTQAGRIKRNYVEKAKEQMEQSGSKFLGIILNKVSESVATYGDYGNYGKRDRKRK
>gnl|bykdb|A0A1A9PPL3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus wiedmannii] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNVEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTAVDNLHFLACGPIPPNPAELLGSKSMQELLGQAYSMYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKESAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A1B1IEU0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. oral taxon 064] (length=230 residues).
MPTLEIAHKKLDQARKAEEYYNALRTNIQLSGNNLKVIAITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEYLSGTTDLSQGLCETNVENLFVIQAGSVSPNPTALLQSENFATMIDTLHKYFDYIIVDTAPIGVVI
DAAIITQKCDASVLVTAAGETNRRDVQKAKEQLEQTSKPFLGVVLNKFNTSVEKYGSYGAYGNYGNYGKK
>gnl|bykdb|A0A1B1LFY0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis] (length=233 residues).
MALNLFKKKKNYRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A1B1S2X0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planococcus versutus] (length=233 residues).
MARKKKVLQETARKLITFTTPRSVVSEQFRTLRTNINFSSPDAEIRTIVVTSAAPSEGKSTTSANLAVVFAQEGKKVLLV
DGDMRKPTTHYTFRMGNTIGLSSVLTRQSSIQEVIRPTAVERLDLMTCGPIPPNPAELLASQSMNTLIGQLKNMYDLIIF
DAPPVLSVTDGQILANKCEGTILVVSSGNTEKDMAVKAKEAIESSNSRLIGAVLNNFALPKDSYYYQYYGNTE
>gnl|bykdb|A0A1B1S369 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planococcus versutus] (length=219 residues).
MTITHPKSRVSEQFRTLRTNIHFTSPDGDIRSLVVTSASHSEGKSTTSSNLAIVFAQEGKRVLLIDADMRKPTMHQTFKI
PNTRGLSNVLARQIALKMAIQSSGIENLDLLPCGSIPPNPAELLSSPNMDFLFDHALDTYDLLIFDTPPVLSVTDSVILA
NKCEGTILVVNSGKTERAQALKAKEAITAAAKIRLLGVVINNVENQQEMGDAAYYGANE
>gnl|bykdb|A0A1B1S3A4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planococcus versutus] (length=234 residues).
MRTKNKTKRVMPRKLVVRTNPQSIAAEQYRTIRTNINFSIPELDSKVLLFTSPAKEEGKSTTAANMAIVFAETGKKVLLV
DADMRRPTLFRTFQLGNSTGLSNLLLRKGNLKHSVKASGIANLDLLMSGQIPPNPAELLESDALDELLEEMRGLYDYVLF
DSPPILSVTDSKILANRCDGTVLVINTGKSEKISVEKARDSLATSKAFIVGVVLNNYPMTNENYYYHNYNEEMN
>gnl|bykdb|A0A1B1Z952 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Fictibacillus arsenicus] (length=227 residues).
MFKSKKKLNNQRLLVADLNSKSPVFESYRTLRTNIQFASVDQDIKKIVITSPKPGEGKSTTVANLAIAFAQQGKKVLLID
ADLRKPTVANTFSLPNTSGLTNVLSRQSKIEQVIQQTAVENLHILTSGPIPPNPSELLGSNSMKELVAKAENEFDIILFD
SPPVLAVTDAQVLTNLSDGTILVVRSGSTDQDAAKKAKDLLQVGKSRLLGVVLNGKNQKQEQYYYYY
>gnl|bykdb|A0A1B2A215 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Leuconostoc lactis] (length=252 residues).
MTLFRNKYKVGRDGLSRDTMLNGARLITALEPKNPVSEQFRTIRTNIEFASVAKGNVKTLLVSSPLPSEGKSTITANLAV
AYAQQGKKVLLVDTDLRRPTVGVTFGIADNHGLTNYLADVNSEPQSIIRHTRLETLDVITSGPVPPNPAELLASSRMTDL
IAELRQRYDLVIFDVPPFLMVTDAQVLMSKMDGVAVVVSGRQTTKGALQRTTDMLKLADAPVLGFIYNDRTRKKNSGNGY
GYGYGYGYGDAK
>gnl|bykdb|A0A1B2A5M0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus curvatus] (length=242 residues).
MGLFRKEKGLDQASMKEGVGLITLTEPTSVIAEQFRTVRTNIQFSSIDQKLRSVVFTSAGPSQGKSTVSANVAVTWADQG
VDVLLVDADMRRPTVHQTFQVPNKKGLTSLLTEETFDLNSAIQKTPVDHLFVLPCGVVPPNPSELLNTKKMDKLIQELTK
HFDLVIFDVPPVVSVTDAQILASKVDGTILVVPQGIVEKGSVAKAKELLEVVNARILGTIMNRVKAENTGGYYGGYYGTE
DK
>gnl|bykdb|A0A1B2DHX8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. BIHB4019] (length=225 residues).
MSRTKPNWPLITETNPKSPISEAYRILRTNIDFSNLEEEIRTLMVTSTKMNEGKSTTSANIAVTYAQSNKRVLLIDADMR
KPTQHQLFRVSNQIGLTSVLSNQKEWENAIQATSVSGLSILPAGPVPPNPSEMLASKRMDQLLEKMKEHYDIIIVDTPPI
MVVTDAQIVASKSDGVVLVIDSGTVKKEVAIKAKASLEHVKARILGVVLNKIKRSSSEGYLYYYQ
>gnl|bykdb|A0A1B2DJQ4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. BIHB4019] (length=230 residues).
MRRLTSETNLVALTNPNSPISEVYRTLRTNIQYAEIDTPKQILMIASSQPDEGKTTTITNLAVTIAQEERKVLLVDADMR
KPSLHQVFDKPNRIGLSSAISNQFSWQEAVMDTMVEHLSVITSGPIPPNPSEMLGSNRMKALVQEWKEHYDVILFDTPPV
LAVTDALIVSAFCDGVVLVVLAGKVKKEMVKKMKANLDRVQAQIVGVVMNKINPKDSEDIQLQYYETAKS
>gnl|bykdb|A0A1B3XK93 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus muralis] (length=228 residues).
MKPRTATKKINKNNLITKIDPKSLISEDFRVIRTNIDYSRIDSQYKSIMITSPEPNSGKSVVSANLAVVFAQQGKSTLLI
DGDLRKSSVQYFFPEVRSAGLTALLTGRISLEEAIEETEVKNLFVLPAGFISTNPAELLSSKKMKELFKRLLTMYEQIII
DTPPILAVADAQIISSLVDGTILVFRSGYTSKTNAKKSVHVLQQVHGKIICSILNDHKNKKDAYYYGK
>gnl|bykdb|A0A1B3XRM4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus muralis] (length=225 residues).
MRSKDKKQVNLIAQNNPKSPITEQYRLIRTNIQFSSVDEDIQTIVVTSAEPNDGKSTTSANLAIVLAQEEKKVLLVDADL
RKPSVHYAFGLSNIQGLTSVLTKKMSIETAVMQTDVPNLEILTSGPIPPNPSELLNSRAIGITIKELKEMYDYIIFDTPP
VLVVPDSQIVANKCDGVIMVVSSGKTNKQSAVKAKELLTKANTSVLGVVLNGVETDNSNYYYYQS
>gnl|bykdb|A0A1B8RQ73 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium paraputrificum] (length=211 residues).
MLENPTTIYAEAYSKLKTSIKYSSADKNNKVFLITSSEKGEGKSTTATNLAISLSFDKKKVLLVDCDLRRPSLHKYLRIS
GECGLTEVIIGETNVEKAIVNIKDNLFFLPSGNRPPNPAELLGSENFELMLKELKDIFDYIIIDSPPLRVVADAQILSSK
VDGVILVVKYGFTKKDELLVCRETLELVGGKLIGTVINGDKKENDYKYYYY
>gnl|bykdb|A0A1B8RSH5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium paraputrificum] (length=219 residues).
MFIVEKKPNSIAAEAYRTLRTNIQYSSFDKEIKTMVVTSSEPGEGKSTTAGNMALSFAQSEKSVILIDCDLRKPSLHRKF
KISNLVGLSDVLIGKEKMNDAVNEYSENLHILTSGKLPPNPSEMLGSKAMGRLLEELKSKYDIIILDSAPLQAVTDAQIL
STKVDGTILVVRAEKTKRDSVQQAKALLDKVGANVLGTVLNGVENTRKKYYYYYGNEGK
>gnl|bykdb|A0A1B8VZJ1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. FJAT-27264] (length=229 residues).
MSQSPNNQQRHLITVTNPRSPISEAFRALRTNIDFSSVDEKIQIIMITSSGPEEGKSTVSANLAAAYAQSDKKVLLIDGD
LRKPTAHKTFKLSNRYGLSSLLSKQADLEDVVQESGVPNLSLITSGPLPPNPAEMMASNRMTTVLQEMREVFDIVIIDTP
PLLAVTDAQIVASKSDGVIMVVSYGKVKRDIAMKAKSGLDRVGAKMLGVVLNNVKRKASEGYYYYYYGN
>gnl|bykdb|A0A1B8W3L6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. FJAT-26390] (length=230 residues).
MSRSKNKRQIITLTNPRSPISESYRALRTNIEFSSIDEKLQVLMVSSAGPGEGKSTTITNLAVTFAQSEKKVVLIDADLR
KPTAHHTFSISNRWGLSSVISQQCSLEEVLQVTDIPNLDVITSGAIPPNPAEMMNSKRMTAIIAQLRGMYDIILIDTPPL
LAVTDAQIVATKSDGVILVVDQGKVKREIAGKAVKNLESVNARILGVVLNNVKRRANEESYYYYYGVQDK
>gnl|bykdb|A0A1B8WAI5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. FJAT-26390] (length=230 residues).
MSRLIPKWNLITELNPKSPISEGYRMLRTNIEFSTINQKLQIIMVTSSKPSEGKSTTCANMAVAFAQANKKVLLIDADLR
KPSQHHIFGKSNRSGLTTALFNQLKLEDIIQFTGTENLSIIQAGPTPPNPSELLSSDQMADLLKKARERYDVIIIDTPPI
MSVTDAQIVATQSDGVVLVVDSGKVKKDVALKAKASLEHVKARLIGVVLNKINRNHSDIYSYYYGEKTDA
>gnl|bykdb|A0A1B9AL51 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. FJAT-27986] (length=232 residues).
MARKKSRQFGNSNQRKLVTYLEPKSPISEQFRTLRTNIQYSFIDEEMQTIMITSSGPTEGKSTTAANIAVVFAQQGKRTL
FIDADLRKPSSHYTFSFTNNVGLTSVLTRQIELGKAIQIVEPLGLHVLTSGPLPPNPAELLSSKSMNELINQTKEDFDII
IVDTPPITAVTDAQIIANICQGVVLVVSSGRTQVEDAVKTKELLLNTGTKILGAVLNNRKMKDNTYYYYGKK
>gnl|bykdb|A0A1B9AL75 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. FJAT-27986] (length=232 residues).
MARNKGKQTGNRNQRKLITMWDAKSPISEQYRTLRTNIQFSSVDEEIQTMLVTSSGPAEGKSTTAANIAVVFAQQGKRTL
FIDADLRKPSSHYTFSVTNTFGLTSVLTKHSNLEEAVNIVEPLGLHVLTSGPIPPNPAELLSSKAMKELINEAKNDYDLI
IIDTPPVTAVTDAQIISSLCQGIVLVVSSGKTQIEDAIKTKELLTKTGTKILGVVLNNKQMKDNTYYYYGNH
>gnl|bykdb|A0A1B9AQ17 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. FJAT-27225] (length=226 residues).
MSREKAQSKTSPRFLITKLHPRSYISEQYRTVRTNIQFASADADVRTLLVTSASPGEGKSTTTANLAVVFAKHGKSVLLI
DADLRKPTVHYTFSVKNYRGLSNILVGEATLIEAVVASEVENLDILTSGPIPPNPSELLDSKRMETLLQEAKSHYDIVLI
DTPPVLVLTDTQILANLCDGSILVVRNKVTQLEDAQKAIEVLKASEGKVLGTVLNGTSSKETNYYY
>gnl|bykdb|A0A1B9AVC6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. FJAT-27225] (length=236 residues).
MALNRRKKPQTGDKRVKLVTLFDPKSTISEQYRTIRTNIQFSSVDREIRSLMITSSGPAEGKSTTAANMAVVFAQTGKKV
LLIDSDLRRPTVHYTFSLPNTYGLTNVLTKQIQFEEAIRETEVENLFIMTSGPIPPNPAELLGAATMNQLFETAYSHFDI
VLFDTPPVLAVTDAQILANKCDGTLLVIYSGKTIIEQVTKAKELLEAAQGKLLGTVLNHKEIKGNDYYYYQYYGGK
>gnl|bykdb|A0A1B9AYT6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus wudalianchiensis] (length=235 residues).
MALKKNKKKEAPGQAQRKLIAKTDPKSPISEQYRTIRTNILFSSVDQEIRSLMVTSAGPGEGKSTTTANLAIVFAQQGKK
VLLVDADMRKPTMQYTFNTSNTIGLTNVLAKQKVLEAAVFETDVDGLDLLSSGPIPPNPAELLGSKAMAELVQEAYDQYD
VVIFDTPPVLAVTDAQVLANQCDGTVLVINSGKTEIDGASKAKELLESAKAKLLGVVLNNRKLKESSYYYYYGTK
>gnl|bykdb|A0A1B9B2F8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. FJAT-27986] (length=219 residues).
MSKERAKYAQIYKQSIVSEQYRLLRSSITFSRIGKDIQTLLVTSPNHGDGKTTTAANLGIVLAQHDKKVIVIDADLRRPK
IHKLFDLKQSDGLTAILAGKATVDEAICISDIPNLHIIQSGPVTKTSYELLTANRIEDIISILSQQYDTIIFDTSPILYT
AETQILANLCEASMLVVKSGQTLKEDARKAVNVLQDSKAELLGASLNGNPIKPKAYQYN
>gnl|bykdb|A0A1B9BQ18 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium beijerinckii] (length=238 residues).
MFSAKRLNKAVANQEYKGFVVEKKPKSIVSEAYRTLRTNIQYSSFDKTIKTIVITSAEAAEGKSTVSGNLALSFAQNEKK
VIIVDCDLRKPSVHKNFKLSNLSGLSEVLIGKEDLDKVIQNRNENLDILTSGKIPPNPSEMLSSTAMTNLIQKLGEKYDI
VILDSAPLQAVTDAQILSTKADGTILVVRAQRTSRESVIDAKNLLTKVGANILGTVLHAVENTRGKYYYYYGSSEEGK
>gnl|bykdb|A0A1C0A6S9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Orenia metallireducens] (length=224 residues).
MIVKHNPKSPASEAYRSIRTNISFLSPDNPLTKIAVTSSGPSEGKSLTIANLAVSMAQNGKKVVIIDADMRKPMQHKFYD
LPNFEGLSNILTSEIEFEDGLRETGIDGLKVVTTGTVPPNPAELLNSKRMEEVIKKAEKEADMVFIDTPPVIAVTDAAVL
SNKVDGIILIVASHQTEEQMMVRAKENLDKANANIIGTIITKYPVSTKGGYYNYYYYYGNSFKG
>gnl|bykdb|A0A1C0BIN1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. W14A] (length=224 residues).
MDPSLTFQVTEAYKVARTSLAFSLLKKGCKKVIVTSSLDAEGKSTTSVNLAKSLAQQVDIKVLLIDSDLRRPKIHEYFGL
ENTVGLTNYLGNMCGVKDVTRPTEEPNLSVICSGVAVPNPSELLASSAMKNLLACLEPYYDYIIMDTSPVNIVVDALPLA
KISDGVIIVVRDGISTYPELTKTVETLKMAEAKILGIILNGMKPEPRDCRYRYDRYGKTCEPCP
>gnl|bykdb|A0A1C0UNG0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=227 residues).
MPTLEISQAKLDFVKKAEENYNALCTNLQLSGDDLKVFSITSVKQGEGKSTTSTNIAWAFARAGYKTLLIDGDIRNSVML
GVFKARDKITGLTEFLSGTTDLSQGLCDTNIENLFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGVVI
DAAIITQKCDASILVTKAGEINRRDIQKAKEQLEHTGVPFLGVVLNKFNTEVEKYGAYGVYGNYKKG
>gnl|bykdb|A0A1C0Y7Z1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Caryophanon tenue] (length=239 residues).
MFNKKKKQRAKRTPSTLARKLITIESPKAIVSEQFRTIRTNISFSNPDKEIKSVIVTSSSPGEGKSTNSANIAAVYAQGG
KRVLLVDADMRKPTVHHTFNLKNTKGLSNLLTHQITMSEAVHETEQENLFVMTSGPIPPNPAELLASKSMNQFILDVTAA
YDFVIFDVPPVLSVTDAQILSNRCDGTVLVVNAGEADKAMVQKAKEALVASKANILGVILNNYVLERDHYYYQYYGQPE
>gnl|bykdb|A0A1C0YM54 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Caryophanon latum] (length=242 residues).
MFFKKKKKSKKRTTATLARKLITVENPKAIVSEQFRTLRTNINFSNPDKVLKTILVTSSSPGEGKSTTSANVASVYAQEG
KRVLLVDGDMRKPTVHHTFGLKNTKGLSNVLTRQVSIEEAIQPSTLDNLSIMTSGPIPPNPAELLASKSMEQLIGELTAQ
YDFVIFDAPPILSVTDSQILSNRCDGTVLVVKAGEAEKAMVQKAKESLVASQANILGVVLNNFVLAKDNYYYYQYYGQAE
SN
>gnl|bykdb|A0A1C0ZRK7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus pectinilyticus] (length=229 residues).
MSNSTNKRPIITHQNPKSPISEAYRALRTNIQFSSIDEELKVIMVTSAGPGEGKSTTLINLAVAYAQTDKKVLIIDGDLR
KPTMHHTLRVSNRWGLTNLLTNQLSIQEVLQDTFIPNLHIISSGPIPPNPSEILASKKMLSVIEELKLQFDVILIDAPPA
IAVTDSQIIATRADGVILVVNSDKTKRDAVLKAKQNLDNVRARILGVILNNVDRKNKDAYYYYYYGETQ
>gnl|bykdb|A0A1C0ZSF7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus pectinilyticus] (length=236 residues).
MRTLTNKTSKADKAVSHQLITDIRPKSQVSEAYRTLRTNIQFSSIDHMMKTVLITSAQPAEGKSTTAANLSVAYAQEGKK
VLLIDADLRKPTIHHYFAKSNRYGLTSTLANQTEIEEVIFKTTVENLFIITSGPIPPNPSELLMSQKMTALLADMATQFD
MIIIDSPPTLAVADAQILATKCDGVVMVISEGKVKRDVARKAIENLERVQAKILGVVLNNKRHKKSDVSYNYYYGQ
>gnl|bykdb|A0A1C1ZE09 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus reuteri] (length=247 residues).
MSLFHRTQQQSTDTMDNGAKLITVAHPKSPISEQFRTIRTNINFMAIDKPIKTLAMTSANVSEGKSTVTDNVAVVWAQTG
QKVLLIDSDLRRPTLHATFNKSNQHGLTTILTSGTNSVDLREIIQPSGVDNLDILTAGPIPPNPAELLNSQRMKTLLDTV
KGIYDMVIVDVPPMLEVTDTQILSRHLDAVVLIVKQGQTQKLAVKRAVELLNLAHANLLGYVMNDVNAEGDAAYGYGYGY
GYGEDTK
>gnl|bykdb|A0A1C2D3B3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus crispatus] (length=261 residues).
MSLFRKKRGTDDTIKHGAQLITVADPRSAVAEQFRTVRTNINFMAVDENINTLAFTSANISEGKSTVTANVAITYAQAGR
KTLLIDADLRRPTLHSTFNVKNNTGLTTVLTSEADEINLNDVVEESGIDNLSILTSGPIPPNPAELIGSRRMETFIELVK
SHYDMVIIDLAPVLEVSDTQELASHLDGVVLVVRQGVTQKAGITRAVQMLKFAKARILGYVMNDIRAENGGYGYGYGYGY
GYGYGAEKKKGLFGRKKSDDQ
>gnl|bykdb|A0A1C2G545 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus reuteri] (length=250 residues).
MSLFHRTQKQSTDTMDNGAKLITVAHPKSPISEQFRTIRTNINFMAIDKPIKTLAMTSANVSEGKSTVTDNVAVVWAQTG
QKVLLIDSDLRRPTLHATFNKSNQRGLTTILTSGTNSVDLREIIQASGVDNLDILTAGPIPPNPAELLNSQRMKTLLDTV
EGIYDMVIIDVPPMLEVTDTQILSRHLDAIVLVVKQGQTQKLAVKRTVELLNLAHANLLGYVMNDISADGDAGYGYGYGY
GYGYGEETSK
>gnl|bykdb|A0A1C2G5N7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus reuteri] (length=249 residues).
MSIFHRKKSNANNDTMNNGAKLITVAHPKSPISEQFRTIRTNINFMAIDKPIKTLALTSANVSEGKSTVTDNVAVVWAQT
GQRVLLIDADLRRPTLHATFNKSNREGLTTILTSGDNSVDLRKIVQPSGVENLDILTSGPIPPNPAELLNSQRIKTLIES
VKSIYDMVIVDVPPLLEVTDTQVLSHFLDAIVLVVKQGQTQKLAVKRAVELLNLAHANLLGYVMNDVNTDGDAGYGYGYG
YGYGTDSAQ
>gnl|bykdb|A0A1C3F3H3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Desulfosporosinus sp. BG] (length=236 residues).
MAYSLITLEQSKSPISEAYRTLRTNVQFTSVDSETKKIMITSSGPREGKSSTVANLAVSMAQAGKSVLVVDADLRNPTQH
KLFGLDNGQGLSVALVQDQDYRQYIQETAVPGVMVITGGPIPPNPAELVGSKRMKRLIEEFSLQFDMVLIDTPPIIAVTD
AAIIAQEVDGVILVLAAGEVNKDFAQRAKEQLDKVGAKILGAVLNKVDMKTSEYYYYYYYHGSDDAKKKPKRQKGR
>gnl|bykdb|A0A1C3F3Q4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Desulfosporosinus sp. BG] (length=215 residues).
MLRTNIQFTSVDLETQKIMITSSGPREGKSHTVANLAVSMAQSGKSVLIIDADLRNPTQHKLFGLDNGEGLSVFLVQDQD
YCKYIRETAVPGVMVLPAGPVPPNPAELVGSKRMKLLIEEVSEQFDMLLIDTPPVIAVTDAAILAQEVDGVILVLASGEV
NKGYAQKAKEQLDKLGVKILGAVLNKVDMNTKEYYYYYYYNASDDTKKKHNRRSS
>gnl|bykdb|A0A1C3SIT1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus glycinifermentans] (length=227 residues).
MAIRKKRSRKYESALVALHQPNTPIVEQYRTIRTNIEFSSFEKPFRSLLITSGLPGEGKSFTAANLAVVFSQQEKKVLLI
DADLRKPSIHKIFQLDNHSGVTNVLMKKTHLENVVQQSQAESLHVLTSGPIPPNPAELLSSQAMEDLLAEAYKQYDLVLL
DSPPLLPVADAQILANQVDGSILIILSGKTKLDNAIKARDALNSSKSELLGAVLNGRKVKKARQYNY
>gnl|bykdb|A0A1C3SPA5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus macedonicus] (length=246 residues).
MPQLELVRAKAQMVKSMEEYYNSIRTNIQFSGRDLKVITLTSAQSGEGKSTTSVNLAISFARAGFRTLLIDADTRNSVMS
GTFKSKERYQGLTSFLSGNAELSDIICDTNIDNLMIIPAGQVPPNPTSLIQNDNFKAMIEIVRGLYDYVIIDTPPLGLVI
DAAILAHYSDASLLVVKAGADKRRTVTKLKEQLEQSGSVFLGVILNKYDIHLDKYGSYGSYGGYGSYGNYGKSEEKTKIG
RGKRKK
>gnl|bykdb|A0A1C3STD7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactococcus piscium] (length=231 residues).
MSKIQKDVDNNRAIITSVNPQSPISEQYRTIRTTVEFKMVDQGIKSFLVTSSEASAGKSTTVANLAVAFAQQGKKVLVID
GDLRKPTVDKTFKVQNRVGLTNVLMNQFSIQDVLQRTRISENLTVITSGPIPPNPSELLGSNAMRQLLDAVTVHFDVVLV
DTPPLSAVTDAQILTSYLGGVVIVVHANQTRKDGLLKTKKLLDQVNANILGVVLHGTEPNDSASYYYYGVD
>gnl|bykdb|A0A1C3TGJ0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus mycoides] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A1C3ZJY8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. nio-1130] (length=227 residues).
MIFKRKKREKRDLSCISVLNPHSVIAEQFRTIRTNIEFTSIQTRLKSILVTSSLPKEGKSFTAANLAAVFAQQKKRVLLM
DADLRKPAIHEYFDLSPHTGLTNVLLNNCSLEEAILPTPIEHLELLPSGTIPPNPAELLSSSVMKQLFYEIEQQYDMVIV
DSTPLLPVADAKILANRTDGSILVVLSGKTKIAAVKKSKEVLEGTTGKLLGAMLNGKKVKKGRHYMY
>gnl|bykdb|A0A1C4CYH0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus enclensis] (length=234 residues).
MANSKKLKKLMMNTKRKLITKSDPKSPISEQYKTIRTNINFSSVDRDLRSIMVTSSGPGEGKSTTAANLAVVFAQQGKSV
LLVDADMRKPTAHYTFNLTNTFGFTTVLTRQKTLREVVHPSDVDHLDLLTCGPVPPNPAELLSSRSMEEFLVDVYGDYDL
VIFDTPPVLAVTDAQVLANQCDGTVLVVSSGTTEIEGAQKAKDLLQATKGKLLGVVLNNREVKDTSYYYYYGKR
>gnl|bykdb|A0A1C4EK38 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. v-76] (length=235 residues).
MVRKKQGNDKALTAKRRLVAHTNPKLPIAEQYRTVRSNIQFSNLDEDIRSLVMTSSGPGEGKSTTAANLAIVYAQQGKRV
LLIDADLRKPTAHFSFRLENYVGFTNVLTRKAKLLDAVHETNIPNLSVLTSGPIPPNPSELLASKNMDALLDEMYETFDF
ILFDTPPTLAVTDAQVLANKVEATILVISSGKTEREAAQKAKELLLNAKARLLGVILNNRKIEDGGHYYYYYGTN
>gnl|bykdb|A0A1C4FH28 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLSHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSLYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A1C4GJG1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSLYDL
VVFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQSLYYYYGAN
>gnl|bykdb|A0A1C5KH19 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Clostridium sp] (length=239 residues).
MKKLNLGELRPLNFQGSESYKSLRTNIQFCGDDVKVIAFTSSIPNEGKSILVYRTSCSMAETGKKVLMIDTDIRKSVLVN
RLGIDKPGKGLSEYLSGQCSLDECLYETNVENLHMILTGPVAPNPSELLGSDRFKKLIAKARETYDYVLIDCPPLGSVID
AAIVASAADGAILVIESDVISRRFALNIKQQLERSGCRILGAVLNKVEMEGKGYYGHYYGKYYKKYYGKYYGDKEHEEK
>gnl|bykdb|A0A1C5L1Z6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Blautia sp] (length=234 residues).
MKKITLTDKRKNNYYYNEAIKTLRTNIQLSGQSIKTILITSCFPNEGKSDVVLSLAQELGSIGKKVLLLDADIRKTAYVG
RLGVEEEVRGLSQFLSGQANINDIIYETNFENMDIIFGGPSAPNPSGLLSENVFQVFLKKVREYYSYILIDTPPIGTVVD
AAVIGRYCDGAVFLIEPGNVRYKDAQRALSQLERSGCQILGAVMNKIDTKADKYYSFYYKHYGEYYRRAEEENK
>gnl|bykdb|A0A1C5LBT6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Ruminococcus sp] (length=473 residues).
MNQEHYKNQNVQSYDVKYISRCLMRNALFILMFACLAGVFSYIFLDHYKKDTYTASVNLYVIPRDNAGTKFNSNGISSAV
SRCVSALNSDMMKEQIKKEKNADKLKGKLSAYAAESTNIIVMSATSSSAESACRLLKAGIDNYPKLSGYFQTGYLLKKIG
SFEGNGITVNHADAPISALKVALLVLIAGCGLVGAMAVFTDKVHSVEQAQQLLDMDVFGALPFVKKKQEQKSILITDPRT
SSQYAEAVDKIVTKLRRKMHENHYKVLMVSSLKENDGKSTAAANLVLNLVQRGKKVVLVDCDMRRSAVCKLFDIDMKDQK
QLYDYLTEESTLQDVLIEYGQDERKFSCILQKKAVSEPEKWFDSERFEHMLKELSGSFDYVILDTAPIGIVRDAEIIAGY
ADSVFMVMKQDEVHAASVNDGIDILEDAGSVVVGGVLNMARGEKIAGNGYHKYKYGSYYYGYAYGKDGQHAGK
>gnl|bykdb|A0A1C5LBT8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Ruminococcus sp] (length=497 residues).
MQESDKVRAERVRTGQQYGAGQEGIDLFSMMDDALRCFQKYWLQFLLLIVIVTAVFIIYGNRQYVPQYQAKVTYAVNKTG
DSDTDASIAQRLSNSISVVTKTGDFKDRLFADVEEENVNPNYVISSAYTDNSNLFSVTVTANNYNNANMLLDLLENMYPE
WVAGSNGTMELQVVDRALAGENPVNGYSAMKQLVEGVLAGVILCLAIAALYAQLIRTVRKESDMKKITSKGCISLIPEIA
VKKREKSKKQQLLLSNKRVDWGFKQSVQAAQLRIEKQMEQEHKQVLLVSSTLPQEGKSMAAVNLALAFMQHEKKTVLIDG
DLRKPSVAEMLGMEEQKGLAEYLKGNAKVKEVLQKKGDLTVIQGGKVHGNISSLMDESRMEELMTFLKSEFDYVIIDTPP
AYLFSDAAILAGYADCVLYVVRHDMAEIPQIEKGMESFIQEDKLLGYLINRSQKGFASYGKYGYGKYGYGKYGYGKYGKY
QRYVDVKEDDMDTEDSL
>gnl|bykdb|A0A1C5LM35 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Ruminococcus sp] (length=234 residues).
MNKVQINNMPTLTYSTEEAINRLRVNLNFQAKDVKKIMVISSTENEGKSFVAFHTWKQMAESGVHTLLLDTDLRKSVMAE
KYQMEAENGKKLIGTSHVLSKDMPLKDAVWHTIMPQGDILPNVENLVNPAMLLESETFHRLLNEASEEYRYIFIDAPPLD
LVSDGEKIGSLCDGAILVVASGKVSRGMVQNSIHQLERAGCPLLGIVLNRVEDQRKKNYYQKYGYYASEKGKKK
>gnl|bykdb|A0A1C5N4W8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Clostridium sp] (length=245 residues).
MFNKKKNDVSRYDNVAKYNDGNYEINEAYRGIRTFLTVDENIKTILITSSEMNEGKTTTVANIARCFSELDNKKTIVIDC
DFRKQSINKYFRLSKNTKGLSDIIYENKELEICVQKDGDLDILCSGTFKANPAVLLQSSKMKKLIEYLKEKYDYILIDSP
PVGRVNDACIIAQYVDGTVVVAASKETEKSQVKVTKDRLEKVNANIIGVVLNKFKTNEYKSYSYYGYYDYEDDRKFRLFK
NKRRA
>gnl|bykdb|A0A1C5N6D6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Clostridium sp] (length=232 residues).
MQEIELKEIKKDYRSNEAYKSLRTNIEFSGEDNKVLVFTSCTPNEGKSTVTLALAQSLAEAGKKVLFIDADLRKSVLAGR
HKVHGQLKGLSHFLSGQTELGEVMYRVKDTNMVMIFAGVVPPNPAELLGGKRFESLLTSARKAYDYVIIDAPPLGSVIDA
AIIAKQSDASVLVISANTVSHKFAKVVKEQLEKSGCPILGVVLNKVDMAQNKYYGKYYGTYGDYGRVEEGKV
>gnl|bykdb|A0A1C5NDT5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Ruminococcus sp] (length=234 residues).
MKEVNIYRQELDYSANESYKSLRTNLLFCGEDKKVIAVTSCTPNEGKSTVSLNLALSLADSGKKVLFIDADLRKSVLMGR
TEVEGEEIKGLSHLLSHQETIENVICATNVPRFHIIYAGIVPPNPAELLGGKYFKRFLSAIRKVYDYVIIDTPPLGSVID
SAVIADECDGSIIVMESGVISYRFAQDVKGQLEKCNCPILGVILNKVDMSKQGYYGKYYGKYYGKYGDKKTEKK
>gnl|bykdb|A0A1C5PCP8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Blautia sp] (length=227 residues).
MQAKIVLPNEELEYGAAEAIKTLRTNIMYSEDVKAIMLTSTMPSEGKSTVSLELARSFAALGKNTVLMDCDMRKSYLVRR
LGIQEKIQGVSEYLSKQSMKIVYRTSDPNLSIIFSGSYPPNPSELLSGIRFESLMETLRDAYDYIIVDAPPMGDLVDGAI
ISRQVDGTLLVVRNDFVKTKAVKKVKQQIEQNGGRVLGVALNRIKKNQKGAYPYGKKYYSYEYKKEK
>gnl|bykdb|A0A1C5QYH5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Coprococcus sp] (length=237 residues).
MKKVNLSIEKKSYGVREAIRTLRTNLQFCGDDKRVILVTSCVPREGKSSVSVALAESIADMGKSVILVDADIRNSVMASK
LQITGADKGLSHFLSGQCVLADVIMATNIPKFHILLSGPEAPNPTELLESKRFTGMLESMKNVYDYIIIDCPPLGLVIDA
AIIGHQSDGAIIVVEAGKTKYRLVQNVKDQLDNSGVSVLGVVLNKVERKNQKGYYNKYYGSQKYEGYYGHNEETKNA
>gnl|bykdb|A0A1C5T1I1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Clostridium sp] (length=247 residues).
MGQTLSLKNTGRKDYHYEEAVKTLRTNIQFCGNNLKTIMFTSSLPSEGKSDTTFAVAASFGSIGKKVLLIDGDIRKSVIV
KRHEIQGNPCGLSQYLSGQKTAEEICYGTDVENLDIILAGPYSPNPSELLEDPLFKELLDRARLKYDYIIIDTPPMANLI
DGAIIASLCDGAVIVINSGTISYHLVQKVKSQLEKSGCRILGAVLNRVGTDYDNGYYKKYYGKYYGRYYGKTYGGGGEKY
QILDEAR
>gnl|bykdb|A0A1C5TAU5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Coprococcus sp] (length=239 residues).
MKKINIDFKEMPYAVEEAMNRLRINIKFCGKNTKKLLITSSLPNEGKSTISMNLWKMMAEAGFPTVFLDVDLRKSVIKSR
HNIQTEGEIKDLGYYLSGQAEYEDVVYETNIPNGYIVPCCNLLENPSALLEDDRFAELLNKLAEQYRYVIIDSPPLGSVA
DAAQVASLCDGAVLVVRSGETSRNVIKQSMQQLEQVRCKLLGVILNRVEVSGRAYKSYYGKYKSYGYGYGYGKDQKSGK
>gnl|bykdb|A0A1C5TSA7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Blautia sp] (length=234 residues).
MKKITLTDKRKSNYYYNEAIKTLRTNIQLSGQSIKTILVTSCYPNEGKSDVILSLAQELGSIGKKVLLLDADIRKTAYVG
RLGVEEEVKGLSEFLSGQANVNDIIYETNFPNMDIIFGGPTAPNPSGLLSENVFQVFLKKVREYYSYILIDTPPIGTVID
AAVIGRCCDGAIFLIESGSVRYKDAQKAMSQLERSGCQILGAVMNKIDSKSDKYYSSYYKHYGEYYRKADEENK
>gnl|bykdb|A0A1C5TVM6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Blautia sp] (length=229 residues).
MVKVKISDWKADTSMDEAYKALRTNIQFCGADKKVIAFTSCTPNEGKSNVTFHLAASLAESGKSVLLIDADLRKSVLMGR
VHVEEEVMGLTHYLSKQAKLSDVICATNLPKFHIIFSGVVPPNPAELLGSRLFKDMIRLVRDVYDYIIVDTPPLGRVIDC
AVVADSCDGTVIVIESGSISYHFVQDIKGQLEKTNCPIIGAILNKVDTKEYGKYGKYGKYGKYGEYGKY
>gnl|bykdb|A0A1C5U0M6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Clostridium sp] (length=236 residues).
MASDRKVVMIDPKKADSLYEEAIKTLRTNLQFTGRGIQVILATSCYPNEGKSDIAFQLAREIGNMGKKVLFLDADIRKSM
LVSRYKVKQKGITGLSHYLCGQTDPEYLCYESNFPNLDIIFAGRSVPNPSELLEDEAMGNLIQSLRSRYDFIILDAPPVL
SVSDALIAAKWCDGVLLVVESKKVSYKALQRVKKQLEQTGCRILGAVLNKVDMQQDTYYSKYYGHYGYYNGYGNTK
>gnl|bykdb|A0A1C5U2R6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Blautia sp] (length=246 residues).
MKQLTITLPELPYAVEEAMNRLRINIKFCGKNTRKILLTSCLPNEGKSTVSSYLWKMLAEAGFPTVLVDADLRKSVMRKR
LQIEYKEDVRGLNHYLSGMAEYDEVVYQTNVANGYLVPCTQLLESPSALLEDSRFRDLLNTLAENYRFVIIDTPPLGSVS
DSALIASMCDGAVLVIRAGVTPKGMIKQSLFELEQVNCKLLGTVLNRAEVHSRAYGKYYSKYYGKYGKKYGYGYGYGKEE
KPDAGK
>gnl|bykdb|A0A1C5UTJ0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Blautia sp] (length=234 residues).
MKKITLTDKRKSNYYYNEAIKTLRTNIQLSGQSIKTILVTSCYPNEGKSDVILSLAQELGSIGKKVLLLDADIRKTAYVG
RLGVEEEVKGLSEFLSGQANVNDIIYETNFPNMDIIFGGPTAPNPSGLLSENVFQVFLKKVREYYSYILIDTPPIGTVID
AAVIGRCCDGAIFLIEPGSVRYKDAQKAMSQLERSGCQILGAVMNKIDSKSDKYYSSYYKHYGEYYRKADEENK
>gnl|bykdb|A0A1C5W7L9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Ruminococcus sp] (length=240 residues).
MAEQKVIMTDPRQEDYFYQEAIKTLRTNIQFAGMDVKTILFTSCYPNEGKSDITFQLSQEIGKLGKKVLLLDADIRKSIL
ASRYGVGKQVQGLSNYLSGQASIAEIIYRTNYENMDIIFSGSFAPNPSELLGQEAFGTLLGAVREHYDYIIVDTPPIGSI
IDAAIVAKQCDGAVLVFESELVSSKEAARVKEQLLMTGCRLIGAVLNKVDVKKNKYYHRYDYYYHGYQEKKEVTKKNKEK
>gnl|bykdb|A0A1C5WD38 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Ruminococcus sp] (length=250 residues).
MEQARRSQRSDARQQTRVRPSVTMVDQRKENYHYEEALKTLRTNIQFAGAEITSILVTSCYPNEGKSDIVSQLAKEMGKA
GKKVLLLDADIRKSTFIQRFQIEGEIKGLSQYLSGQVAVRDILYTTNYENVDMIFAGPVAPNPSELLEGKLFAHLVEGLS
QRYDYILIDTPPMASVIDAAIVGGVCDGAILVIEDGAVGYRTAQKVKAQLEKSGSRVLGAVLNKVEMKKGKYYSYDKYGK
YSKYGRYGKY
>gnl|bykdb|A0A1C5WZV1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Blautia sp] (length=232 residues).
MVKVKISDWKADSSMDEAYKALRTNIQFCGADKKVIAFTSCTPNEGKSNVTFHLAASLAESGKSVLLIDADLRKSVLMGR
VQVEEEVKGLTHYLSKQAKLQDVICATNLPKFHIIFSGVVPPNPAELLGSRQFKDMIRVVRDVYDYIIIDTPPLGRVIDC
AVVADSCDGTVIVIESGSISYHFVQEIKGQLEKTNCPIIGAILNKVDTKEYGKYGKYGKYGKYGKYGEYGKY
>gnl|bykdb|A0A1C5X1G3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Clostridium sp] (length=287 residues).
MQNVKLQFEKKNNDYRIREAFKTLRSNIEFCGGDVKVIAVTSCTPNEGKSSVAMEMARAFAEAGSKTMLIDADMRKSVLV
GRYKTGAVRKGLTHCLIGKANYLEVMCETNVPNLYVTFSGPVPPNPSELLGGEKFRSILNVLRSSFDYVIVDTPPLGSVI
DAAVAAKSCDGTVLVIESNAISYRFAQKVKEQLDKTGSRILGVVLNKVDMNGKGYYGHYGKYYGKYYGKYYGNYGSETAS
RQEKSSLENEVRQFRDDMVEDPEKGRAAQKISEAGKDPEDIEFIEDI
>gnl|bykdb|A0A1C5XEE7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Clostridium sp] (length=224 residues).
MSKNKNTYKFDNMEAFRKLKTNIEFSAVEKPIKVVNITSSCANEGKSTVAFHLAQVYAAKYKKVLVIDCDLRRPKMHRYF
QISNQVGLSDLLVFIDKQPDLSTYIQEVTVTDCENAISVLTSGSKVPNPQELLGSSKFKKLLQALSKQYDFIILDCPPIS
MISDTFYVSNVSDGTIFVISMKDTKKDIALSSIRQLERSRSKILGIVLTKTQNLSSYDYYYTYE
>gnl|bykdb|A0A1C5XQS7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Clostridium sp] (length=272 residues).
MQNVIIRSIERLDFRTKEAYKTLRTNLSFAGKNVKVISLTSCTPNEGKTSVSFQLCLSLAESGKKTILVDADLRKSVLRG
RYKANREKYGLSHYLSGQMELDDVCCRTNVNNFDIIFAGPVPPNPSELLGGDAFKNMLEVLRMQYDYVIVDTPPLGSVID
GAVAGAICDGTVLVVESGAISYKFAQNVKEQLDKVGCRILGCVLNKVNTKKNSYYGKYYGHYYGNYYGHGQDGADEAQGE
LPLDAGSKTDATAAETETAVSEQNTGEKEDAK
>gnl|bykdb|A0A1C5XR76 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Blautia sp] (length=241 residues).
MIKVKLSNWKSDHQMDEAYKALRTNIQFCGADKKVIALTSCTPNEGKSSVAFNLAASLAESGKSVLLIDADLRKSVLMGR
VTVDQEVMGLAHYLSKQAKLSDVICATTLPKFHIIFSGIVPPNPAELLGNRLFKDMIRVVRDVYDYVIVDTPPLGLIIDS
AIIADSCDGSVIVVESGTISYRFVQEVRDQLAKSNCPILGTILNKVDYSKAGNYGHYGKYGKYGKYGKYGSYGDYGESSS
K
>gnl|bykdb|A0A1C5YMF0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Blautia sp] (length=235 residues).
MENVEIKVQEMDYSGTEAYKSLRTNLQFCGEDKKVIAVTSCTPNEGKSSVTMNLAVSMAEAGKKVILIDADMRKSVLVGR
TKVRSSVKGLTHYLSKQAPLIDVICSTNVKNLSIIFAGPVPPNPAELLGSRHFKAMLDSLKKVYDYILIDTPPLGSVIDS
AIIAEECDGAMIVIESGVISYRFAQDVKQQLEKSNCPILGVVLNKVDMSRQGYYGKYYGKYYGKYGKYGKYGHED
>gnl|bykdb|A0A1C5YQC9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Clostridium sp] (length=237 residues).
MQLHIHRNPKSHISEAYRLLRTNIEFSNIDKNLKTILITSSGQNEGKSTAISNIAASFASLENKKVLLIDCDLRNPTVHK
MFGVSNINGITDVLTGQKDVEKCIENTKVSNLDILKVGKIPPNPSEMLQSKRMKSFMEAIKPHYDYIFIDAPPVGIVTDA
SILAQYVDGTILLVAANEADIEATKIAKERLESVNANILGAVLNKFEADEKSYGYYNYYYGSSSEKRKPKRGLFGRK
>gnl|bykdb|A0A1C5YXK3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Clostridium sp] (length=249 residues).
MKQIITLNRDMKDDYHYNEAIKTLRTNIQFCGNGIRTIMLTSSLPDEGKSDITFAMAASLAQIGKKVVMIDADIRKSVLV
SRYQLETEVYGLSQYLSGQKTLADVLYDTNVENLSMVFAGPYSPNPAELLEEDLFEQMVQELKKTYDYVIIDTPPMANLI
DGAIVARQCDGAVMVVESGCISYRLEQRVKGQLEKSGCRILGVVLNKVSMERNGYYSKYYSRYGKYGKYSKYGKYGKYGK
YEKYEKAEA
>gnl|bykdb|A0A1C5YYN9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Ruminococcus sp] (length=255 residues).
MNQLNVNLPELPYAVSEAMNRLRINIKFCGKNTRKILLTSCQPNEGKSTISSYLWKMLAEAGFPTVLVDVDLRKSVMKTR
FQMDYDDDTTMGLNHYLSGMAEYEDVIYSTNIPNGYMVPCTQLLENPSALLEDVRFKELLNTLSENYRFVIIDSPPLGSV
SDGALIASLCDGAVLVVRAGTTPRTLIKQSLYEIQQSGCKLLGTVLNRADVKGRAYGKYGYGKYGYGYGYGYGYEPKDKK
NSSDSAAADKNSTGK
>gnl|bykdb|A0A1C6AJD6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Clostridium sp] (length=239 residues).
MAKRGAYDEGNFELNESYREIRTYVTINKNIKTILVTSAEMDEGKTTIICNLAKCFSELEGVRVLLIDCDFRKRGVSRYF
GIENSFGVSDIVFGNNKKSECIKKVGDLDIITSGGVPSNTSILLNSQSMKDLVSKLREEYDYVFIDSPPICRLNDACIIT
QYVDGTIIVNAAKAIDSKGAKITLDKLNKVGANIIGVVLNKFKAEKYSYYSNYYGYSNYYGEHKHKLFGRKKKRRRKTS
>gnl|bykdb|A0A1C6ASN0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Clostridium sp] (length=249 residues).
MQIDKSNFENNKVQKVSIREGTSLDYRTNEAYKSLRTNIQFCGDDIKTIAVTSCMPNEGKSSVAFNLAISLAESGKKVIL
LDCDLRKSVLVGRYKISKGVKGMTHYLTGMHTIDQVICSTDVENLFVVFSGPVPPNPAELLGNRYFSALMKQLPEFYDYV
IIDTPPLGSVIDSAIVAQQCDGAVMVIAANQISYKFAQKTKEQLEKSNCKILGVVLNKVDIRENGYYGKYYGKYYGKYYG
KYYGNYGSD
>gnl|bykdb|A0A1C6AUG1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Clostridium sp] (length=234 residues).
MDNSYQIYFNSPELREAIKTLRVNIEFAGIDEPVRSVAVTSVEAGVGKSTIALSLAIAMAETGKTTLIIDNDFRNPQIAN
RLMVRGVYSLTELFSGKVDPREACVPTKVNNLFMLDLGSRRLNNPIEVLSSGRYKALLAKVKQDFDFVVIDTPPLGLFID
AAIASTQVDGVLMVISSGKSTAAEVKESLAQLEKANAHVIGCVLNNLKHKPADYYGYYYDKRGDKKRKKIRRKQ
>gnl|bykdb|A0A1C6AXF3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Clostridium sp] (length=238 residues).
MANVLAFKEPKSPIAEAYRTIRTNIQFSKIDKDIKTILVTSSKQNEGKSTVSANLAVSFAALEDKKVLIIDGDLRNPSVH
KHFNISNAHGLTDIITGQKTLQQTIQITGIDNLQILTTGKMPPNPAEMLESKKMKEFVDRLKEYYDYIFIDSPPIGIITD
AGVIANYADATILVVGSKDVEAEVAKISKERLEKVKANVIGVVLNKYIGEGSSYGHYNYYYEQSDGSRSSKHKNKKRK
>gnl|bykdb|A0A1C6CX13 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Clostridium sp] (length=247 residues).
METIDKLDAKSPIVEAYRSVRTSIEYSNLDAKLKIILVTSTQQNEGKSTVASNLAISFSKLPNKKILLIDADLRNPSIHR
VFSIGNSDGMMSILKGDKDLKSTVYNLNENLDILTTGVIPPNPDEILVTDKMKEFIQQIKEKYDYIFIDSPPIGIVSDAS
LLSQLSDGVIFVISSGEVETDFAKLAKEKLMNVDAKILGAVLNKYESHNDDYGYYYSEYYGARKKRKLFRLGKFKRKTKK
HLKVEKA
>gnl|bykdb|A0A1C6D7M5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Ruminococcus sp] (length=254 residues).
MAKTKKHQLAVTDKKTLHQNLSFVAKEQYKMLRTNLNFVLPDDLKCPIIGVTSSVRGEGKSTIAINLAYALAEDGKTVLL
IDGDLRLPSIAKKLGYKNQPGLTDFLQGGDTKVYKTNIHENWYVMMSGNIPPNPSELLGSAKMEKMLHMMADRFDYIIID
LPPVNVVTDALAISKLISGMILVVREEYVEKRELDNCVRQLKLSNVNVLGCVMNNAKDEKAAYGKYSKYGKYKTYYYQQP
ESEELPGAETVTES
>gnl|bykdb|A0A1C6EBS6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Clostridium sp] (length=240 residues).
MKKAKIEIRQMAYATREALKTLRTNVQFCGDDKRVILVTSCVPGEGKTRSAIELAYTFAELNKPVLLIDADMRKSVMVSR
LQIQGVEQGLSHFLSGQCSLADIVIETNVPKMHVMLAGPLVPNPTELLSTKRFRSMIESLRKVYEYIIIDSPPLGMVIDA
AIIAKNCDGAIMVVESAKTKYRLAQNVKEKLENAGCTVMGVVLNKVDRKKQGGYYNKYYGASYGKKGYGEYYRYEPEEKE
>gnl|bykdb|A0A1C6EGN1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Clostridium sp] (length=272 residues).
MQNVIIRSIERLDFRTKEAYKTLRTNLSFAGKNVKVISLTSCTPNEGKTSVSFQLCLSLAESGKKTILVDADLRKSVLRG
RYKANREKYGLSHYLSGQMELDDVCCRTNVNNFDIIFAGPVPPNPSELLGGDAFKNMLEVLRMQYDYVIVDTPPLGSVID
GAVAGAICDGTVLVVESGAISYKFAQNVKEQLDKVGCRILGCVLNKVNTNKNPYYGKYYGHYYGNYYGHGQDGADEAQGE
LPLDAGSKTDATAAETETAVPEQNTGEKEDAK
>gnl|bykdb|A0A1C6ERZ2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Eubacterium sp] (length=235 residues).
MKKVTMNLPEIKDYRLTEGLNQLKTNLAFCGKDIKVITMTSSVPNEGKSSVSFDLSKTMAEGGKKILMVDADLRKSVLAA
KYHIQGIDKGLSHYLTGQAEIEDIIYETETEGFYLTVAGPLSPDPTSILDSEQFQKFIDKVRDDYDYVIIDAPPLGVVID
AVIIGKYCDGAVLVIEQGVIKRKVVQDVIKQLKRGGVRILGAVLNKVDERIGAYGSYDYKYSYSYYGHSDAEDKH
>gnl|bykdb|A0A1C6ESQ2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Ruminococcus sp] (length=229 residues).
MKRVTLKKREMSYAMTEELNTLRTNIQFSGVDKKVIVMTSSFSGEGKSTITYQLAKSLAELGKRVLLIDADMRKSVMVNM
LESGSVDKGLSHYLSGQCSLSEAVYATESSRLHILFAGPVPPNPTELLSGELFKDTLNSFRDIYDYIFIDCAPVGMVIDA
AIVAKCSDAAIMMIESGAVKRKLALEAKEKLETAGCPILGVVLNKVERKSGGYYRKYYKKYEEAAKVEG
>gnl|bykdb|A0A1C6EVI4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Eubacterium sp] (length=471 residues).
MSKDYAEHRENRENLIDIAGLFDNLVKVAFQLKFKFLITIIVCGVIFCGYKRFTYSPYYIASSTFTISSSISSENSNTYI
ENATANQMAKSFPYILQSGAFKQVLAEDLGMQSVPGTIEAEVMENTNLFTLKVTESNPELAQKVLESVVKNYPSVAEFVI
GSSQLTLMDESGVPTAPANPFSYKHEIEIGAVIGILLCMFLDVLLAFGKNTVKKEEDFKRLFHVDSLGILPHAKFHKKRT
QVEELVVLDNPRLPRSFLEASRTVRRRIERAQKETGMKSFLVTSAMPGEGKSTVSANIAISLAMKGYKVILVDADLRNPS
TAKVLGMQEQELGTLQVLKGEVKIEDAVQPYKDTSVMVLAGSTPIQDTSTVLSGENMRQFIKELEAEADFVVIDTPPSAL
LSDAAIVAQYVDGAVFVIRQDYTEADRILEGMEILSGSGAQITGCILNDANVKANSSEHYKNSYRSKSEVV
>gnl|bykdb|A0A1C6FL55 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Clostridium sp] (length=231 residues).
MFITKKMPKSLSAEAYRSLRTSIKFSSVDRPIKTLVVTSSIMGEGKSTVAGNIANILSQDGARVLMIDCDLRKPSMHYNF
FVTNGEGLTDLLVGNSDLKSVMKKVDDSLFLITAGTVPPNPSEILGSHGMEKLLEELSVNFDYIVLDTPPVLPVTDALLL
SAKADGTLIVVKSRVTKEKMVKETYDKLIDVRANVIGTVLNGCDKSIDNKYYGYYGDFKKHKEKKFKIKRK
>gnl|bykdb|A0A1C6FMD7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Clostridium sp] (length=221 residues).
MFIAQMMPRSISAEAYRSIRTSIQYSSIDKKIKTLVVTSSLASEGKSTISGNLAYVLSENNNKVLLIDCDLRKPSLHKKF
KVSNEKGITDLLVNKCTINEVIKVMSKGVHLITAGTIPPNPAEIVGSKALKDFIDNMEEDYDYIVIDTPPVLAVTDAQLL
AAKCDGTVLVSRAKKSRTKYVKLAYNELEKVRANVIGSILNDSDMKQKYGYYKHYSSDLKK
>gnl|bykdb|A0A1C6FQQ1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Eubacterium sp] (length=245 residues).
MKKLNLKIKDMPYAAEEALNRLRVNIKFCGKNTKKIVITSSVPNEGKSTVSVRLWKLLSEAGFPTVLVDVDLRKSEIQKK
YQVEGIKEGLNHFLSGLAEYEDVVYETNIPNGHIVPVTTLLENPSALLEDPRLGELLDRLAEDYRYVIIDTPPLDNISDG
ALIASMSDGAVLVVRCGETSKALVRQSLQQLDRVGCPVLGTVLNRAEIRSGAYKKYYNRYGKKYGDYYGAYYGGNTTEKK
AGIKE
>gnl|bykdb|A0A1C6FUT4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Clostridium sp] (length=217 residues).
MFVVEKKPKSIAAEAYRTLRTNIQYSSFDKEYRTIVVTSSEPGEGKTITSGNLALALAQGESKVLLVDCDMRKPSVHKHF
RISNENGLTDLLLHKKTMEQVMVKYNENLTIVAAGRVSPNPSEMLGSRAMGTFLEEMKEHFDYVVMDTPPLGAVTDAQVL
STKVDGTILVVKAGSTKKDVVMNSVNLIKKVNGNLIGTVLNGVEQSKNKYYYYYGNE
>gnl|bykdb|A0A1C6GIN3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Blautia sp] (length=257 residues).
MNQLNVNLPELPYAVSEAMNRLRINIKFCGKNTRKILLTSCQPNEGKSTISSYLWKMLAEAGFPTVLVDVDLRKSVMKTR
FQMDYDDDTTMGLNHYLSGMAEYEDVVYSTNIPNGYMVPCTQLLENPSALLEDVRFKELLNTLSENYRFVIIDSPPLGSV
ADGALIASLCDGAVLVVRAGTTPRTLIKQSLYEIQQSGCKLLGTVLNRADVKGRAYGKYGYGKYGYGYGYGYGYGYEPKD
KKNSSDSAATDKNSTGN
>gnl|bykdb|A0A1C6GLW2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Ruminococcus sp] (length=232 residues).
MVKVKISDWKADSSMDEAYKALRTNIQFCGADKKVIAFTSCTPNEGKSNVTFHLAASLAESGKSVLLIDADLRKSVLMGR
VQVEEEVKGLTHYLSKQAKLQDVICATNLPKFHIIFSGVVPPNPAELLGSRQFKDMIRVVRDVYDYIIIDTPPLGRVIDC
AVVADSCDGTVIVIESGSISYHFVQEIKGQLEKTNCPIIGAILNKVDTKEYGKYGKYGKYGKYGKYGEYGKY
>gnl|bykdb|A0A1C6H3C6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Ruminococcus sp] (length=240 residues).
MASDFKLFKKKDDKKNNGQNFSLSDKSKFAIVESYKAARTNIMFSLSAKEKKCFAVTSYSKGEGKSTVSANLAISFSKME
KRVLLIDCDLRRPNVHNFFKLDNKKGLTNVIGKMIEIDEAVKHDVLPNLDILPAGTVAPNPSELMCSTRFQELYEQFVRD
YDYVIFDTPPIGVVADALLLKDMIAGFVVVVRERSTTHGDLQHLLDSVKLADSTVLGLIEVGCTYDSKRRKKGYYYYQYY
>gnl|bykdb|A0A1C6HN44 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Eubacterium sp] (length=245 residues).
MKKLNLKIKDMPYAAEEALNRLRVNIKFCGKNTKKIVITSSVPNEGKSTVSVRLWKLLSEAGFPTVLVDVDLRKSELQKK
YEVEGIEEGLNHFLSGLAEYEDVVYETNIPNGHIVPVTTLLENPSALLEDPRLGELLDRLAEDYRYVIIDTPPLDNISDG
ALIASMSDGAVLVVRCGETSKALVRQSLQQLDRVGCPVLGTVLNRAEIRSGAYKKYYNRYGKKYGDYYGAYYGGNTTEKK
TGTKE
>gnl|bykdb|A0A1C6HQH6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Clostridium sp] (length=239 residues).
MGKEISLMRDQKEDYQYEEAIKTLRTNIQFSGTNLQVIMLTSAVPNEGKSEISFSLASSLAQIDNRVLLIDADVRKSVLV
TRYKLDRKIEGLSQYLSGQKKLEEVIYTTNIPNLDVIFSGPLSPNPAELLEEPLFKKLIDHAREEYAYVIIDTPPMSTII
DGAIVAGHCDGAIMVVESGGVSYRVLQKVKRQLERSGCRILGTVLNRVNMQVQGYYRYYGKYGRYHYVYGYGYGRENKK
>gnl|bykdb|A0A1C6HS70 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Clostridium sp] (length=233 residues).
MDNEVFLKRTAIEDYQYNEAMKTLRTNIQFSGTGIQVVMLTSSVPGEGKSETTFHLAASLAQLDKKVLLIDADIRKSILV
TRYQLDRRVDGLSQYLSGQKKLEEVVYKTNLPNLTMIFSGPYSPNPAELLAEPLFDKLVAWARENFDYVIIDTPPMGNLI
DGAIISRNCDGAILVIESGNISHRLLQKVKGQLEKSGCRILGAVLNKVDVRQNSYYYYGKYGKYYGKEYSSEH
>gnl|bykdb|A0A1C6HTM1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Clostridium sp] (length=259 residues).
MHDEIVIEDLISPDERGMGELVLKGFEVNDYQYEEAMKTLRTNIQFSGSNIHAVMFTSSAPNEGKSETTFQLAASMVQLG
KKVLLIDADIRKSVLVSRYHLEHQVDGLSQYLSGQCKKEEVVYRTNIPNLNIIFSGPFSPNPAELLEGELFTKLIAWARE
CYDYILIDSPPMGSVIDGAVISRHCDGAILVIESGAISYRLLQKVKNQLEKSGCRILGTVLNKVDIKQGSYYYYGKYGKY
YGYGHENAKQGKEVKTASV
>gnl|bykdb|A0A1C6I684 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Eubacterium sp] (length=243 residues).
MLNINIDKLKKLDNSSNEAYKRLRTNVQFCGSDVKVIALTSTIPNEGKSSVSFNLAASIAESGKKVIFIDADLRKSVLVG
RYKINKAVKGFTHYLSGVNAFDEVVYSTNVENLHVVFSGPVPPNPAELLGNKYFKTLIKQLRQTYDYVIIDTPPIGSVID
AAIIAQECDGVVMVVAAGEISYKLVQKTKAQLEKADCKILGVVLNKVPTGKGGYYGKYYGHYGHYGEYGNYGNYGNYGQS
AKK
>gnl|bykdb|A0A1C6IDE5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Flavonifractor sp] (length=493 residues).
MDEQKTKQHTEAPEPIDLTALLGELWRIFTRMFWVPLVLAVLAGGLLGLRSWRSYTPMYRSEATFTVQLLSNQYDITGVD
SYYDKAAAEQLANTFPYLLSSDLMQQLLQRELGVGWLNGSITAQSVANTNLFSVQVTSTSAQDACDILNGVIAVYPQVAN
YVVGSTELTVLVPPAVASQPYNAFQPTRTIIKGAVLGFGVGVVFLLVLAMASKTIRTREDMKKWMNVPCLGTLPTVSFKR
RTGKTGGTVTILNDRTGSAFQESIRSLRIRFLREAERQESKVFLVSSTVPGEGKTTVAVNLALTLGQNGARVILVDMDLR
KPSVKKALGLTAPSKGVPELLRSGEESPKAALMELEGTRVRVLAGDKAVENPRRQLESRKLSGLIKALREEADYVVIDTP
PNGLLGDSTALAGLADGILYVVRAGKAQVPHIMDSIQLLSSSRTPLMGCVLNGVKENGGGYGYGYGYGYGGYRGYERHSR
KSGRDGQLEEERK
>gnl|bykdb|A0A1C6IHE6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Clostridium sp] (length=480 residues).
MEEHKLDQEEGRIDLYRLLPELGRALRRLFWVPLLLALLGAAAMGVRAWRSYVPLYHSEATFTIETSASALSDMAGSGSY
YDKATAEQLAKTFPYLLQSDLLQSLLRQELGVSWLNGSISARAVDNTSLFSLRVTSTSAQDAYDILETVIRIYPRVADYV
VGSTEMHILTQPAVAAQPDAPFDPVRSICKGALLGLALGLAVVLLFAATRRTVRTPEEVKRRLNQTCLASLPAVRFKRRS
GQFDRTISIQNPRISGAFLENVRSLRIKFLRAAEGRKVIMVSSTLPGEGKTTVAVNLALTLSQNGARVILVDLDLRKPSV
KRCLGVSVPSRGAPELLNLRGADPREHLLTLEGTQVRLLAGDEPSSNPRRQMESRRLEALLTTLREEADYVILDTPPCGL
LGDGAALAGLADASLYVVRSGTAQVSHILDSLQFLAGSGTPLMGCVLNGASGGGGRYGYGYGYGYGGDHYGKYHAYRQEK
>gnl|bykdb|A0A1C6JJM7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Ruminococcus sp] (length=473 residues).
MNQEHYKNQNVQSYDVKYISRCLMRNALFILMFACLAGVFSYIFLDHYKKDTYTASVNLYVIPRDNAGTKFNSNGISSAV
SRCVSALNSDMMKEQIKKEKDADKLKGNLSAYAAGSTNIIVMSATSSSAESACRLLKAGIDNYPKLSGYFQTGYLLKKIG
SFEGNGITVNHADAPISALKVALLVLIAGCGLVGAMAVFTDKVHSVEQAQKLLDMDVFGALPFVKKKQEQKSILITDPRT
SSQYAEAVDKIVTKLRRKMHENHYKVLMVSSLKENDGKSTAAANLVLNLVQRGKKVVLVDCDMRRSAVCKIFDIDMKDQK
QLYDYLTEESTLQDVLIEYGQDERKFFCILQKKAVSEPEKWFDSERFEHMLKELSGSFDYVILDTAPIGIVRDAEIIAGY
ADSVFMVMKQDEVHAASVNDVIDILEDAGSVVVGGVLNMARGEKIAGNGYHKYKYGSYYYGYAYGKDGQHAGK
>gnl|bykdb|A0A1C6JJP6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Ruminococcus sp] (length=492 residues).
MQESDKVRAERVRTGQQYGAGQEGIDLFNMMDDALRCFQKYWLQFLLLIVIVTAVFIIYGNRQYVPQYQAKVTYAVNKTG
DSDTDASIAQRLSNSISVVTKTGDFKDRLFADVEEENVNPNYVISSAYTDNSNLFSVTVTANNYNNANMLLDLLENMYPE
WVAGSNGTIELQVVDRVLAGENPVNGYSAIKQLVEGVLAGVILCLAIAALYAQLIRTVRKESDMKKITSKGCISLIPEIA
VKKREKSKKQQLLLTNKRVDWGFKQSVQAAQLRIEKQMEQEHKQVLLVSSTLPQEGKSMTAVNLALAFMQHEKKTVLIDG
DLRKPSVAEMLGMEEQKGLAEYLKGNAKVKEVLQKKGDLTVIQGGKVHGNISSLMDESRMEELMTFLKSEFDYVIIDTPP
AYLFSDAAILAGYADRVLYVVRHDMAEIPQIEKGMESFIQEDKLLGYLINRSQKGFASYGKYGYGKYGYGKYGKYQRYVD
VKEDDMDTEDSL
>gnl|bykdb|A0A1C6K495 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Clostridium sp] (length=215 residues).
MFVVEKNPKSVAAEAYRTLNTNIHYSSVDKKYKSIAVTSANPREGKSTTASNLALTLAEGEEKVLLIDCDMRKPSIHKNF
KVTNNYGISEILVQNKKVMDIANKYNNNLHIITIGKIPPNTFEMLASKTMTLFLEEMKEHFDYVILDTPPFQAVADPQIL
YTKVDGTLVLVRSGKTKKDDVNNSISLLKKVNADIIGTVLHAVDKSNNKYYYYYG
>gnl|bykdb|A0A1C6K4K9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Clostridium sp] (length=217 residues).
MFIVEKSPKSVAAEAYRSLKTNIQYSSFDKEYKTIVITSSNPGEGKSTTAGNLALTLAEGEAKVLLVDCDMRKPSMHKNF
RITNTYGISNILLQKQKVMDVAHCYNKNLSIITAGKVPPNPAEMLASKAMTAFLKEMKEHFDYIVLDTPPVQAVADAQIL
STKVDCTLVVVRAGVTKKDEVQNTVNTLKKVNADIIGTILHAVDNTRNKYQYYYGNE
>gnl|bykdb|A0A1C6K796 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Clostridium sp] (length=217 residues).
MFIVEKSPKSVAAEAYRALKTNIQYSSFDKEYKTIVITSSNPGEGKSTTAGNLALTLAEGEAKVLLVDCDMRKPSVHKNF
RITNTYGISDILLQKKKVTEVAYSYNKNLSIITAGKVPPNPSEMLASKAMTAFLKEMKDHFDYIVLDTPPVQAVADAQIL
STKTDGTLVVVRAGVTKKDEVKNTINTLNKINANIIGTILHAVDNTRNKYQYYYENE
>gnl|bykdb|A0A1C6K9V6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Clostridium sp] (length=229 residues).
MFITKKMPKSLSAEAYRSLRTSIKFSSVDRPIKTLVVTSSIMGEGKSTVAGNLANILSQDGARVLIIDCDLRKPSVHYNF
FVTNGEGLTDVLVGNSDLKSVIKKVDDSLFLITAGTVPPNPSEILGSHGMENLLEDLAVNFDYIILDTPPVLPVTDALLL
SAKADGTLIVVKSRVTKEKMVKETYDKLIDVRANVIGTVLNACDKSIDNKYYGYYGDFKKSKNKKFKIK
>gnl|bykdb|A0A1C6KRD9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Blautia sp] (length=255 residues).
MNQLNVNLPELPYAVSEAMNRLRINIKFCGKNTRKILLTSCQPNEGKSTISSYLWKMLAEAGFPTVLVDVDLRKSVMKTR
FQMDYDDDTTMGLNHYLSGMAEYEDVIYSTNIPNGYMVPCTQLLENPSALLEDVRFKELLNTLSENYRFVIIDSPPLGSV
SDGALIASLCDGAVLVVRAGTTPRTLIKQSLYEIQQSGCKLLGTVLNRADVKGRAYGKYGYGKYGYGYGYGYGYEPKDKK
NSSDSAAADKNSTGK
>gnl|bykdb|A0A1C6KSE6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Eubacterium sp] (length=233 residues).
MSLKKTAKFGKPQETDYATKEAFNSLRTNLKFCGDDIRVVALTSCTENEGKSTTALNLSFSFTEDGKKVLLIDADLRKSV
FIGANKLRADGQIMGLSHYLSGQCMMEDVIYQTDVKGLDLVVAGPTAPNPTELLGGERFENLIRKARETYDIVLIDSPPL
GMVIDTVVMAHCCDGAIIVIESDMISYRYALEVKKQLEFADCRILGTVLNKVDLGGGKYYKGYYKKGKYGAYK
>gnl|bykdb|A0A1C6L158 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Clostridium sp] (length=217 residues).
MFIVEKSPKSVAAEAYRSLKTNIQYSSFDKEYKTIVITSSNPGEGKSTTAGNLALTLAEGEAKVLLVDCDMRKPSMHKNF
RITNTYGISNILLQKQKVMDVAHCYNKNLSIITAGKVPPNPAEMLASKAMTAFLKEMKEHFDYIVLDTPPVQAVADAQIL
STKVDGTLVVVRAGVTKKDEVQNTVNTLKKVNADIIGTILHAVDNTRNKYQYYYGNE
>gnl|bykdb|A0A1C6L202 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Clostridium sp] (length=217 residues).
MFIVEKSPKSVAAEAYRALKTNIQYSSFDKEYKTIVITSSNPGEGKSTTAGNLALTLAKGEAKVLLVDCDMRKPSVHKNF
RITNTYGISDILLQKKKVTEVAYSYNKNLSIITAGKVPPNPAEMLASKAMTAFLKEMKDHFDYIVLDTPPVQAVADAQIL
STKTEGTLVVVRAGVTKKDEVKNTINTLNKINANIIGTILHAVDNTRNKYQYYYENE
>gnl|bykdb|A0A1C6L206 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Clostridium sp] (length=232 residues).
MVKVKISDWKADSSMDEAYKALRTNIQFCGADKKVIAFTSCTPNEGKSNVTFHLAASLAESGKSVLLIDADLRKSVLMGR
VQVEEEVKGLTHYLSKQAKLQDVICATNLPKFHIIFSGVVPPNPAELLGSRQFKDMIRVVRDVYDYIIIDTPPLGRVIDC
AVVADSCDGTVIVIESGSISYHFVQEIKGQLEKTNCPIIGAILNKVDTKEYGKYGKYGKYGKYGKYGEYGKY
>gnl|bykdb|A0A1C6LB47 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Clostridium sp] (length=255 residues).
MNQLNVNLPELPYAVSEAMNRLRINIKFCGKNTRKILLTSCQPNEGKSTISSYLWKMLAEAGFPTVLVDVDLRKSVMKTR
FQMDYDDDTTMGLNHYLSGMAEYEDVIYSTNIPNGYMVPCTQLLENPSALLEDVRFKELLNTLSENYRFVIIDSPPLGSV
SDGALIASLCDGAVLVVRAGTTPRTLIKQSLYEIQQSGCKLLGTVLNRADVKGRAYGKYGYGKYGYGYGYGYGYEPKDKK
NSSDSAAADKNSTGK
>gnl|bykdb|A0A1C7CFH5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus salivarius] (length=246 residues).
MPLLKLVNSKVNFAKQTEEYYNAIRTNIQFSGAQMKVIAVSSVEAGEGKSTTSVNIAISFASVGLRTLLIDADTRNSVLS
GTFKSNEPYKGLSNFLSGNATLEETVCRTDIAGLDVISSGPIPPNPTSLLQNENFTHLLDVARSQYDYVIIDTPPIGLVI
DAVIVAHQADASLLVTAAGKIKRRFVTKAVEQLTQSGSQFLGVVLNKVDMTVDKYGTYGSYGSYGDYGKKSEQKSSHSRS
QRRRKG
>gnl|bykdb|A0A1C7DFA1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planococcus antarcticus DSM 14505] (length=233 residues).
MARKKKVLQETARKLIAFTTPRSFVSEQFRTLRTNINFSSPDAEIRTMVVTSAAPSEGKSTTSANLAVVFAQEGKKVLLI
DGDMRKPTTHYTFRMGNTVGLSSVLTRRNSIQEVIRPTAVERLDLMTCGPIPPNPAELLASKSMTALIEQLKDMYDLIIF
DAPPVLSVTDGQILANKCEGTILVVSSGNTEKDMALKAKEAIESSNSRLIGAVLNNYALAKDNYYYQYYGTTE
>gnl|bykdb|A0A1C7DFC4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planococcus antarcticus DSM 14505] (length=234 residues).
MVKKKNKPEVKNRKLIAFTNPKSRVSEQFRTLRTNLHFSSPDGDIQSLAITSASHSEGKSTTASNLAIVFAQEGKRVLLI
DADMRKPTMHETFKITNTRGLSSVLTRQIALKVAIQSAEIKNLDLLPCGPIPPNPAELLSSHSMDLFFEQALDTYDLLIF
DTPPVLSVTDSVILANKCEGTLLVVNSGKTEREYALRAKEALTASTKTRLLGAVINNVKVQKDAAYEQYYGTDS
>gnl|bykdb|A0A1C7DFQ3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planococcus antarcticus DSM 14505] (length=234 residues).
MRAMKKTKRLMPRKLVARTNPQSIAAEQYRTIRTNINFSTPGLDSKVILFTSASKEEGKSTTAANMAIVFAETGKKVLLI
DADMRRPTLYRTFELGNNIGLSNLLIRKGKLKQSVKASGIQNLDLLMSGQIPPNPAELLESDALDELIEEMRGLYDYVLF
DSPPILSVTDSKILANKCDGTVLVVNTGKSEKISVEKARDSLATAKAFILGVVLNNYPMNKENYYYHNYDSQFS
>gnl|bykdb|A0A1C7DQH2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planococcus halocryophilus] (length=231 residues).
MRTANKTKRLMPRKLVVRTNPHSIAAEQYRTIRTNINFSIPDLTSKIILFTSASKEEGKSTTAANMAIVFAETGKRVLLI
DADMRRPTLFRTFQLVNNTGLSNLLLGKGNLKHSVKASGIPNLDLLMSGQIPPNPAELLESDILDELMGEMRELYDYVLV
DSPPILSVTDAKILANRCDGTVLVVNTGKSEKVSVEKARDSLATAKAFILGVVLNNYPLTSENYYYHNYND
>gnl|bykdb|A0A1C7DRC0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planococcus halocryophilus] (length=237 residues).
MVKKKNKPEVKNRKLIAFTNPRSRVSEQFRTLRTNIHFTVPDGKVRSLVVTSASHSEGKSTTSSNLAIVFAQEGKRVLLI
DADMRKPTMHQTFKISNSKGLSNVLVRRVSLKMAIQASGIENLDLLPSGPIPPNPAELLSSSNMDLLFENALDTYDMLIF
DSPPVLSVTDSVILANKCEGTILVLNSGKTERAHALKAKEAITAATKTRLLGIVLNNVQVDKDLNYAQYYAESQFEK
>gnl|bykdb|A0A1C7DRD3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planococcus halocryophilus] (length=233 residues).
MARKKKVLQETARKLIAFTTPRSVVTEQFRTLRTNINFSSPDSEIRTMVVTSAAPSEGKSTTAANLAVVFAQEGKKVLLI
DGDMRKPTTHYTFRMGNTIGLSSVLTRQSSIQEVIRATAVDRLDLMTCGPIPPNPAELLASKSMDTLIEQLKNTYDLIIF
DAPPVLSVTDGQILANKCEGTILVVSSGNTEKDKALKAKEAIESSNSRLIGAVLNNFELPKDSYYYQYYGNTE
>gnl|bykdb|A0A1C7E2V7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planococcus maritimus] (length=233 residues).
MRMLNQTASKRPLARKLVARIKPNSVISEQYRTIRTTINFSLPGNEMKTLLFTSASKEEGKSTTSANMAIVFAESGKKVL
LVDADMRKPTLHHTFHLNNHMGLSNLLIGKGELEQSVRDSGIQGLELLTSGQIPHNPAELLDSPMLDRLIEKMKERYDLI
IFDSPPILSVSDSKIMANKCDGTVLVVNTGKTEKQSAIKARDSLTTSKAYIVGVVMNNYKLSKDHYYSYEYNY
>gnl|bykdb|A0A1C7E385 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planococcus maritimus] (length=232 residues).
MAKKKQLQETARKVVTHTTPRSIVSEQFRTLRTNVNFASPDKDLRTIVVTSAAPGEGKSTTSANLATVFAQEGKTVLLVD
GDMRKPTTHYTFHMPNTIGLSNVLTRQTTVENAIRPTKIERLDLMTCGPIPPNPAELLASNAMAMLIADLKKRYDMVIFD
APPVLSVTDGQVLANKCDGAIMVINSGSTEKEMAAKAKEAIEASNSKLIGAVLNNFELAKDSYYYQYYGTAE
>gnl|bykdb|A0A1C7E7W3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planococcus plakortidis] (length=232 residues).
MRMLNQTASKRPLARKLVARIKPNSVISEQYRTIRTTINFSLPGSEMKTLLFTSASKEEGKSTTSANMAVVFAESGKRVL
LVDADMRKPTLHHTFNLNNHSGLSNLLVGKGELEQSVRDSGIRGLELLTSGQVPHNPAELLDSPMLDRLMAEMKERYDLV
IFDSPPILSVTDSKILANKCDGTVLVVNTGKTEKQSAMKARDSLATSKAFIVGVVMNNYKLSKDHYYSNEYQ
>gnl|bykdb|A0A1C7E9H6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planococcus plakortidis] (length=234 residues).
MAKKKQSLQQTARKVITHTTPKSFVSEQFRTLRTNVNFASPDLELRSIVVTSAAPGEGKSTTSANLATVFAQEGKNVLLV
DGDMRKPTTHYTFHMPNTIGLSNVLTRQATVEDAIRPTTIERLDLMTCGPIPPNPAELLASNAMGMLISDLKKRYDVVIF
DAPPVLSVTDGQVLANKCDGAILVVNSGSTEKEMAAKAKEAIEASNSKLIGAVLNNFELAKDSYYYQYYGNAEE
>gnl|bykdb|A0A1C7EG16 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planococcus donghaensis] (length=231 residues).
MRTANKTKRLMPRKLVVRTNPHSIAAEQYRTIRTNINFSIPDLTSKIILFTSASKEEGKSTTAANMAIVFAETGKRVLLI
DADMRRPTLFRTFQLGNNTGLSNLLLGKGNLKHSVKASGIPNLDLLMSGQIPPNPAELLESDTLDELMEEMRGLYDYVLF
DSPPILSVTDAKILANRCDGTVLVVNTGKSEKVSVEKARDSLATAKAFILGVVLNNYPLTSENYYYHNYNE
>gnl|bykdb|A0A1C7EGH2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planococcus donghaensis] (length=233 residues).
MARKKKVLQETARKLIAFTTPRSFVSEQFRTLRTNINFSSPDAEIRTIVVTSAAPSEGKSTTSANLAVVFAQEGKKVLLV
DGDMRKPTTHYTFRMGNTIGLSSVLTRQSSIQEVIRPTAVDRLDLMTCGPIPPNPAELLASRAMTTLIEQLKNMYDLIIF
DAPPVLSVTDGQILANKCEGTILVVSSGNTEKDMALKAKEAIESSNSRLIGAVLNNYELAKDSYYYQYYGNAE
>gnl|bykdb|A0A1C7EGR0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planococcus donghaensis] (length=237 residues).
MVKKKIKPEVKNRKLIAFTNPRSRVSEQFRTLRTNIHFTVPGGKVRSLVVTSASHSEGKSTTSSNLAIVFAQEGKRVLLI
DADMRKPTMHQTFKISNSKGLSNVLVRRVSLKMAIQDSGIENLDLLPSGPIPPNPAELLSSSNMDLLFENALDTYDMLIF
DTPPVLSVTDSVILANKCEGTILVLNSGKTERAHALKAKDAITASKKTRLLGTVLNNVQVDKDFDYAQYYIRPRSEK
>gnl|bykdb|A0A1C7I8G7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia sp. YL58] (length=231 residues).
MDKLEIKGEISLSSREREVYRTLRTNLEFTGVENRVIAVTSCTPNDGKSTVAYNLALALAESGRNTLLIDADMRKSVLVH
RLRIEGAIKGLSHYLSGQEELGDVVYGTNKRNFFLLPTGIFPSNPTELLGNERLQKLLTGLKNTFAYIIIDTPPLGSVID
AAVIAQVCDGSILVLAADNSSRAEAKGVVGQLKAANSNLLGVVLNKVDVHTGSYYGKKYGGYYGNKYGGYY
>gnl|bykdb|A0A1C7IDI4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia sp. YL58] (length=242 residues).
MSTIKLKMKKLDYETNESYKTLRTNLQFCGEDKKVIVMTSCTPNEGKSTVATYLASAMAQAGKRVLLIDGDLRKSLFTGN
FEITDEVKGMAHLLSGQASLEEVICNTDQAGLDVVFSGPVPPNPTELLGDKAFKNMIKKCREMYDYVFIDSPPLGSVIDS
AIIAESCDGSIIIIEAEVISYRFVQEIKEQLEKSNCPILGTILNKVDVRGQKYYSRYYGKKYGYGKYYKYGHYGKEERER
NH
>gnl|bykdb|A0A1C8QIU9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKKELVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMS
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGHVKRSSLKKVKEQLDQTGTPFLGVILNKYDIANEKYSEYGNYGHYGKKA
>gnl|bykdb|A0A1C9C1U3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis Bt18247] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A1C9IDN8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=241 residues).
MATLEIARTKKELVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTSDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGHVKRSSLKKVKEQLDQTGTPFLGVILNKYDIANEKYSEYGNYGHYGKKASQISDNISLISR
Y
>gnl|bykdb|A0A1C9IDU0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTSDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGHVKRSSLKKVKEQLDQTGTPFLGVILNKYDIANEKYSEYGNYGHYGKKA
>gnl|bykdb|A0A1C9IDW6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGVTSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGHVKRSSLKKVKEQLDQTGTPFLGVILNKYDIANEKYSEYGNYGHYGKKA
>gnl|bykdb|A0A1C9IDZ9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIGYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGSVKRSSLKKVKEQLDQTGTPFLGVILNKYDIANEKYSEYGNYGHYGKKA
>gnl|bykdb|A0A1C9IED9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMS
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGMVI
DAAIIAQKCDAMVAVVEAGSVKRSSLKKVKEQLDQTGTPFLGVILNKYDIANEKYSEYGNYGHYGKKA
>gnl|bykdb|A0A1C9IFW6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGSVKRSSLKKVKEQLDQTGTPFLGVILNKYDIANEKYSEYGNYGYYGKKA
>gnl|bykdb|A0A1C9IG35 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKKELVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTSDLSQGLCDTDIPNLTVIESGKISPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGHVKRSSLKKVKEQLDQTGTPFLGVILNKYDIANEKYSEYGNYGHYGKKA
>gnl|bykdb|A0A1C9IG87 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMS
GFFKPITKITGLTDYLAGTTDLSRGLCETNIPNLTVIESGKISPNPTALLQSKNFENLLATLRRYFDYVVVDCPPLGMVI
DAAIIAQKCDAMVLVAEAGHVKRSAVKKVKGQLEQTGTPFLGVILNKYDIANEKYSEYGNYGHYGKKA
>gnl|bykdb|A0A1C9IGG1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKREIVNKNEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGHVKRSSLKKVKEQLDQTGTPFLGVILNKYDIANEKYSEYGNYGHYGKKA
>gnl|bykdb|A0A1C9IGX7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSITAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGSVKRSSLKKVKEQLDQTGTPFLGVILNKYDIANEKYSEYGNYGHYGKKA
>gnl|bykdb|A0A1C9IH36 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKKELVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTSDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGHVKRSSLKKVKEQLDQTGTPFLGVILNKYDIANEKYSEYGNYGHYGKKA
>gnl|bykdb|A0A1C9IHH7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKREIVNKNEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVLVAEAGNVKRSSLKKVKEQLDQTGTPFLGVILNKYDIATERYSEYGNYGNYGQKA
>gnl|bykdb|A0A1C9IHK8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKKELVKKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTSDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGHVKRSSLKKVKEQLDQTGTPFLGVILNKYDIANEKYSEYGNYGHYGKKA
>gnl|bykdb|A0A1C9IHQ7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVLVAEAGNVKRSSLKKVKEQLDQTGTPFLGVILNKYDIATERYSEYGNYGNYGQKA
>gnl|bykdb|A0A1D2KMU4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Brochothrix thermosphacta] (length=228 residues).
MRKTKIKDKKRLNIILNRENAKSIPYEQMKNIRSSIQFASTKELKSLIVTSPESGTGKSFVATNLALTYAEQGKKVLLVD
TDLRRPTIHKMFGKENILGITSVLTGQETIDDCVQDTIFNSLTILTSGFLPPNPAELLESEEMKAIIKQLTTDYDIVIFD
APPVLPVVDSALLSTLVDGVIFVIRSRYTEQGAAVKAVEKIKSAGSRIIGTILNDKSSKDSGYEAEYY
>gnl|bykdb|A0A1D2LG11 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Brochothrix thermosphacta] (length=221 residues).
MKRKLKQNLITFYNSKSPVSEQIKAVRTSLNFATIDQDAQVILITSPTPSSGKSVVSSNLAVSYAQQDKKVLIIDGDLRK
ATQHYQFKADPYRGLSSLLIGKLSIADAIQETFVPNLSVLTSGPMPPNPAELLSTNKLDTLMDEFKKSFDIIIIDTPPVI
NLTDAVVISRVADGIILVVRANHTQKNEVSRSVEILKTTNKKLFGTILNDAKYEVSDYYYY
>gnl|bykdb|A0A1D2YVY5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Vulcanibacillus modesticaldus] (length=242 residues).
MELYKRGVRYVKFKTKGKTKRERKLITIYSPKSPISESFRTLRTNIQFASIDQSLKTLMVTSTGPGEGKSTIIANLAVVL
AQQEKKVLLVDADMRKPTVHHTFRLPNLVGLTNVLVGNEVLEDAIQETTVNNLNILTSGPIPPNPAELLGSNRMSQLVDE
VSSTYDIVLFDAPPVIAVTDAQVLSRIIDGVLLVVHSGKTHREMAIKSKELLENVRANVIGVVLNHKEVKGENYYYYYYG
EN
>gnl|bykdb|A0A1D3NKD8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus mycoides] (length=234 residues).
MALKSLFQKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNVEFASVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKK
VLLIDADMRKPAMHQMFQVDNIVGLTNVLTHSERLEKCVQVTAVENLSFLACGPIPPNPAELLGSKSMQELLAQAYSMYD
LVIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A1D3PR17 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANICDASILVVRSESTEKETAVKAKGLLESAKGKLLGAVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A1D3R461 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMSVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSLYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKEAAVKAKGLLESAKGKLLGVVLNDREREQSLYYYYGAN
>gnl|bykdb|A0A1D3TRA1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerobium acetethylicum] (length=247 residues).
MQHISVGLEQKMDYYMSESFKSLRTNILFCGSENKVIAFTSCTPNEGKSSVSLKMAISMAEAGKNVLFIDADLRKSVLAG
CYKLDKPLRGLSHFLSGQEKFDEVVCVTEIENLHMVFSGPVPPNPAELLGNRKFELLLNELRKVYDYVIIDTPPLGYVID
AAVVAEQCDGAIMVVESKAVSYKFAGKIKEQLERSNCKILGVVLNKVERRERGLYGRYYGGYYGKYYGKYYGKYYGKYYG
HEENKDK
>gnl|bykdb|A0A1D3TRD1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerobium acetethylicum] (length=226 residues).
MQNVKIDIDRKMDYLSNEAYKGLRTNILFCGSDIKVIAITSCTPNEGKTEISFRLAVSMAEAGKKVMFIDADLRKSVLVG
RYKVETSLKGLSHYLSGQESLDSIICTTSAENMQVIFSGQVPPNPAELLGNSRYQSMIAEFREMYDYIIIDTPPLGRVID
AAVIAGQSDGAVLVIESNAISYKFAQKIVEQLEKSNCRILGAVLNKVEHKDKGIYGKYYGKYYGQY
>gnl|bykdb|A0A1D7QRL4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus beveridgei] (length=237 residues).
MGRKQKKRALKSITSKPQLITETDPRSPIAEQFKTLRTNIQFSSYDHALQTMVITSSSPGEGKSTVAANLAVVLAQQDKK
VLIIDGDLRKPTVHYTFRIPNKTGLSSVITGQALLDDVIIASQTERVHVLPSGPVPPNPSEMLSSNRMAMLLDEVKVNYD
YIVLDTPPVNAVTDAQILGKMCDGVILTLRSGVTETEEALDAKRALEATGAKILGAVLNDLAVEQSKYHYYYGAESS
>gnl|bykdb|A0A1D7XN28 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium taeniosporum] (length=246 residues).
MFFKSKLDKALENQNYKGFVVEKKPKSIVSESYRTLRTNIQYSSFDREIQTIVITSAEAAEGKSTVSGNLALSFAQNEKR
VIIVDCDLRKPSVHKNFKMSNLVGLSEVLLGTSKLDEVIQKRNENLHVLTSGKIPPNPAEMLSSTAMSRLLEELKKEYDT
IILDSAPLGAVTDAQVLSTKVDGTILVTRAERTKIESVIEAKNLLTKVGANIIGCVLHAVENTKGKYYYYYGTDGEMKRK
EHEDDK
>gnl|bykdb|A0A1D7ZX45 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus fermentum] (length=232 residues).
MNNGVMLIMLADPKSGPAEQFRTIRTNIHFMSVDRPLKTFAFTSSGISEGKSTVTANVAIAWAQEGKRVLLIDADLRRST
LHATFGLSNQKGLTTILTGDSKEVDLSNVVQKSGVENLEVLTAGPVPPNPSELLGSQRMQSLINGVREAYDIVVLDVPPM
LQVTDTQVLSSNLDGVILVVRQGMTKKAAIRRAVEMLKISQANVLGYVMNDVYDDDAGYGYGYGYDYEGGEG
>gnl|bykdb|A0A1D8FMB6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus subtilis subsp. subtilis] (length=227 residues).
MIFRKKKARRGLAQISVLHNKSVVAEQYRTIRTNIEFSSVQTNLRSILVTSSVPGEGKSFSAANLAAVFAQQQEKKVLLV
DADLRKPTINQTFQVDNVTGLTNVLVGNASLSETVQKTPIDNLYVLTSGPTPPNPAELLSSKAMGDLISEIYEQFSLVIF
DSPPLLAVADAQILANQTDGSVLVVLSGKTKTDTVLKAKDALEQSNAKLLGALLNKKKMKKSEHYSY
>gnl|bykdb|A0A1D8FMU1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus subtilis subsp. subtilis] (length=237 residues).
MALRKNRGSRMQRNVIAMTEPKSLNSEQYRTIRTNIEFASVDRQMKSVMITSACPGEGKSTTAANLAVVFAQQGKKVLLI
DADLRKPTVHTAFFLENTVGLTSVLLKKSSMEQAVQASNEKHLDVLTSGPIPPNPAELLSSKWMKELAYEACAAYDMVIF
DTPPILAVADAQILGNVADGSVLVISSGKTEKEQAAKAKEALATCKSKLLGAIMNGKKLSKHSEYGYYGTKDNFMQK
>gnl|bykdb|A0A1D9FJN5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium formicaceticum] (length=245 residues).
MKERKIITHSNPKSPISEAYRTLRTNIQFASLDNPIKVLMVTSSGPGEGKTTTTANLAVTMAQLGAKVLVMDADLRKPAV
HKAFQLSNSEGVTNILVKDLNYKEFLLKTEVEGLEVLPSGAIPPNPSELLASQKMKNFIHSLREDYDYILIDTPPAAIVT
DAALLSTAVDGVILVCAAGEVAIQGAQRAKELLDNVNANIIGVVLNKIPIGKKGSSYYSYYYYSSYYGEEEPVKNKKNKR
MKQHG
>gnl|bykdb|A0A1D9N014 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium pasteurianum] (length=234 residues).
MLIVKDNPKSPISESYRTLRTNIQFSSFDDNMSTILVTSSTPSEGKSTVSSNLALAMAETNKKVLLIDCDLRRPSIHKKF
GLSNEKGLSNLLIGQHSFNEIAQEITSNLCVLTSGTIPPNPSEMLSSKKMELFLKEAEKNFDFIILDTPPVVSVTDAQAL
STIVDGVLLVVSSGHAQIPEVHKAIELLQYVKANIIGIVANKVKSFRRGYKYYQYYYYGEGDGKNKKHRSKSSK
>gnl|bykdb|A0A1D9P3V8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Butyrivibrio hungatei] (length=277 residues).
MQTAKLHFSQSENNYQIKEAYKTLRSNIEFSGQNVRVISVTSCTPGEGKTTVAMALARAFAEAGKKTVLVDADMRKSVLV
GRYRTGSVRLGLTHCLVGRERLSSVICETDTPNLYVIFSGPVPPNPSELLGGRIFSKVLENMKQVFDYVIIDTPPLGSVI
DAAVVSKQCDGTVMVIESNAISYRFAQRVKDQLDKAGAKMLGVVLNKVDISGKGYYGHYGNYYGKYYGKYYGKYYGKYGD
DAEMSSGSGRPKTPEADLPDDDDLDELNYLAGVTRKD
>gnl|bykdb|A0A1D9PNZ1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus velezensis] (length=226 residues).
MGFRKKKSRRGLAQISVLHHKSLVAEQYRTIRTNIEFSSVQTHLRSILVTSSVPGEGKSFSAANLAAVFAQQEKKVLLVD
ADLRKPTIHETYQLENVQGLTNVLVGNASLGETVQKTLIDNLYVLTSGPTPPNPAELLSSKAMGELIQEMYSRYSLVIFD
SPPLLAVADGQILANQTDGSVLVVLSGKTKMDTVQKARDALQQSKAKLLGALLNKKKIKKTEHYSY
>gnl|bykdb|A0A1D9PPA8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus velezensis] (length=229 residues).
MLTRKKDKPGKRSVIAMSEPKSINSEQYRTIRTNIEFSSVDTEVKSLLITSAGPEEGKSTTAANLAVVFAQQGKKVLLID
ADLRKPTVHFTFKLDNGTGLTSLLLKQMPFQKAVLPADEANLDILTSGPIPPNPAELLSTGAMKDLLSEAGAVYDKVILD
TPPVLAVADTKILGSYTDGAIMVISSGKTDKEKAAKAKEALDYCPCKLLGAVMNGKKQTKHSDYAYYGQ
>gnl|bykdb|A0A1E1GCH8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. NPS 308] (length=230 residues).
MPTLEIVQKKLDLARKAEEYYNALRTNIQLSGNNLKVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSQGLCDTNVENLFVIQAGSISPNPTALLQSENFATMLDTLRKYFDYIIVDTAPIGVVI
DAAIVTQKCDASVLVTAVGEANRRDVQKAKGQLEQTSKPFLGIVLNKLNTSVEKYGSYGAYGSYGNYGRK
>gnl|bykdb|A0A1E2W451 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus luciferensis] (length=231 residues).
MVKKTTKEKLKRFLITLTNPKSPFAEQYRTVRTNIQFSSIDRKIKSILVTSSEPSEGKTTTIANLAITYAQQEKKVLLVD
ADLRKPQLHSDFKLENFKGLTTAIAQEKSLKDVIQKTDISNLSILTSGPIPPNPSELLSSEKMKKLIAQMYEQYDVILFD
APPLLAVTDAQIISQVCDGTILVVRRGYTAKEKIKKAKELLTLVNANILGVVLNRAEQDKDGYYDYYGSEK
>gnl|bykdb|A0A1E3A154 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Eisenbergiella tayi] (length=308 residues).
MQTVTFNAIEKLDFRTKESYKTLRTNLEFSGKDRRVISVTSSTPNEGKTSVSFQLAISIAEGGKKVILVDADLRKSVLKG
RYKSNASRYGLSHYLSGQASISEICCKTNIPNFYVIFSGPVPPNPSELLGNDAFELLLEYLRKEYDYVIVDTPPLGSVID
GAVAAQHCDGTVIVIESGAISYKFAQKVKEQLEKVDCRILGVILNKVNMSGKGYYGAYYGKYYGKYYGKYYGNDDEGGLH
AAVVQKGTKAAKAVKGDTGERSHEGKNGSGSGKEKGLEENGYPEDDMIQLDIDMVQLVEDTETIEELK
>gnl|bykdb|A0A1E3A6V1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Eisenbergiella tayi] (length=308 residues).
MQTVTFNAIEKLDFRTKESYKTLRTNLEFSGKDRRVISITSSTPNEGKTSVSFQLAMSIAEGGKKVILVDADLRKSVLKG
RYKSNAARYGLSHYLSGQASISDIFCKTNIPNFYVIFSGPVPPNPSELLGNDAFRILLEYLRNEYDYVIVDTPPLGSVID
GAVAARYCDGTLIVIESGAISYKFAQKVTEQLEKVDCRILGVILNKVNMSGKGYYGAYYGKYYGKYYGKYYGNNEEGGLH
AAVVQKGLKNGKAAKGEENTHSHEIKNGSDPVKEKIPEENQIPEDDMIQLDIDMVELTEDTEPIEKLK
>gnl|bykdb|A0A1E3AC90 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Eisenbergiella tayi] (length=308 residues).
MQTVTFNAIEKLDFRTKESYKTLRTNLEFSGKDRRVISVTSSTPNEGKTSVSFQLAISIAEGGKKVVLVDADLRKSVLKG
RYKSNASRYGLSHYLSGQASISEICCKTNIPNFYVIFSGPVPPNPSELLGNDAFELLLEYLRKEYDYVIVDTPPLGSVID
GAVAAQHCDGTVIVIESGAISYKFAQKVKEQLEKVDCRILGVILNKVNMSGKGYYGAYYGKYYGKYYGKYYGNDEEGGLH
AAVVQKGTKAAKAVKGDTGERSHEGKNGSGSGKEKGLEENGYPEDDMIQLDIDMVQLVEDTETIEELK
>gnl|bykdb|A0A1E3AD88 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Eisenbergiella tayi] (length=308 residues).
MQTVTFNSIEKLDFRTKESYKTLRTNLEFSGKDRKVISITSSTPNEGKTSVSFQLALSIAEGGKKVVLVDADLRKSVLKG
RYKTNAARYGLSHYLSGQASISDISCKTNIPDFYVIFSGPVPPNPSELLGNDAFRLLLEYLRKEYDYVIVDTPPLGSVID
GAVAAQHCDGTVIVVESGAISYKFAQKVKEQLEKVDCRILGVILNKVNMSGKGYYGAYYGKYYGKYYGKYYGNSEEGGLH
AAVVQKGTKGAKAVKGVGNLHSHDNKSARESGKEKAAEEGVIAEDDMIQLDMDMVELVEDTELIEELK
>gnl|bykdb|A0A1E3ADK5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Eisenbergiella tayi] (length=308 residues).
MQTVIFNAIEKLDFRTKESYKTLRTNLEFSGKDRRVISITSSTPNEGKTSVSFQLAMSIAEGGKKVILVDADLRKSILKG
RYKTNASRYGLSHYLSGQANISDICCKTNIPNFYVIFSGPVPPNPSELLGNDAFRLLLDYLRKEYDNVIVDTPPLGSVID
GAVAAQYCDGTVIVIESGAISYKFAQKVKEQLEKVDCRILGVILNKVNMGGKGYYGAYYGKYYGKYYGKYYGNNEEGGLH
AAVVQKGMKGSRAVKGEGNGFPHETKGKPETEKEMGKEDTLTEEDDMIQLDIDVVELTEDMEQIEELK
>gnl|bykdb|A0A1E3AEF3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Eisenbergiella tayi] (length=308 residues).
MQTVTFNAIEKLDFRTKESYKTLRTNLEFSGKDRRVISITSSTPNEGKTSVSFQLAMSIAEGGKKVILVDADLRKSILKG
RYKTNASRYGLSHYLSGQANISDISCKTNIPNFYVIFSGPVPPNPSELLGNDAFRLLLDYLRKEYDYVIVDTPPLGSVID
GAVAAQYCDGTVIVIESGAISYKFAQKVKEQLEKVDCRILGVILNKVNMSGKGYYGAYYGKYYGKYYGKYYGNNEEGGLH
AAVVQKGIKGSRAVKGEENIFLHETKGKPETGKEMGTKETLTEDDDMIQLDIDEVELTEDMERIEELK
>gnl|bykdb|A0A1E3AM71 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Eisenbergiella tayi] (length=308 residues).
MQTVTFNSIEKLDFRTKESYKTLRTNLEFSGKDRKVISITSSTPNEGKTSVSFQLALSIAEGGKKVVLVDADLRKSVLKG
RYKTNAARYGLSHYLSGQASISDISCKTNIPDFYVIFSGPVPPNPSELLGNDAFRLLLEYLRKEYDYVIVDTPPLGSVID
GAVAAQHCDGTVIVVESGAISYKFAQKVKEQLEKVDCRILGVILNKVNMSGKGYYGAYYGKYYGKYYGKYYGNSEEGGLH
AAVVQKGTKGAKAVKGEGNLHSHDNKSTRESGKEKTAEEGVIAEDDMIQLDMDIVELAEDTELIEELK
>gnl|bykdb|A0A1E3U5Z6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Eisenbergiella tayi] (length=312 residues).
MQTVTFNAIEKLDFRTKESYKTLRTNLEFSGKDRRVISITSSTPNEGKTSVSFQLAMSIAEGGKKVILVDADLRKSVLKG
RYKSNAARYGLSHYLSGQASISDIFCKTNIPNFYVIFSGPVPPNPSELLGNDAFRILLEYLRNEYDYVIVDTPPLGSVID
GAVAARYCDGTLIVIESGAISYKFAQKVTEQLEKVDCRILGVILNKVNMSGKGYYGAYYGKYYGKYYGKYYGKYYGNNEE
GGLHAAVVQKGLKNGKAAKGEENTHSHEIKNGSDPVKEKIPEENQIPEDDMIQLDIDMVELTEDTEPIEKLK
>gnl|bykdb|A0A1E3UR08 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Eisenbergiella tayi] (length=308 residues).
MQTVTFNSIEKLDFRTKESYKTLRTNLEFSGKDRKVISITSSTPNEGKTSVSFQLALSIAEGGKKVVLVDADLRKSVLKG
RYKTNAARYGLSHYLSGQASISDISCKTNIPDFYVIFSGPVPPNPSELLGNDAFRLLLEYLRKEYDYVIVDTPPLGSVID
GAVAAQHCDGTVIVVESGAISYKFAQKVKEQLEKVDCRILGVILNKVNMSGKGYYGAYYGKYYGKYYGKYYGNNEEGGLH
AAVVQKGTKGAKAVKGEGNLHSHDNKSIRESGKEKAAEEVVIAEDDMIQLDMDIVELAEDTELIEELK
>gnl|bykdb|A0A1E4R4B2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lysinibacillus fusiformis] (length=232 residues).
MLFKRKTKRIPMARKLITVSDMMSIPSEQYRTIRANIKFSQPNQDVKTILVTSSIAGEGKSTNAANIGVVFSQEGKRVLI
IDADMRKPTLHHTFYLDNIFGLSSVLSRQATLQEVIQETFVEGVDIISSGAIPPNPTELLASETMTFLLHEVKERYDIVM
IDAPPLLFLSDAQILSNKCDGTLLVVNTGAVGKAAVVKSKSILTISKANILGVILNNYKMKGSTYEQYYGKE
>gnl|bykdb|A0A1E5G9A8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus termitis] (length=233 residues).
MSNKIRNQKKQKTKAVSLITLADKSSPISEQYRTIRTNIQYAMVDRALKTLVITSSGPSEGKSTTSANLAIVFANSGKRV
LLVDADMRKPTVSKTFSIDNVRGLSTLLGSREVVLHQVVQSSGVDNLFLMTSGPKPPNPSELLDSRRMEELIRELKQQYD
LIIFDMPPVVAVTDAQIVSSKSDGTILVVRENVSKRDSLLKAKSLLELVDANILGVVYNGSKNVTDQGYYYGS
>gnl|bykdb|A0A1E5GGN9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus ureasiticus] (length=233 residues).
MTNKIRPQKKQKTKAVSLITLADKSSPISEQYRTIRTNIQYAMVDRDLKTLVITSSGPSEGKSTTSANLAIVFANSGKRV
LLVDADMRKPTVAKTFSLDNVRGLSTLLGSRETVLHQVVQSSGVDNLFLITSGPKPPNPSELLDSRRMKELMVELKQQYD
LVIFDLPPVVAVTDAQIVSSKSDGTILVVRENVSKRDSLLKAKNLLELVDANILGVVYNGSKNIADQGYYYGS
>gnl|bykdb|A0A1E5GPP8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus quebecensis] (length=233 residues).
MTNKMRQQKKQKTRAVSLITLADKSSPISEQYRTIRTNIQYAMVDRDLKTLVITSSGPSEGKSTTSANLAVVFANSGKRV
LLVDADMRKPTVAKTFSLDNVRGLSTLLGSRETVLHQVVQSSGVDNLFLMTSGPKPPNPSELLDSRRMGELLQELKQQYD
LIIFDMPPVVAVTDAQIVSSKSDGTILVVRENVSKRDSLLKAKNLLEMVDANILGVVYNGSKNITDQGYYYGS
>gnl|bykdb|A0A1E5HFH0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus ureilyticus] (length=234 residues).
MTKNIIRAQKKQKTKAVSLITLADKSSPISEQYRTIRTNIQYAMVDRDLKTLVITSSGPSEGKSTTSANLAIVFANSGKR
VLLVDADMRKPTVAKTFTLDNARGLSTLLGSRETMLHQVVQPSGVDNLFLMASGPKPPNPSELLDSRRMQELLQELKHQY
DLVIFDMPPVVAVTDAQIVSSKSDGTILVVRENVSKRDSLLKAKSLLELVDANILGVVYNGSKSIEDQGYYYGS
>gnl|bykdb|A0A1E5KSF5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus rivorum] (length=242 residues).
MEEQYVTFRSHEFKRNNREEGDKLVLVTRPLSVATEQFLSIRTSLDFIVEEDAVKVMVVTSCEQNSGKTLISANLAISFA
RGGKKTLIIDGDLRNPSLQRYFYCDRNRGLSSIGDISQLKDNIFETEQENLYILPAGSININPADYFKSSKMKEIFNELR
MHFDIIIVDTPPLLAVSDASVVSNYADGIIVVFRSGKTKLKNAKKTLRILEQSPTPVIGSILNDTNEFRDDYYYNYNYTK
SF
>gnl|bykdb|A0A1E5KXN4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus rivorum] (length=232 residues).
MSKLRQPKRQETKAVSLITMADKSSPVSEQYRTIRTNIQYAMVDRELKTLVVTSSGPGEGKSTSSANIAIVFANAGQKVL
LVDADMRKPTIAKTFAVSNTRGLSSLLSNRNTSLEQVVQPVGIDNLSVITSGPKPPNPSELLGSVKMNQLIKDLKREYDL
VIFDMPPVVTVTDAQIVASKADGTMLVVRENVSKKDSMLKAKTLLQMVNANVIGVIYNGAKNASDQGYYYGN
>gnl|bykdb|A0A1E5LDH3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus solimangrovi] (length=230 residues).
MARKKNNLSSGRNLITQTDPKSPISEQYRTIRTNIQFASIDKQIKTIVVTSSNPGEGKSTTIANLAVTFAQQGKKVLLID
TDMRKSTVHYTFRLENTTGLTNVLTKQVKLLEAIKSINESNMDVLTSGPVPPNPAELLGSQSMKDLLDEAREHYDIILFD
SPPLLAVTDAQILSNQCDGVILVVHSGKTAKEDAQKAKELLQTAQAKILGAVINQKKLKASNYYYYYGNN
>gnl|bykdb|A0A1E7S2H3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Butyribacterium methylotrophicum] (length=244 residues).
MKDSIITYKSPKDPISEAFRNMRTNITFADIDEELRVLTITSTGKGEGKSTIIANYAVALAQSKKKVLLIDCDLRRPRIH
RLFEQPNKRGLTNILLRECEPTEAIQTTDVENLFMISSGPIPPNPSEILASKRLIELINQFKLAFDYILIDAPPVGVVTD
AAVLSHVTDGYIVVAAISVTNKEGVRMALETLRNVNGNIVGVVANNAPVSKRSGYYYYYSAYEEDQHQSKKEKKHRKIKE
KRGK
>gnl|bykdb|A0A1E7XBV3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus sunkii] (length=247 residues).
MNIFHRKRKKLSTDTLRNGVKLITDVDPKDIVSEQFRTVRTNINFSAVNQKLKTIIFTSSAVSEGKSTVSANLAVIWAQQ
GQKTLFIDSDLRRPTLHTTFGLLNTNGLSTALSTDIDFNSVVQKTEIDNLSVITSGPIPPNPSDLLASNRMKELISYFKK
IYDVIILDVPPLLSVTDTQIIAAQVDGVVLVVRQGLAQKLAIKRSTELLKMVKANLLGYVLNDVAPKNGYGYGYGYGYGY
GYDNKSK
>gnl|bykdb|A0A1E8ABI2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSEATEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A1E8B0J3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus mycoides] (length=229 residues).
MVLKKKILRARRQLIAYEQPKSSVSEQYRNIRTNIEFASVDKKIRSLIVTSANQSEGKTTTAANIAIVFAQQGKKVLLID
ADLRKPALHQMMQVENIFGLTSVLTRSKTLETCVTQTKIGNLTFLPCGPIPPNPAELLGASSMKDLLSEAYGTYDLVIFD
SSPILPVTDAQIMANQCDASVLVIRSGATEKEAALKAKQSLDSAKGKLLGVVLNDKEQNGSEYYYYGSN
>gnl|bykdb|A0A1E8GCN0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Floricoccus penangensis] (length=233 residues).
MAKKNTRKKDTTHAVSLITLADASSPVSEQYRTIRTNIQFASTINNEIKTMVITSSGPSEGKSTTSANLAVVFANSGQKV
LIVDADMRKPTVAKTFALPNIGGLSTLLTTPQHVTDIAQYSGIENLYVLTSGPKPPNPSELLGSMRMNEILQEARDNYDF
VIFDMPPVVAVTDAQIMASKVDGTLLVVRENVSRKDALLKAKNLLQMVNANVLGVVYNGAKNVADQGYYYYGA
>gnl|bykdb|A0A1E8GM43 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Floricoccus tropicus] (length=233 residues).
MFKKNNRKKETTQAVSLITLADKSSPVSEQYRTIRTNIQFASTVNNEIKTMVITSSGPSEGKSTTAANLAVVFANSGQKV
LIVDADLRKPTVAKTFALPNVGGLSTLLTTPQHVTDIAQYSGIDNLYVLTSGPKPPNPSELLGSVRMNEILQEARDNYDF
VIFDMPPVVAVTDAQIMASKVDGTLVVVRENVSRKDALLKAKNLLQMVNANVLGVVYNGAKNVADQGYYYYGA
>gnl|bykdb|A0A1E8TZP2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. HMSC071D03] (length=229 residues).
MAKLELSQQKLNSVKKAEEYYNALCTNIQLSGNNLKVIAVTSVDPSEGKSTTATNVAWAFARAGYKTLLIDADIRNSVMS
GVFKSRERITGLTDYLAGTQDLSHGLCETNIDNLFMIQSGSPSPNPTALLQSTNFELMIETLRKYFDYIIVDTAPIGVVI
DAAIIVQKCDASILVTEAGGTKRRDIQKAKVQLEQTGILFLGVVLNKFDVKREKYGSYGTYGSYGKRKK
>gnl|bykdb|A0A1E8UV07 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. HMSC073D05] (length=230 residues).
MNTLEISKNKLQEVRKAEEYFNALATNIQLSGVDLKVIAISSVQENEGKSTTSTNLAVAFARAGYKTLLVDCDIRNSVMT
GIFRSRTKIQGLTDFLSGRSQLDQILYATDFPNLDIIESGQVAPNPTGLLQSKNFTVMMDALREHFDYIIVDTPPIGVVI
DAAIIAQRCDGTVLITESGANGRKAVQKAKDQLEQTGTPFLGVVLNKFNIKAAEYGSYGGYGSYGEYGKK
>gnl|bykdb|A0A1E8X651 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus sp. HMSC055H04] (length=230 residues).
MTNTRRSTSSLIVHEQPKSPISEKFRGIRSNIMFANPDSAVQSIVITSEAPGAGKSTIAANLAVAYAQAGYKTLIVDGDM
RKPTQHYIFNLPNNEGLSSLLLNWSTYQDSIISTEIQDLDVLTSGPIPPNPSELITSRAFANLYDTLLMNYNFVIIDTPP
VNTVTDAQLFSKFTGNVVYVVNSENNNRDEVKKGKELIEATGAKLLGVVLNRMPKDKSASYYAYYGTDES
>gnl|bykdb|A0A1E8XCN7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus sp. HMSC055H04] (length=228 residues).
MSKKENTTTTLFVYEKPKSTISEKFRGIRSNIMFSKANGEVKRLLVTSEKPGAGKSTVVSNVAITYAQAGYKTLVIDGDM
RKPTQNYIFNEQNNNGLSSLIIGRTTMSEAITSTEIENLDLLTAGPVPPNPSELIGSERFKELVDLFNKRYDIIIVDTPP
VNTVTDAQLYARAIKDSLLVIDSEKNDKNEVKKAKALMEKAGSNILGVILNKTKVDKSSSYYHYYGDE
>gnl|bykdb|A0A1E9A4X6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. HMSC034E03] (length=224 residues).
MAKLELTKQKLDSAKKAEEYYNALRTNIQLSGDNLKVITISSVEPSEGKSTTSTNIALAFARAGYKTLLIDADIRNSVMS
GVFKSRERITGLTDYLAGTQDLSHGLCETNIDNLFMIQSGSPSPNPTALLQSANFELMIETLRKYFDYIIVDTAPIGVVI
DAAIIVQKCDASILVTEAGGTKRRDVQKAKVQLEQTGIPFLGVVLNKFDVKREKYGSYGSYGKR
>gnl|bykdb|A0A1E9BB33 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. HMSC056C01] (length=227 residues).
MAKLELSQQKLNSVKKAEEYYNALRTNIQLSGNNLKVIAVTSVDPSEGKSTTATNVAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTDYLAGTQDLSNGLCETNVENLFMIQSGAISPNPTALLQSDKFGSMIETLHKYFDYIIVDTAPIGVVI
DAAIIVQKCDASILVTEAGVAKRREVQKAKSQLEHTGKPFLGVVLNKFDIQRERYGSYGSYGSYGKK
>gnl|bykdb|A0A1E9E189 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. HMSC062B01] (length=233 residues).
MATLEIIKNKLAEMHQAEEYFNALSTNIQLSGSDIKVVAVSSVQPNEGKSTISINLSLAFARAGYRTLLIDADIRNSVMT
GVFKSQRKVEGLTEVLSGNADISRALADTDYPNLDVFLSGQVSPNPTGLLQGKNFEVIMGVLREHYDYIVVDTPPIGMVI
DAAIIAQRCDGSFLVSASGAVSRKAVQKAKEQLEQTGTPFLGVVLNKFDVKSEKYGSYGNYGNYGNYGNYGKK
>gnl|bykdb|A0A1E9G0F5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. HMSC076C08] (length=227 residues).
MPTLEIAQKKLDLARKAEEYYNALRTNIQLSGNNLKVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSQGLCETNVENLFVIQAGSVSPNPTALLQSENFATMIDTLRKYFDYIVVDTAPIGVVI
DAAIITQQCDASVLVTAAGETNRRDVQKAKEQLEQTSKPFLGIVLNKLNTSVEKYGSYGAYGSYGKK
>gnl|bykdb|A0A1E9H6F8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. HMSC061D01] (length=231 residues).
MPSLELAKNKEKTIKKTEEYYNALRTNIQLSGDNIKVIAVTSVQSGEGKSTTSTNLAIAFARSGYNTLLIDADIRNSVMS
GIFKTRDKITGLTDYLAGATDLSNGLCETNIDNLFVIEAGQVSPNPTALLQSKNFGIMIDILRNHYDYIVVDTPPIGLVI
DAAIIAQKCDASVLVVESGNVKRKTLQKAKEQLEQTGTPFLGVILNKYDTQLEKYGSYGNYGNYGNYGKKK
>gnl|bykdb|A0A1E9PDU6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Aerococcus sp. HMSC062B07] (length=235 residues).
MFGRKKKSEIKKPADRPGLVVVDNPTSAMAEQFRTIRTNIQFSMLDKELKTFNITSPGPSSGKSFLAANIAAAFASDDKR
VLLLDADMRKPTVHKTFGVPNDRGLTNLLTDNSLEIHQVIKKSYVPNLFYLTCGAIPPNPSELLASKRMQGLMEQLRNVF
DIIVLDCPPVLAATDAQVVSARGDGTVVVGPYGQCTKDEVKESQALLDKVNTNVLGVIMNRTERTEDYYYYYEEE
>gnl|bykdb|A0A1E9PPM8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Aerococcus sp. HMSC062B07] (length=251 residues).
MFNFKQRKIDKKNKEQRRGVSLITAADPNHVISEQFRTIRTNIQFAIDAYHLKTLMFTSSGPWEGKSTIAANVATTMAHL
DGVRVLMIDCDLRKPTVHKTFDIHSRKGLTTYLTDRDVDYMDVAQYVAEVNTYVIPAGPIPPNPAELLSSQRMSDLLEDV
TAVFDLVIIDAPPLLPVTDAQIIASRTDASVFVLREGVASYQDIQKSKRLLESVDANVIGAIYNGADGQGMNAYYGYGYR
DEDIDSEDLQS
>gnl|bykdb|A0A1E9XYN9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. HMSC034B05] (length=230 residues).
MPRLELAKNKEKALKKSEEYYNALRTNIQLSGENIKVIAVTSVQSGEGKSTTSTNLAIAFARSGYNTLLIDADIRNSVMS
GVFKTRDKITGLTDYLAGAADLSNGLCDTNVENLFVIEAGQISPNPTALLQSKNFGMMIDILRNHYDYIIIDTPPIGIVI
DAAIIAQKCDASALVVESGNVKRKALQKAKGQLEQTGTPFLGVILNKYDTQLEKYGSYGNYGDYGNYGKK
>gnl|bykdb|A0A1F0A4S2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. HMSC061D10] (length=229 residues).
MVKLELAQQKLNSVKKAEEYYNALRTNIQLSGNNLKVIAVTSVDPSEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTDYLAGTQDLSHGLCETDVENLFVVQSGAVSPNPTALLQSANFEKMIETLRKYFDYIIVDTAPIGVVI
DAAIIVQKCDASILVTEAGVAKRREVQKAKSQLEHTGKPFLGVILNKFDIQREKYGSYGGYGNYGEKIK
>gnl|bykdb|A0A1F0B462 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. HMSC057G03] (length=230 residues).
MNTLEISKNKLQEIRKAEEYFNALATNIQLSGVDLKVIAISSVQENEGKSTTSTNLAVAFARAGYKTLLVDCDIRNSVMT
GVFRSRDKIQGLTDFLSGRSQLDQILYATDFPNLDIIESGQVAPNPTGLLQSKNFTVMMDALREHFDYIIVDTPPIGVVI
DAAIIAQRCDGTVLITESGANGRKAVQKAKEQLEQTGTPFLGVVLNKFNIKAAEYGSYGGYGSYGEYGKK
>gnl|bykdb|A0A1F0B4F0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. HMSC077D04] (length=227 residues).
MPTLEIAQKKLDLAKKAEEYYNALRTNIQLSGNNLQVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLVDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSHGLCDTNVENLFVVQAGSISPNPTALLQSENFSTMIDTLRKYFDYIIVDTAPIGIVI
DAAIITQKCDASVLVTAAGEANRKDVQKAKGQLEQTNKPFLGVVLNKFNTSAEKYGSYGEYGSYGKK
>gnl|bykdb|A0A1F0BD56 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. HMSC074B11] (length=227 residues).
MAKLELSQQKLNSVKKAEEYYNALRTNIQLSGNNLKVIAVTSVDPSEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFQSREKITGLTDYLAGTQDLSHGLCETNVENLFVVQSGAVSPNPTALLQSANFERMIETLRKYFDYIIVDTAPIGVVI
DAAIIAQKCDASILVTEAGVAKRREVQKAKSQLEHTGTSFLGVVLNKFDIQRERYGSYGGYGNYGKK
>gnl|bykdb|A0A1F0BI99 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. HMSC078H03] (length=246 residues).
MPLLKLVKSKENFAKQTEEYYNAIRTNIQFSGAQMKVIAVSSVEAGEGKSTTSVNLAISFASVGLRTLLIDADTRNSVLS
GTFKSNEPYKGLSNFLSGNADLNETICQTDISGLDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPIGLVI
DAVIIAHQADASLLVTAAGKIKRRFVTKAVEQLEQSGSQFLGVVLNKVDMTVDKYGSYGSYGSYGEYAKKSDQKEGHSRA
HRRRKG
>gnl|bykdb|A0A1F0BSG0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. HMSC070B10] (length=227 residues).
MPTLEIAQKKLDLAKKAEEYYNALRTNIQLSGNNLQVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLVDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSHGLCDTNVENLFVVQAGSISPNPTALLQSENFSTMIDTLRKYFDYIIVDTAPIGIVI
DAAIITQKCDASVLVTAAGEANRKDVLKAKDQLEQTNKPFLGVVLNKFNTSAEKYGSYGEYGSYGKK
>gnl|bykdb|A0A1F0CJ44 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. HMSC069D09] (length=229 residues).
MTRLEIVDSKLRQAKKTEEYFNAIRTNIQFSGKENKILAITSVREGEGKSTASTSLALSLAQAGFKTLLIDADTRNSVMS
GTFKATGTIKGLTNYLSGNADLGDIICETNVPRLMVVPSGKVPPNPTALLQNAYFNKMIEAIKNIFDYIIIDTPPIGLVV
DAAIIANACDGFILVTQAGRIKRNYVEKAKEQMEQSGSKFLGIILNKVNESVATYGDYGNYGKRDRKRK
>gnl|bykdb|A0A1F0KIB5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. HMSC065E03] (length=230 residues).
MNTLEISKNKLQEIRKAEEYFNALATNIQLSGVDLKVIAISSVQENEGKSTTSTNLAVAFARAGYKTLLVDCDIRNSVMT
GIFRSRDKIQGLTDFLSGRSQLDQILYATDFPNLDIIESGQVAPNPTGLLQSKNFTVMMDALREHFDYIIVDTPPIGVVI
DAAIIAQRCDGTVLITESGANGRKAVQKAKDQLEQTGTPFLGVVLNKFNIKAAEYGSYGGYGSYGEYGKK
>gnl|bykdb|A0A1F0N943 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. HMSC067H01] (length=224 residues).
MAKLELAQQRIDSVKKAEEYYNALRTNIQLSGNNLKVIAVSSVNPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSRERITGLTDYLAGTQDLSHGLCETNVENLFVIQSGAVSPNPTALLQSANFERMIETLRKYFDYIIVDTAPIGVVI
DAAIIVQKCDASILVTEAGAARRREVQKAKSQLEQTGTPFLGVILNKFDVQREKYGSYGSYGKR
>gnl|bykdb|A0A1F0NBW7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. HMSC066E07] (length=231 residues).
MPSLELAKNKEKTIKKTEEYYNALRTNIQLSGDNIKVIAVTSVQSGEGKSTTSTNLAIAFARSGYNTLLIDADIRNSVMS
GIFKTRDKITGLTDYLAGATDLSNGLCETNIDNLFVIEAGQVSPNPTALLQSKNFGIMIDILRNHYDYIVVDTPPIGLVI
DAAIIAQKCDASVLVVESGNVKRKTLQKAKEQLEQTGTPFLGVILNKYDTQLEKYGSYGNYGNYGNYGKKK
>gnl|bykdb|A0A1F0RVL0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus sp. HMSC056D05] (length=248 residues).
MKVSLRSILGRNKIDDETQKNGVMLVTFAEPKHAVSEQLRTVKTNIEFAGAALDRCQVIMFTSSAMSEGKSTVAANVAVT
WAQAGKKVLLVDADLRRPTVHATFRTLNIDGVTTILTGKTTAQEVVEETFVDNLSILTSGPIPPNPAELLNSKRMGELID
WAREKFDIVVLDAPPVLAVSDVQVLVPKTDGVVVIANMGKTLKSDLKRTVEVLKLADAKVLGAVERIKAKRGDKGYGYGY
GYGYGNSK
>gnl|bykdb|A0A1F0S3J0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus sp. HMSC056D05] (length=254 residues).
MSLNKIFNKFTHRNQKDNETQKNGVMLVAFAEPKHVVAEQFRTVRTNIEFAGAALDQCEVIMFTSSTVSEGKSTVSANVA
VTWAQAGKKVLLIDADLRRPTVHATFRTLNLEGVTTVLTGKTKPSDVAEKTFVDNLDIITSGPVPPNPSELLNSKRMAHL
LEWSRTNYDIVVLDAPPVLAVSDVQVLVPKTDGVVVVTNMGKTLKGDLKRTVEVLKLAKAKILGSVERVRASKGDRGYGY
GYGYGYGYQSNDVR
>gnl|bykdb|A0A1F0TGW6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. HMSC062D07] (length=233 residues).
MAKLELSEKRQALVKKAEEYYNALRTNIQLSGDKLKVIAVSSVRPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFMSTEKITGLTDYLSGTKDLSHGLCETNVENLFVIQSGAISPNPTALLQSEKFEVMIETLRKYFDYIIVDTAPIGVVI
DAAIIVQKCDASILVTEASATKRREVQKAKTQLEQTGVPFLGVILNKFNIHLEKYGTYGTYGGYGNYGAYGKK
>gnl|bykdb|A0A1F0Y198 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. HMSC078D09] (length=230 residues).
MNTLEISKNKLQEIRKAEEYFNALATNIQLSGVDLKVIAISSVQENEGKSTTSTNLAVAFARAGYKTLLVDCDIRNSVMT
GVFRSRDKIQGLTDFLSGRSQLDQILYATDFPNLDIIESGQVAPNPTGLLQSKNFTVMMDALREHFDYIIVDTPPIGVVI
DAAIIAQRCDGTVLITESGANGRKAVQKAKEQLEQTGTPFLGVVLNKFNIKAAEYGSYGGYGSYGEYGKK
>gnl|bykdb|A0A1F0ZUP1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. HMSC061E03] (length=230 residues).
MNTLEISKNKLQEVRKAEEYFNALATNIQLSGVDLKVIAISSVQENEGKSTTSTNLAVAFARAGYKTLLVDCDIRNSVMT
GIFRSRTKIQGLTDFLSGRSQLDQILYATDFPNLDIIESGQVAPNPTGLLQSKNFTVMMDALREHFDYIIVDTPPIGVVI
DAAIIAQRCDGTVLITESGANGRKAVQKAKDQLEQTGTPFLGVVLNKFNIKAAEYGSYGGYGSYGEYGKK
>gnl|bykdb|A0A1F1BTN4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus sp. HMSC078E07] (length=235 residues).
MAKRKKEKRKALETPLYVEDNPKSIVSEKVRGIRSNIMFSNAEEIKSVLITSEKPAAGKSIVSANIAITYAQAGYKTLII
DGDMRKPTQHYHFETSNYDGLSNLIIGNSDFDKAIRSTRVKNLDLLTSGPIPPNPSELIASKRFKKIFEHLQKEYDFILI
DTPPIISVTDAQVFLQYVPNCMLIIDAQKNNRNEVKKAKQLVEQADGHVIGAVLNKTAKEKSSSYYHYYGDEIKS
>gnl|bykdb|A0A1F1CGI6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. HMSC072G04] (length=230 residues).
MNTLEISKNKLQEIRKAEEYFNALATNIQLSGVDLKVIAISSVQENEGKSTTSTNLAVAFARAGYKTLLVDCDIRNSVMT
GIFRSRDKIQGLTDFLSGRSQLDQILYATDFPNLDIIESGQVAPNPTGLLQSKNFTVMMDALREHFDYIIVDTPPIGVVI
DAAIIAQRCDGTVLITESGANGRKAVQKAKDQLEQTGTPFLGVVLNKFNIKAAEYGSYGGYGSYGEYGKK
>gnl|bykdb|A0A1F1DER6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. HMSC072C09] (length=230 residues).
MNTLEISKNKLQEIRKAEEYFNALATNIQLSGVDLKVIAISSVQENEGKSTTSTNLAVAFARAGYKTLLVDCDIRNSVMT
GIFRSRDKIQGLTDFLSGRSQLDQILYATDFPNLDIIESGQVAPNPTGLLQSKNFTVMMDALREHFDYIIVDTPPIGVVI
DAAIIAQRCDGTVLITESGANGRKAVQKAKDQLEQTGTPFLGVVLNKFNIKAAEYGSYGGYGSYGEYGKK
>gnl|bykdb|A0A1F1EHT0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. HMSC071H03] (length=231 residues).
MPSLELAKNKEKTIKKTEEYYNALRTNIQLSGDNIKVIAVTSVQSGEGKSTTSTNLAIAFARSGYNTLLIDADIRNSVMS
GIFKTRDKITGLTDYLAGATDLSNGLCETNIDNLFVIEAGQVSPNPTALLQSKNFGIMIDILRNHYDYIVVDTPPIGLVI
DAAIITQKCDASVLIVESGNVKRKTLQKAKEQLEQTGTPFLGVILNKYDIQLEKYGSYGNYGNYGNYGKKK
>gnl|bykdb|A0A1F1EMW9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. HMSC062H02] (length=230 residues).
MPTLEIAHKKLDQARKAEEYYNALRTNIQLSGNNLKVIAITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEYLSGTTDLSQGLCETNVENLFVIQAGSVSPNPTALLQSENFATMIDTLHKYFDYIIVDTAPIGVVI
DAAIITQKCDASVFVTAAGETNRRDVQKAKEQLEQTSKPFLGVVLNKFNTSVEKYGSYGAYGNYGNYGKK
>gnl|bykdb|A0A1F1HDF1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. HMSC064H09] (length=246 residues).
MPLLKLVKSKENFAKQTEEYYNAIRTNIQFSGAQMKVIAVSSVEAGEGKSTTSVNLAISFASVGLRTLLIDADTRNSVLS
GTFKSNEPYKGLSNFLSGNADLNETICQTDISGLDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPIGLVI
DAVIIAHQADASLLVTAAGKIKRRFVTKAVEQLEQSGSQFLGVVLNKVDMTVDKYGSYGSYGSYGEYGKKSDQKEGHSRA
HRRRKG
>gnl|bykdb|A0A1F1JT30 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus sp. HMSC25A02] (length=254 residues).
MNLSFDRILNRHKEDQETQKNGVMLVTFAEPKHVVSEQFRTVRTNIEFAGAALDTCQVIMFTSSAMSEGKSTVSANVAVT
WAQAGKKVLLIDADLRRPTVHATFRTLNVDGVTTVLTGKEKADDVVEETFVNNLSIITSGPVPPNPSELLNSKRMASLVD
WAREKYDIIVLDAPPVLAVSDVQVLVPKTDGVVVVANMGKTLKGDLRRTVEVLKLAKAKILGSVERVKAKRGDRGYGYGY
GYGYTSDSGRTSGI
>gnl|bykdb|A0A1F1LBJ3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. HMSC19A10] (length=215 residues).
MLIVESRPKSAEAEAYKTLRTNVQYSSISKKIKTLLVTSADSKDGKSTVCSNLGVTFSQNGQSVIILDCDFRKPSIHKFF
NISNSAGITDILLGEEKLEETIQHYNSNTDILTAGNIPPNPSEILGSQSMINLLSFLSERYDIVIIDSPPVGVVTDAQII
SASVDGTLVVIRAEETKAKRVTEAVNLLKKVDANIIGMVLNEAQTINKSYSDYYV
>gnl|bykdb|A0A1F1LR85 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Abiotrophia sp. HMSC24B09] (length=232 residues).
MEQVEPRLNKKLISPEAEEYYNAIRTNILFSGKDIKVIAITSTKDNEGKSTVAMNIATSLAALGKRTLLIDADTRNSVFV
GRMKIRSKVVGLTHYLAGEATVKEIVFGTTEPNLHMILSGPVPPNPTALLQGDSFQELIDVCRHHYDYVIVDTPPLGLVT
DASIVAHQCDASILVVEAGAIKRRAVKKIQELLEHTGAKFLGVILNKVDLKASHYGAYGSYGNYGNYGKKAE
>gnl|bykdb|A0A1F1MF04 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus sp. HMSC068D05] (length=231 residues).
MTKKNEKRKNLSTPLFTEDNSKSIVSEKVRGIRSNIMFSGVEEVQSIIVTSEKPAAGKSIISANIAITYAQAGYKTLIID
GDMRKPTQHYHFETTNYDGLSNLIIGKSNFDKSIIKTRVKNLDLMTAGPTPPNPSELIGSGAFENILRDLNEIYDFILID
TPPIISVTDAQVYLRFVPNCVMVIDVQNNNKNEVKKAKELIEKVGGRVLGAVLNKTPKEKSSSYYYYGDDE
>gnl|bykdb|A0A1F1N9N0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. HMSC072D03] (length=248 residues).
MPLLKLVKSKADFAKKTEEYYNAIRTNIQFSGANFKVIAVSSVQPGEGKSTTSVNLAISFASVGLRTLLIDADTRNSVLS
GTFKSNEPYKGLSNFLSGNASLGEVICETDVPGLHVLSSGPVPPNPTSLLQNDNFVQLLEIVRAQYDYVIIDTPPIGLVI
DAVIIAHQADASLLVTAAGRIKRRFVTKAVEQLQQSGSEFLGVVLNKVDLAIDKYGSYGSYGSYGSYGEYGGDKHTENKS
RKHRRKRG
>gnl|bykdb|A0A1F1QIA9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus sp. HMSC08B12] (length=260 residues).
MGLFGRKNHLDNETIKNGAKLITLANPQSVISEQFRNIRTNINFMNVDKEVKTIAFTSAMASAGKSTVSANVSITMAQAG
KKTILIDADLRRPTLHSTFNVSNSNGLTTLLTSRSKEMDANSVIRKSGVENLSILTAGPIPPNPSELLSSKHMLDLIEDL
KQEYDMVVLDLAPILDAAETQQLTSSLDGTILVVRQAYSQKSAVKRAVELLKLTKSPILGYVMNDVDADGDGGYGYGYGY
GYGYGYGKEKEKKGLFGRKK
>gnl|bykdb|A0A1F2EQC8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Aerococcus sp. HMSC10H05] (length=237 residues).
MNAEQRRGASLITVTQPKDTISESFRQIRTNIQFSMVDHNFKSIMFTSSGVWEGKSTVTANTAAVMAQQGLRVLLVDADL
RKPTVAKTFNINTTVGLTSLLTDREASIMDTVNYVADANIYVLAAGPIPPNPSELLGSNRMAELIDELEEMFDLVIFDTP
PILAVTDAQIVATRVDGVIVVVRSGIANKNDVRKTKELLDVVNANVIGAVYNGEDVSKVGYGYGYGYGYGYGQTDTD
>gnl|bykdb|A0A1F2GBJ2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. HMSC10A01] (length=231 residues).
MPVLELSNNKKQSIQKTEEYYNALRTNIQLSGEDIKIVAVTSVQPNEGKSTTSTNLAIAFARAGYTTLLIDADIRNSIMS
GVFKSKERITGLTDYLVGKNDLSQGLCETDVPNLFVIESGQSSPNPTALLQSKNFDEMMNILRRHYDYIIVDTPPIGLVI
DAAIISQKCDASLLVAEAGSVKRKALQKSKEQLEQTGTPFLGVVLNKYDVSGDRYGVYGAYGNYGAYGKKH
>gnl|bykdb|A0A1F2HLC6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. HMSC10E12] (length=246 residues).
MPLLKLVKSKVNFAKQTEEYYNAIRTNIQFSGAQMKVIAISSVEAGEGKSTTSVNLAISFASVGLRTLLIDADTRNSVLS
GTFKSNEPYKGLSNFLSGNADLNETICQTDISGLDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPIGLVI
DAVIIAHQADASLLVTAAGKIKRRFVAKAVEQLEQSGSQFLGVVLNKVDMTVDKYGSYGSYGSYGEYGKKSDQKEGHSRA
HRRRKG
>gnl|bykdb|A0A1F2JAT8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus sp. HMSC13A10] (length=230 residues).
MSNVRRKYPKLIVNEQPKSPISEKFRGIRSNILFASADDPIKSVVVTSDGPGSGKSTTSANLAISFAQAGYKTILIDGDM
RKPTQHYLFKLSNNEGLSSLLLKWSDYESAIQSTHIEGLDVLTSGPIPPNPSELITSRSFKNMFDHISEKYNFVIIDTPP
VNVVTDAQLFSNYTQHAVYVVNVESNNKEEVKKGKQLLEKSGSKIIGIVLNKAPQEKNSKYYAYYGDDKS
>gnl|bykdb|A0A1F2PKV6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Acetobacterium wieringae] (length=269 residues).
MQKTIVTHLTPKSPVSEAFRNMRTNILFSDIDNERKVLAITSSGGSEGKTTILANYGVTLCQSGKRVLIVDCDLRKPQVH
RRFELDNTTGLTNLLLKEIKTVDAFRRIEVPNLFAISAGPIPPNPSEILASRRMAEVIAELKLHFDYILLDTPPLGMVTD
AAVLNPVVDGYIVLASLGSVHRDGLLHVLDTLSKINAHVVGIVANKVPVSKRFSKYGYYSAYGYYGDESKSDKKAKKEKK
RWGKAISKPSSEPMIEQNFEQKAEPVSID
>gnl|bykdb|A0A1F2PM96 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Acetobacterium wieringae] (length=227 residues).
MDSQNLITLSDPTSFITESYKLLRTNLNFKNLNNRYQVMLVTSAGKEEGKSTTISNLAVTFAQADKRVLLIDADLRLPQI
STIFNINKRKNGLSNMLVDELPLESLVNKIEKLEKLEILTAGNKHVSPTELLNSEAFGTFIKKCREEYDVILIDTPPVLS
FADASIISNVVDGVLLVIAAHSTKKATIIEAKKNLDKVGAAVIGVILTKVKFKKNANYYRYNADKAK
>gnl|bykdb|A0A1F2YCV8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Alicyclobacillus sp. RIFOXYA1_FULL_53_8] (length=239 residues).
MPKKMNRTHLITHLLPQSPVSEAYRLLRTNIDFASFNQTRKVLVVTSTVKGEGKTSTCANIAIVYAQTNKKVLVIDADMR
NPQCQYVFSASNLSGLSNYLARESNLEACIVKTHLPNIHLLPAGSIPPNPAELLTSEYFEALISAVRALYDMVIIDTPPV
LPVADAVIISQQVDGVLFVLDSQTTNRFLAERAMNIVRKSQTPILGVILNRLPKRDERYAYDSYYPGPGSGSIKSGNEV
>gnl|bykdb|A0A1F8U475 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridiales bacterium GWB2_37_7] (length=242 residues).
MSYKNSLIVHADPKSPIAEAYRVLRTNIQFASVDKPIKTIVVTSSTPGEGKTTTIANLAVTFSQSGSRVLLIDADLRKPR
VHKAFDLTNIHGMTTVLAEQRDYKTCINKTDIENLFVLTSGPIPPNPSELLSSNAMKKFLEALCNDFDMILIDAPPVGVV
TDAAILSTIVDGTILVVSSGNVEIDAAQRAKLLLEKVNAKLLGVVLNKITKENQGGRYSYDYYYADDYDNEKNNNHKQKK
KH
>gnl|bykdb|A0A1F8V4Q2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridiales bacterium GWF2_38_85] (length=226 residues).
MADNIKDTAELQSINLFAVQESYKTIRTNIFLSVIKEGCKRIVITSSLPSEGKTTTSMNLAISMAQAYMKVLIIDCDLRK
SKIHKVLNIPNVPGLTNVISGMEKYSVAIRETKYTGLHVLTAGLQVPNPSEILASEYTARLLDELSKEYDYIILDSPPLN
IVADALPLVRISDGVVLVVKQNQTTHNDLKKAIDSLEFINAKIFGIILNGVEDINKKYYKYKYKYK
>gnl|bykdb|A0A1F9ZNS6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Firmicutes bacterium GWF2_51_9] (length=248 residues).
MDQAARGKGYGYSADLSEAFRHLRTNIEFSNFEKKIKVISIVSAKPTEGKSTVAANLAVVMAGQHPRVLLIDCDLRKPVV
HKMFHASNKSGLSNLLLESSFEPGVFNKYCQQIMHPHITNELFLITSGPVVPNPSEMLSSKKFKDLIASLRNSFDIIILD
GPPVLPVPDSIPIGLTADGTLFVIASEQTEKEAAQIAVTTLRRSNVNLLGTVLTMIKKESSSYQYSYTAYRETHPKKSMF
KKKKEKLD
>gnl|bykdb|A0A1G1SM37 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Exiguobacterium sp. SH31] (length=231 residues).
MFLRKKNDNLPDYGQRDLITLANPKSPISEQYRTIRTNLEFTSIGQKLQMINVTSASTGEGKSTTAANLAVVYAQLGKRV
LLIDCDLRKPTAQFTFNLSSQAGLSTILVGRILLERAIQKTGVERLSLLTAGPIPPNPTELIASNQMVELLDEVRRQYDI
VILDAPPMMQVADARLLAKIADGTILVIGCENSERQLVVKAKEQLERTGTHMLGLVLNKRKSRRHKYYAYE
>gnl|bykdb|A0A1G1UHW1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. RZ2MS9] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDRERENGLYYYYGAN
>gnl|bykdb|A0A1G4FHZ1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Sporanaerobacter sp. PP17-6a] (length=247 residues).
MARSKIITYENPKSPTAEAYRTLRTNIQFSSIDKTIKSIVVTSFGPGEGKSTVTVNTAVTMAQAEKKVLLIDCDLRKPKV
HTFFRIHNGEGLTNIIAGNLDYNEAIKTTEIVSGLDIITSGPIPPNPAELIGSQKMKNFLNRVKEDYDIVLVDASPVGMV
TDAAILSSIVDGTIFVCAVGETDVEGAKSTKALLNKVNANILGVVLNKVPIKERGGYYRYQYYRYSYYNDDSGRKGKRVK
KRRKNND
>gnl|bykdb|A0A1G4L888 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLYFLACGPIPPNPAELLGSKSMQELLAQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A1G4TB59 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus tianmuensis] (length=226 residues).
MSRSVKRRPVIAHSHPKSPISESYRTLRTNIQFSSVDRLYRTLMITSSSPMEGKSTTINNLAVVYAQSNKKVLLIDADLR
KPTAHHTFHLSNRFGLTDMLTSQCTLDVAIKVTDIPNLEVMTSGSIPPNPSEILASQKMTGLLEELKRQYDIVLLDTPPV
LAVTDAQIIAAKCDGVILVIDSGKIKRDLAQKAKNALELVQANLLGVVLNRIARPSGNAYYYYGNE
>gnl|bykdb|A0A1G4V2K8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcaceae bacterium P7] (length=246 residues).
MKIKLKRTDKKEDKQKKKTTPETETLSENTKFAIVESYKSARSNIMFSLSAEDQKAFAVTSHSKGEGKSTVSSNLAISFS
KMERRVLLIDCDLRRPNVHNIFKLENKVGLSNVIGKMAEFEDVVKRDVLPCLDILTSGTIPPNPSELICSPRFDKLLKRV
SDDYDYIIFDTPPIGVVSDALLLKDKLAGYVIVLRERSTTHGDIQKILESIKLADTKILGFVKVGCTHGKKRSGKGYYYY
QYYTYY
>gnl|bykdb|A0A1G4VBJ6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcaceae bacterium P7] (length=242 residues).
MAKKTDRKRSDNLINMDAVAFQIRESYKAARTNIVYSIIKKGCKKISFTSANKGEGKTVTSVNVAIALAQQVNTRVLIID
CDLRRPQIHNALSLEPSPGLTNYLNGECEKEEMIRTTKISNLFAVTYGAVPPNPSELLSSSGMQEFVKTVEKDYDYIIFD
TPPVGVVVDSLPLVKQSDGVVLVVKHNSTTYPALKKVIDVLNRNGGKILGIIVNNVESVKTKKFGKGGKGYGYEYGYGYG
YY
>gnl|bykdb|A0A1G5CFX5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Butyrivibrio sp. INlla14] (length=275 residues).
MQNAKLHFSQSENNYQIKEAYKTLRSNIEFSGQNVKVVSITSCTPGEGKTTVAMALARAFAEAGKKTVLVDADMRKSVLV
GRYKTGSVRLGLTHCLVGRERLSSVICETDTPNLYVIFSGPVPPNPSELLGGRIFGKALENMKQVFDYIIIDTPPLGSVI
DAAVVAKQCDGTVMVIESNAISYRFAQRVKDQLDKAGAKMLGVVLNKVDITGKGYYGHYGSYYGKYYGKYYGKYYGKYGE
DNIEVPSKPKASVEKEPSDDDLDELNYLAGVMRKD
>gnl|bykdb|A0A1G5CUP2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus bromii] (length=266 residues).
MKIKLFNNDKSKQNKKSKQDASNKTTSKHSSSEHDKSKQSKSGSSSMAISDKSKFAIVESYKLARTNIMFSLSAYDKKVF
AVTSHSKGEGKSTVSANVAISFSKLEKRVLLVDCDLRRPNVHNIFNVDNKTGLSNIIGNMVTFEDTVHRNVLPNLDAISS
GTIPPNPSELLCSPRFVNMIKRLTDEYDYIILDTPPIGVVSDALLLKDLIAGFVIVIREGSTTHGDIRELLDSIKLADSK
VLGMVKVGCDVSKRKKGRGYYYYQYY
>gnl|bykdb|A0A1G5DYV4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Butyrivibrio hungatei] (length=277 residues).
MQTAKLHFSQAENNYQVKEAYKTLRSNVEFSGQNVRVISVTSCTPGEGKTTVAMALARAFAEAGKKTILVDADMRKSVLV
GRYRTGSVRLGLTHCLVGRERLSSVICETDTPNLYVIFSGPVPPNPSELLGGRIFAKALENMKQVFDYIIVDTPPLGSVI
DAAVVAKQCDGTVMVIESNSISYRFAQRVKDQLDKAGAKMLGVVLNKVDINGKGYYGHYGHYYGKYYGKYYGKYYGKYGE
GEAMQVTRPKAQETVAEPDDDDLDELNYLAGVTRKDR
>gnl|bykdb|A0A1G5J256 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia sp. SF-50] (length=241 residues).
MIKVKLSNWKSDHQMDEAYKALRTNIQFCGADKKVIALTSCTPNEGKSSVAFNLAASLAESGKSVLLIDADLRKSVLMGR
VTVDQEVMGLAHYLSKQAKLSDVICATTLPKFHIIFSGIVPPNPAELLGNRLFKDMIRVVRDVYDYVIVDTPPLGLIIDS
AIIADSCDGSVIVVESGTISYHFVQDVRDQLAKSNCPILGTILNKVDYSKAGNYGHYGKYGKYGKYGKYGSYGDYGESSS
K
>gnl|bykdb|A0A1G5RRJ6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Acidaminobacter hydrogenoformans DSM 2784] (length=245 residues).
MDKLIVRASPKSPVSEAYRTLRTNIQFSNLDHELKSILFTSAMAGEGKTTTIINLGIVVAKSGKRVLIVDSDLRKPTIHK
HFEMVNIRGLSELLLEDGEPTDYIVKSSVEGLDLLLSGTIPPNPSEMLGSRRMMILTEKLRREYDLIFFDAPPVGIVTDA
QILSTIVDGTILVLAAEKTDKREALYAVSLLENVNCKLIGTVLNRIPMKESGYYQYRHRAYYDQNDDETKGIRGLLLRMR
RFYQK
>gnl|bykdb|A0A1G5VSA8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Butyrivibrio sp. INlla18] (length=277 residues).
MQTAKLHFSQSENNYQIKEAYKTLRSNIEFSGQNVRVISVTSCTPGEGKTTVAMALARAFAEAGKKTVLVDADMRKSVLV
GRYRTGSVRLGLTHCLVGRERLSSVICETDTPNLYVIFSGPVPPNPSELLGGRIFSKVLENMKQVFDYVIIDTPPLGSVI
DAAVVSKQCDGTVMVIESNAISYRFAQRVKDQLDKAGAKMLGVVLNKVDISGKGYYGHYGNYYGKYYGKYYGKYYGKYGD
DAEISSGSGRPKTPEADLPDDDDLDELNYLAGVTRKD
>gnl|bykdb|A0A1G5X7B0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus kefiranofaciens] (length=261 residues).
MSLFKKKRGTDEAIKKGAKLITVADPKSPVTEQFRTIRTNINFMAVDHDIKSVAFTSASISEGKSAVAANVAVTYAQAGH
KVLLIDADLRRPTVHRTFNLSNHVGLSTVISSTAKEVDLDEVVQDSGIADLAILPAGPTQPNPSELIGSKRMQDFISLVE
DHYDMVIIDLAPVIEVSDTQELARRLDGIILVVRQGKTQKAAIKRAVEMLNFSKAKVLGFIMNDISSDNAGYGYGYGYGY
GYGYGEEDAKKKKGIFSRLKK
>gnl|bykdb|A0A1G6ANM6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Butyrivibrio sp. INlla16] (length=287 residues).
MQQTTLHFSESENNYQIKEAYKTLRSNVEFSGQDVRAVSVTSCTPGEGKSSVSMALARAFAEAGKKTVLVDADMRKSVMV
GRYKTGSVRLGLTHCLVGREKLSNVICETDTPNLYVIFSGPIPPNPSELLGGQIFSKILDNMKNVFDYIIIDTPPLGSVI
DAAVIAKQCDGTIMVIEDNAISYRFAQKVKSQLDKAGAKVIGAVLNKVDMTGGVYGHYGRYYGRYYGKYYGKYYGKNDSY
SDGSMTGGKPGRIMQPQVKSERPAPSSTAAKGNLDELDYIEGVVRKD
>gnl|bykdb|A0A1G6D9Y7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus henryi] (length=239 residues).
MSQFELVRAKAQMFNKTEEYYNSIRTNIQFSGRDLKVLTLTSFQPGEGKSTTSVNLAVSFANAGFRTLLIDADTRNSVLT
GTFKANGSYQGLTSFLSGNAELSDVIGDTNIPNLMIIPAGQVPPNPTSLLQNQYFHQMIETIRGLYDYIIIDTPPIGLVI
DAAIIAHNADASIIVTEAGSIKRRFIQKAVEQLEQSGTQFLGVILNKVDQTTDRYGSYGAYGDYGNYGKPNKKAKSKNN
>gnl|bykdb|A0A1G6GGK3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pelagirhabdus alkalitolerans] (length=229 residues).
MAKRKKQVNQTMRHLITSLNPRSPISEQYRTIRTNLQFAAVDEDLSTMLVTSAGPSEGKSSTVANLAIVFSQQEKNVLLV
DADLRKPTVHYTFRADNRRGLSSVLVGELSLAEAFTKSEHDGLDILPSGPIPPNPSELLGSKAMTKLIEEAKRYYDFIIF
DTPPVLAVTDAQILANQVDGSLLVVRSKQTDQEAALKAKELLEPAQSKLLGSVLNDVELTKNQYYYYGE
>gnl|bykdb|A0A1G6IK19 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Terribacillus halophilus] (length=230 residues).
MAKRKKQFKTNVRSLITKQNPKSPISEQFRTIRTNVEFASVDEKIQSMLVTSSGPSEGKSSITANLAIVFAQQGKKVLLI
DADLRKPTTHYTFKMDNRVGLSTVLIGEKTLEEAAQETDVPNLDLLTCGPIPPNPSELLGSNAMKRLLEIAEEVYDMVII
DTPPVLAVTDAQILANICDGSIIVARSEQTEYDSLLKAKELIEPAKAKLLGVVLNDVAQKHSNTYYYYGN
>gnl|bykdb|A0A1G6QK37 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus aryabhattai B8W22] (length=236 residues).
MVRKKKNSKNDKVLTLKRRLLAHNSPKDPVAEQYRTIRTNIQFSGADEEIKSLVLTSSGQAEGKSTTAANLAIVYAQQGL
KVLLIDADLRRPTSHYTFRLENHTGLTNVLTRQSTLGQALQNTEVPDLYLLTSGPIPPNPSELLASNQMKEMLSEAKQQF
DMVIFDTPPILAVADAQILANQVDASILIVSSGKTEKDAALKAKELLTQAKSKLLGAVLNDRKIEEGNYYYYYGSN
>gnl|bykdb|A0A1G6RVZ0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Marinilactibacillus psychrotolerans] (length=232 residues).
MLFKKKRDTNLNERPGLVVLNRPTSVVSEQFRTIRTNIQFSMIDDTLKTIVVTSAGPSSGKSTVAANLSATLASDDKRVL
LVDADLRKPTVHKTFNIRNSEGLTKLLTDRMTKLEDVIYRTHTEGLYLLTSGAIPPNPAELLSSKRMGEVIEEMGHYFDM
IVFDMPPVLAVTDAQVMASKVDGVLFVIPKGEVSKDQVFKSKELLENVKANILGAVLNKVDKTDDYYYYYGE
>gnl|bykdb|A0A1G6Z8U5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bhargavaea beijingensis] (length=238 residues).
MARRKQSSKKQLEQRARKLVVSANPRSVVSEQFRTLRSNITFSAVDKELKTILVTSALPGDGKSTVSANLATLFAQDGKR
VLFIDADMRKPTVQYTFSLTNAAGLSSVLTQQRLAGEVIRESEISPNLHILTSGPIPPNPAELLGSRSMTVLMNEMAQQY
DLIVFDAPPVLSVTDAQILANKVDGTLLVVNTGITEKENVKKAKELLGNAQARILGAVMNNFEMDKDQNYYQYYGTEE
>gnl|bykdb|A0A1G7NC16 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Sporolituus thermophilus DSM 23256] (length=225 residues).
MSTKRKLIVHEDAKSPIAEAYRTLRTNINFAKMGGELRSILFTSAGPGEGKSTTVANTAVALAQTGKRIIIVDCDLRKPV
QHKIFGKKNRGVTNYLVEDTPIDGLLQETGIENLLLLPSGPIPPNPSELLGSPRMQELIAYLQSRADMVIIDAPPVIAVT
DACVLASKVDGVILTIASGLVRPEMAKHAKELLIKANGHILGVILNRMEIEEEHAYYYYYYGSER
>gnl|bykdb|A0A1G8EVY2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Desulfosporosinus hippei DSM 8344] (length=233 residues).
MAFSLITHEQTKSPISEAYRTLRTNVQFTSVDTKTKKIMITSSGPREGKSTTVANLAVSIAQSGKSVLVIDADLRNPTQH
KLFELGNLEGLSTFLVQDDQEKDFIKETPVPGVKVLTGGPIPPNPAELVGSQRMRRLIEEVSEQFDVVLIDTPPIIAVTD
AAVLAQEVDGVILVLASGEVNKEYAQRAKDQLDKVGAKILGAVINKADLKTSEYYYYYYYHGSDDPKKKKKKS
>gnl|bykdb|A0A1G8J9H1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planomicrobium glaciei] (length=231 residues).
MWTQKKSKGSATRKLVGHTKPQALVNEQYRTIRTNINFSLPGDDTKTILFTSAAKEEGKSTTSCNMAIVFAEAGKRVLLV
DADMRRPTLHHSFQLSNKIGLSNLLLKKGRLQDCVKRSGVVGLDLLLCGQIPPNPAELLSSPALDDLLEEMKARYDLIII
DSPPLLAVTDSKILANKCDATVLVVNTGKTEKDSVKKARDALVTSKAFILGVVMNNYELTKENYYYHNYNS
>gnl|bykdb|A0A1G8K9M4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Proteiniclasticum ruminis] (length=236 residues).
MKSNLVTLTDSKSVAAEAYRTLRTNIQFSSYDQEVRVITVTSSRPAEGKSTVACNMAITFAENGKKVLLVDTDLRRPTVH
KKFKLPNSLGIVNVIMNMEMLHEVVHHDVTEGLDIITSGVIPPNPSELLGSRKFQRFIDEMRDQYDTIILDSPPLLAVTD
AQVLTTLSDGTVVVAQHGVTKKDEISQAKDLLEKVKGNILGVVLSQIPPEDNGYYYYYSYEDKKTAAAKNPRRSKK
>gnl|bykdb|A0A1G8KFY9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Natribacillus halophilus] (length=230 residues).
MFKKQPRQISKRRSLITRENPMSPISEQFRTIRTNIQYAAIDQDMQVIMTTSSGPAEGKTTINANLAETVGQQEEKVLLV
DADMRKPSVHYMFYLANHTGLSNIITKQRDFADVVQSTSNEALDVLTCGPIPPNPSELLGSQTMKHFINEARALYDYIII
DTPPVLAVTDAQIVAGISDGVILVVDSGHTEKEDARKATELLKQSNAKMLGAVLNRQERKTSNYMYYYGG
>gnl|bykdb|A0A1G8PPU0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Alteribacillus bidgolensis] (length=233 residues).
MGLKFKKKKDTLKKRAVITHENPKSPIAEQYRTLRTNLQFASVDKELESLLITSPGPFEGKSLTAANVAAVFAQQGKKVL
LVDADLRKPTIHYTFQVANTTGLSSYLVNDLSLTNVVQNSGIDNLYLLSSGPVPPNPSELLSSKQMKKMMTEANQHFDLI
IFDTPPVLAVTDTQILSNDVDGVLLVIRSKQTESEAAKKARDLLKQSHANILGAVLNDQSTKDSNYYYYYGNK
>gnl|bykdb|A0A1G8RQB0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus typhae] (length=228 residues).
MSQQPNKQRHLITVTNPRSPVSEAFRALRTNIDFSSVDERIQIIMVTSSGPEEGKSTVTANLAAAYAQADKKVLLIDGDL
RKPTAHKTFSLSNRYGLSSLLSQQSELRDVIQESGVPNLSIMTSGPIPPNPAEMMASNRMSMVLQELRQQFDVIMFDTPP
LLAVTDAQIVASKSDGVIMVVSYGKVKREIAAKAKANLDRVGAKMLGVVLNNVKRKASEGYYYYYYGN
>gnl|bykdb|A0A1G8TY93 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lachnospiraceae bacterium G41] (length=248 residues).
MQELSLKQKKLDFRTQEAFKTLRTNIEFSGSDVKTVFFTSTTPDEGKSTVSFELAVSFAQAGKKTLLVDADLRKSVMKSR
YKKGRVQFGLSHFLIGRVQFEDVVCSTDVPNFHLVFAGPVPPNPSELLGSERFVRFMDQAKELYDIIIVDTPPVGSVIDA
AIVSKQCDGGILVVKSGNISYRFARKSLEQLEVAGCKILGCVLNEVALNSKGYYGKYYGRYYGRYYGKYYGKYYGSYYGN
YGNNEEEE
>gnl|bykdb|A0A1G8XAA8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus casseliflavus] (length=235 residues).
MMAKKQERTGTQTHAVSLITLIDPSSPISEQYRTIRTNIQFASSADKQIKTIVVTSSGPGEGKSTTSANLAVVFAKSGQR
VLLVDADMRKPTVYKTFSLNNASGLSTVLSTSTSVLEAAQKTVIDNLSVLTSGPKPPNPSELLGSARMNQVMEEAKNLYD
VVIFDMPPVVAVTDAQIMASKADGTILVVRENVARKESLTKARDLLNMVQARIIGVVYNGAEHSKDSGYYYYYGN
>gnl|bykdb|A0A1G9BKT0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Alkalibacterium thalassium] (length=233 residues).
MIFNKKKKVETADRPGLVVVNKPSSAVSEQFRTIRTNVQFSMVDETLRTIVVTSAGPASGKSTVSANLAATFASKEKKVL
LVDADLRKPTVHKIFKVRNNDGLTTLLTDRKANLEEMIYRTHSEGLYILTSGAIPPNPAELLSSKRMEEIKQEMLDYFDL
IIFDMPPLLAVTDAQVMASKTDGVLFVIPKGQANKDEVFKAKDLLEKVQANVLGAVLNRVDKSDDSYYYYYGE
>gnl|bykdb|A0A1G9HCV3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Sarcina sp. DSM 11001] (length=241 residues).
MNTKAIIGVNPKLPYAIEEAINRLRINVSFFGTDIRKIMIVSSEPNEGKSFIAMSLWKQMALAGEKTIFVDCDMRKSVLV
EQYQIEREDGKDLWGLSHYLSDNKKLEDCILTTDLPDGDILPNANNIVNPSMLLESRRFSELLDILAERYRYVFMDVPPL
GLVSDAERVGYFCDGAILTVRSGETPRSIIRSSISQLERAGCPILGIALNRVGASSGKYYGGYYGRHYGSKYYTDKYYTS
K
>gnl|bykdb|A0A1G9IPL3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus equinus] (length=252 residues).
MPTLELAKTQAEMIKKLEEYYNSIRTNIQFSGRNLKVIALTSAQPNEGKSTTSANLAISFARAGLRTLLIDADTRNSVMS
GTFRSKESYDGLTSYLSGNAELSDVICNTSVDNLMVIPSGKIPPNPTSLIQNDNYERMIETVRDLYDYVIIDTPPLGRVV
DAAIIAHSSDASLLVTKPGVDKRRTITKQKDQLEQSGSVFLGVILNKFDFKADKYGYGYGYGYGGGYGYGYGSYGKDEKE
KSDKSSRKKAKK
>gnl|bykdb|A0A1G9ISY4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium cochlearium] (length=248 residues).
MRISELISIKDPKSPVAEAYRTLRTNIKFSSFDKKVQSIVITSSGTGEGKSTTAANLAIVMAQSGSKTIIIDCDQRRPNV
HKLFGISNEVGLSNFIVGSIGLDEVIQKTEVENLHILPSGTRPPNPSELISSNRMMEFVEELKKEYDYIILDSPPVIPVT
DAQLLANYADGCLLVVSSGEVEKEAVIKAKDLLNKVNANIIGIVLNKLEVREKGYYGYYYHYYYGEDGRKVKKKCKNRKD
TRSQSATV
>gnl|bykdb|A0A1G9PI16 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Romboutsia lituseburensis DSM 797] (length=240 residues).
MPKLITIKNPKSPISEAYRGIRTSIQFSDLDKEMKVITVTSSKQNEGKTTVITNLATTFANLDKKVLVIDGDLRNPGVHR
MFGISNLHGLTDVLVDNTTFVDCVNCTDTKNLHVLTCGVVPPNPSEMLASQRMKEFIDNLKDNYDYIFIDAPPIGIVTDA
GVISSYSDGCILVIGANETDIETAKLAKERLDSVGAKIIGTVLNKFAVKTNGHDYYAYYYQGRKSKKANRKMNKKEKSMA
>gnl|bykdb|A0A1G9S7M9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus jilunlii] (length=228 residues).
MSQQPSKQRHLITVTNPRSPVSEAFRALRTNIDFSSVDEQIQIIMVTSSGPEEGKSTVTANLAAAYAQADKKVLLIDGDL
RKPTAHKTFSLSNRAGLSSLLSQQADLEDVVQDSGVANLSIMTSGPIPPNPAEMMASNRMSAVLQELRQRYDMILFDTPP
LLAVTDAQIIASKSDGVIMVVSYGKVKRDIAAKAKANLDRVGAKMLGVVLNNVKRKASEGYYYYYYGN
>gnl|bykdb|A0A1G9TSD4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lachnospira pectinoschiza] (length=232 residues).
MQTINIERLIKLDYRANESYKNLRTNIQLCGSDIKTIMFTSTTPGEGKSTVSFNLAVSLAEAGKKVIFIDADLRKSVLVG
RYKINKSVKGLTHFLSGINKFEDVMYGTNVDNLNVVFSGPVPPNPTELLGNKVFKTLLKVLRDLYDYIIIDTPPIGSVID
SAIVAQECDGTVVVVGSNMVGYKYAQKAIEQLKKTNTTILGAVLNKVDVNDNKYYGKYYGKYYGRYSDAGEE
>gnl|bykdb|A0A1G9U893 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Sediminibacillus halophilus] (length=230 residues).
MARRKKLSRSNIRHLITKMNPRSPISEQYRTIRTNLQFAAVDEELKTMMVTSSGPSEGKSSTVANMAIVFAQQGKSVLLI
DGDMRKPTLHYTFRMDNRFGLSNVLVGEKSLGESVVQSDVPNLDLLSCGPIPPNPSELLGSKAMERMLEEASGRYDLVIF
DTPPVLAVTDAQILANLCDGALMVVRSKQTEYEAAQKAKELLQPAKAKLLGVVLNDLEQKKGHYYYYGTN
>gnl|bykdb|A0A1G9W0Y6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Megasphaera paucivorans] (length=245 residues).
MAEIDLITQYNKKSPVSEAYRAIRTNLQFAGAGKPLKLISFTSATPYEGKSTTVSNLAIVMAQNEKNVLLIDCDMRKPVQ
HKKFGLPNRGLSNYIATGAALEKVIQKNVLPHLDILPSGPVPPNPSELLSSTKMEEVLQAVRDMYDYVLLDMPPVLPVTD
AAVMSSKVDGVVLVLSSGDISPDEANRTKAQLEQGGAKILGVILNKVPTQRSYGYSQYYYYYYYDEDHVKHKGHRHHSKE
ENSGQ
>gnl|bykdb|A0A1G9WHR7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus mucosae] (length=258 residues).
MGIFKRKSRVNNNTMKNGAKLITVAKPKSMAAEQFRTVRTNIHFMAVDRSLKTIAFTSANISEGKSTVAANLAIVWAQEG
KSVLLIDADMRRPTLYSTFDLAGQEGLSTVLSSDQAQVNLNAVIQESGIEGLELLPSGAVPPNPAELLSSQRMKVLLEAV
RAQYDLVVLDVPPMLEVTDTQTIAGSVDGVVLVVRQGVTQKAGVRRTIELLKMSHAHLLGYVMNDVVPEDDAGYGYGYGY
GYGYGYGYGYGYEKESEN
>gnl|bykdb|A0A1G9WNW6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Dendrosporobacter quercicolus] (length=229 residues).
MSNKRRLIVQEQAKSPIAEAYRTLRTNIQFSKSDGELKAIMFTSSGPGEGKSTTTSNTAVAMAQSGKRVILMDCDLRKPV
QHKIFTKRNKGVTNALVEEVNPLDLLQETEVDNLLLLPSGPIPPNPSELLGTVRMQEIVECLKENCDLLIIDAPPVVAVT
DASVLAAKVDGIVLVVNAGSNRPEMVQKAKELLAKAKGHILGVVLNRVEIEEEHAYYYYYYGNENKNAK
>gnl|bykdb|A0A1G9Y9X7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. OK048] (length=237 residues).
MRLLAFKRNKKVRTTDPSRKLIATLDPKSPISEQYRTIRTNIQYSSIDKELKAIMVTSSGPGEGKSTTAANLAAVFSQLG
KKVLLVDADLRKPTVHRTFAVNNLFGFTTVLTKQATLGSTVIETEEKDLYILTSGPVPPNPAELLSSKLMEQFIEEAQEQ
FDYVIFDTPPLLAVSDPQILANKVDGSILVVYSGKTEIDQAKKAKELLANAQSKLVGVVLNHKEIKDNDYYYYYGSK
>gnl|bykdb|A0A1G9YKX0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Fictibacillus solisalsi] (length=233 residues).
MSRKLRKTIKDLTQRSLITHNNPKSPISEQYRTIRTNIQFSSIDTQYQSIMVTSSSPGEGKSTTVANLAVVLAQQGKSVL
LIDGDLRKPTVHYTFKVSNIQGITNVLTRQISLEDAAVQTSVDDLSVLPSGPVPPNPSELLNSKAMEILVEEAKTRYDYV
LFDTPPVLAVTDAQILANRCDGVVLVTSSGKTEKEAAIKAKELLDNANAKILGVVLNQKEMNENSYYYYYGAN
>gnl|bykdb|A0A1H0AG19 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. yr247] (length=226 residues).
MSVQSSKNKYTLITNLNPKSHKSEAYKTLRTNITFSSIDRETKKILITSSQPSEGKTTTIANLAVAYAQENKKVLVIDAD
LRKPTLHHIFMKSNRVGLTNILANQNSLEEIIVSTDIPNLSLISSGPIPPNPSELLASRKMIELLKQLEQDFDLILIDSP
PTISVTDSQILSTMCDGVLFVIHSGKVKRQVVVKALQNLEHVKAKVLGVVLNNKNSQSQDQSYTYY
>gnl|bykdb|A0A1H0G2F3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Psychrobacillus sp. OK028] (length=229 residues).
MFKRKKIKAVARKLVTSTNPQSIISEQFRTIRTNIKFSMPNRELKTLLFTSSSIGEGKSTIAANVAIVFAKEGKKVLLID
ADLRKPTMHFTFLKTTSPGLTNLLTSHWNLSQVVKETGVKGLDLVTSGPIPSNPAEILGLPSMDTLIKNMKEHYDLIIFD
APPVLSVSDAQILTNKCDGTILVISSNSTEKVNAIKAKEVLQASNANIIGTILNNYKIGKDHYYHQYYG
>gnl|bykdb|A0A1H0GGX0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus daliensis] (length=234 residues).
MARSKANKQEMSDKQRALITEFDKRSPISEQYRTLRTNIQFASVDKEIKTLMVTSSSPGEGKSTTVANLSIVLAQQDNKV
LLVDTDLRKPTVHFSFQVPNQAGFTNVVTNKASLEDSVFETSIERLDVLPSGPLPPNPSELLGSARMKKFVRDATAVYDY
VIFDAPPVNAVTDPQIIAGLVDGTILVVRSGQTEEEHAQKAVESLRKVDANILGAVLNDRAMEESQYYYYYGES
>gnl|bykdb|A0A1H0KKQ4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Halobacillus aidingensis] (length=231 residues).
MARKKKQMVNTRARNIIANENPKSPIAEQFRTIRTNLQFTTVDSELETMLVTSASPSEGKSITTANTATVFAQQGKKTLL
IDADLRKPTVHYTFRVSNTSGLSNYLVGKQRVTELARETDVDNLDVITCGPIPPNPSELLGSNKMKQFIEEAKQTYDMIV
FDTPPVLAVTDSQVLSNFVDGVLLVVRSKQTEKEAAVKAKETLEQAKANILGVVLNDQDLKSSNYYYYYGQ
>gnl|bykdb|A0A1H0MI92 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus equinus] (length=240 residues).
MPQLELVRAKAQMIKTLEEYYNTIRTNIQFSGRNLKVIALTSAQPGEGKSTTSTNLAISFAKAGFRTLLIDADTRNSVMS
GTFKSKERYDGLTSYLSGNAELSDVICDTTIDNLMVIPAGQVPPNPTSLIQNDNYDKMIETVRGLYDYIIIDTPPLGRVV
DAAIIAHSSDASLLVTKPGVDKRRTITKLKEQLEQSGAAFLGVILNQFDIRRDYYGSYGSYGGYGSYGEYGKSSKKEDKK
>gnl|bykdb|A0A1H0PQN8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium gasigenes] (length=218 residues).
MFIVETKPKSIAAESYRTLRTNLQYSSFDKEYKVIVVTSSEPGEGKSTTAGNLAMSLAQGEKKVILIDCDLRKPSLHKRF
KISNIMGLSDVLIGREVIENAATRYKKNITVLTSGKIPPNPSEMLGSKAMTALLNELQGIFDYIILDTPPIQAVTDSQIL
GAKADGVILVVKAEKTKKESVQNSINLLKKVNAHIIGTVLNGVDNKRNKYYYYYGEKK
>gnl|bykdb|A0A1H0SK24 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Eubacterium limosum] (length=244 residues).
MKDSIITYKSPKDPISEAFRNMRTNITFADIDEELRVLTITSTGKGEGKSTIIANYAVALAQSKKKVLLIDCDLRRPRIH
RLFEQPNKRGLTNVLLRECEPTEAIQTTDVENLFIISSGPIPPNPSEILASKRLIELINQFKLAFDYILIDAPPVGVVTD
AAVLSHVTDGYIVVAAISVTNKEGVRLALETLRNVNGNIVGVVANNAPVSKRSGYYYYYSAYEEDQHQSKKEKKQRKIKE
KRGK
>gnl|bykdb|A0A1H0TW36 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. NLAE-zl-C503] (length=227 residues).
MPTLEISQAKLDLVKKAEEYYNALCTNLQLSGDDLKVFSITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDGDIRNSVMS
GVFKARDKITGLTEFLSGTTDLSQGLCDTNIENLFVIQAGSVSPNPTALLQSKNFNTMLETLRKYFDYIIVDTAPVGVVI
DAAIITRKCDASILVTAAGETNRRDIQKAKEQLEQTGKPFLGVVLNKFDTSVDKYGSYGNYGDYGKK
>gnl|bykdb|A0A1H0W773 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus salsus] (length=235 residues).
MARDKNTRKMQFAAQNRSLVSLKNPKSPIAEQFRTIRTNIEFSSVDHEMKKIMVTSSGPAEGKSTTTNNLAVVFAQQGKR
VLLVDADLRKPTAHYSFRLENHTGLSNVLTRQSTFDRAVRETEQENLFVLTSGPVPPNPSELLGSKRMAELLEEITEIFD
IVIFDTPPVLAVTDAQILANKCDGVVLVTSSGRTENEAALKAKELIESAKGKLIGAILNNKKAKDSQYYYYYGSS
>gnl|bykdb|A0A1H0XZ13 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus equinus] (length=249 residues).
MPQLELVRAKAQMVKTLEEYYNTIRTNIQFSGRNLKVIALTSAQPGEGKSTTATNLAISFAKAGFRTLLIDADTRNSVMS
GTFKSKERYDGLTSYLSGNAELSDVICDTTVDNLMVIPAGQVPPNPTSLIQNDNYDKMIETVRGLYDYVIIDTPPLGRVV
DAAIIAHSSDASLLVTKPGVDKRRTITKLKEQLEQSGSVFLGVILNRFDFKADKYGYGYGYGYGYGYGYGYGKYGKDKKE
KSGNKKGKK
>gnl|bykdb|A0A1H0YCU2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Carnobacterium viridans] (length=240 residues).
MFKKRISEKKYEEKNLITLIDPTSIISEEFRTLRTNIQFSMIDKELKTLMVTSSKQGEGKSTIAANLAVVFASQGKKVLL
VDADMRNPSLHKLFKVRNQQGLTSILTTKNRQLRSLLHETSQENLNLLTSGILPPNPSELLASQRMAQFIEAVKQEYDLI
VFDMPPVNVVTDAQVMGNKADGTVFVIRKEVADLSEILKAKELLNLVQANVLGAVFNSKERVKGLNGGYYAKEKELDTVG
>gnl|bykdb|A0A1H0YGY8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Carnobacterium viridans] (length=234 residues).
MFNKKTKQLNIKERPSLVTLTRSKSVIAEQFRTIRTNIQFSMVDKNLKTLVVTSAGPGAGKSTISANLAVTFAMQGKKVL
IVDADMRKPTVHKTFHLPNRDGLTTLLTERDIEIKNIAHCLDKEGLFVITSGVIPPNPSELLASNRMNQLMAEFEELFDL
IIFDMPPVIAVTDAQVMASKADGTIFVVNKDGADKEMVMKSKDLLEKVQANVIGVVFNRVELKGDNYYYYGEGE
>gnl|bykdb|A0A1H0YHR1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Virgibacillus salinus] (length=230 residues).
MARKRGSNNKIRNLITNQNPRSPVSEQYRTIRTNLQFTSVDEELKSIMVTSSGPGEGKSVTVANLAVVYSQQGKKVLLID
ADLRKPTVHYTFRLDNLRGLSNMLVGDISLEEAISTSEINNLDIISCGPIPPNPSELLASKKMKQMLNEASQLYDVILFD
TPPVLAVTDAQIITNICQGAILVVRSKHTENEAARKAVELLSPGKAKLLGTILNDREQKESQNYYYYGIN
>gnl|bykdb|A0A1H1QY17 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillaceae bacterium GAS479] (length=230 residues).
MPRSTNNNSLVTHNDPKSPISEAYRTLRTNIQFSSFDEPIQVIMVASASPGEGKSTTASNLAVTYAQEGKKVLLIDADLR
KPTVFKVFNVTNRVGLSTVISGQCRAEDAIQHTFVDSLFVLPSGPVPPNPSELLASKSMKAALEEFKASYDVIIFDTAPV
LAVTDSLIVSAMCQGVLLVVHAGKLKSELVRKAKTNLEHVHARILGVVLNSTKSSKGDKYNYYYYGAEAK
>gnl|bykdb|A0A1H1R228 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillaceae bacterium GAS479] (length=230 residues).
MPRSTNNSGLVTFYEPKSPISEAYRSLRTNIQFSSFDEPIKIMMVASANPGEGKSTTASNLAVTYAQEGKKVLLIDADLR
KPSVFKVFNVSNRVGLSTVVSGQCHVQDAVQDTMVENLFVLTSGPVPPNPSELLASQSMKTILEEFKADYDVVIFDTPPV
LAVTDSLIVSAMCQGVLLVVQAGKVKSELVRKAKANLEHVHARILGVVLNNTKSRKGDKYNYYYYGAEAK
>gnl|bykdb|A0A1H1Y8J0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillaceae bacterium GAS479] (length=233 residues).
MSRSTRKWSLITESNPKSPISESYRMLRTGVEYAGVDEPVDLMMVTSCRAGEGKSTTSANVAVTFAQAGQRVLLIDADMR
KPSQHHIFGLSNRSGLTGVLNGRFGLEQGIQETAVNGLDVLTAGQTPPNPSEMLGSKAMSSLLELAKSRYDRVIIDTPPI
MAVTDAHIVAGKCDGVLLVIDSGKVKSDVARKAKASLENAGSRILGVVLNNVDRSSGDGYYYYYYGGDEGQKA
>gnl|bykdb|A0A1H2RBJ7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Alicyclobacillus hesperidum] (length=233 residues).
MASREDIQRPISLINPKSPLTESYRTLRTNIQFASVAEDTKVVLVTSTAPGEGKTSTSTNLAVVAAAANKKVLLIDADMR
KPQVHQRFQVSNLIGLSTLLIKERSLQDCIVSSGAENLYLLTSGPIPPNPAEMLASRAFAELVDVLRSQFDMIVIDSPPV
LSVSDTLALSHIADGVLFVVDSQKTHRLHAKRAVQALMQVEARILGVVLNRVKHNKKDSYYYSYYTAGTPVTS
>gnl|bykdb|A0A1H2TID6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Marinococcus luteus] (length=230 residues).
MARKKKQETNTNQRKLITWLNSKSPVSEQYRTIRTNIQYSSVDKEMQAIVVTSAGPGEGKSTTVANLAVTMAQQEKKVLL
IDADLRKPTVHYTFRRMNTHGMINALTNHGEYASYVQETEVPNLDILPSGPIPPNPSEILGSRSMAHLVELAREQYDVIL
FDAPPVLAVTDVQVISRHCDGSILVVKAGSTENDAARKAKELLEVSGVPILGCILNQKKGMDQSYYYYYG
>gnl|bykdb|A0A1H3AC32 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. CF384] (length=230 residues).
MSKLGNSRYLITYYEPKSPISEAYRAMRTNIDFSSVDDHIQVIMGTSASPGEGKSTTIANIAVVYAQANKKVVLIDADMR
KPTMHHTFGQSNRQGLSSLLSRQCELDEAVKATDIPNLYIIPSGPVPPNPSEMVASQRMSALIEELRTKFDIVLIDTPPT
LAVTDAQLISTKCDGVLLVVESGKIKRDAVIKAKQQLTHVKARILGVVLKNIEQKNSEGYYYYYYSETEK
>gnl|bykdb|A0A1H3AP98 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. PDC88] (length=229 residues).
MPRSTSNQHNLVTAVNPKAPISEAYRTLRTNIQFSAIDDQIKVLMVASAQSGEGKTTTVSNLAVTYAQEGKKVLLIDTDL
RKPSLHQVFTVSNHAGLSSAIAAQYPVQEVLQKTAVHNLDVLPSGPIPPNPSEMLGSKKMTALLEELKGIYDIILFDTPP
VLAVTDAMIISSLCDGVVLVVNSGKVKKDLVKKAKGHLEHVNARILGVVLNNIQLNKNQSNYYYYYGER
>gnl|bykdb|A0A1H3DGS7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. CF384] (length=229 residues).
MSQQDNKQRHLISAINPMSPISEAYRTLRTNIQFSAIDQPMKVLMVASASEGEGKTTTITNLAVTYAQEGKRVLLVDTDL
RRPTLHHIFQLTNRSGFTSAILNQQVLADVIKETSVENLFVLTSGPIPPNPSEILGSQRMHTLVDELKSMFDVILFDTPP
VLPVADSLIVTSYCDGIILVIHAGKVKKELLKKAKASLEHAKSRILGVVLNNNERSKHDGQYYYYYGRK
>gnl|bykdb|A0A1H3G901 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Eubacterium barkeri] (length=243 residues).
MRSSIVTYKSPKDPISEAFRNMRTNITFSDIDNEIKVLTITSAGKGEGKSTIMANYAVALAQSNKRILIMDCDMRRPRVH
RLFERNNRVGLSNILVREVDIADAIQRTEVEGLHLISSGPIPPNPSEMLGSRRMEELIALLKESYDYVLIDAPPVGVVTD
AAVLSKVTDGFILVTALEVTNKEGIKLAIANIENVGGHIVGVVANNTPTNKRSGYYYYYSAYEEDKPKNHTEKRAQRKMN
KQK
>gnl|bykdb|A0A1H3T8S1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus caseinilyticus] (length=234 residues).
MARNKRKNNQLSDKQRSLITHFDQKSPISEQYRTLRTNIQYAAIDRQIRTIMVTSTTPGEGKSTTVGNLGVVLAQQQKRV
LLVDGDLRKPTNHFTFQLPNTLGLTSVLTKQVSFDEAVKETAVPFLEVLTSGPIPPNPSELLASKAMKEFTEGISEIYDY
ILFDAPPVNAVTDPQILSKLVDGVILVIRSGKTEEESAKKAVDSLNKVEANIIGAVLNDQKMEESSYNYYYYSE
>gnl|bykdb|A0A1H3UMN6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus caseinilyticus] (length=238 residues).
MKVLVRNRERRERLTERHRSLITHYRPQSPASEQYRTMRTNLQFASLNEEIRLITVTSSSPGEGKSTTAANLAISLAQQG
FSTLLIDGDMRKPTCHYTFGMDNQSGLTNVLINVHSLSDVLRKSFVPNLHILTSGPIPPNPAELLSLIQMDWLLNELRKQ
FDYIIVDSPPVLAVADAQILAQRSDGVILVVSSGKTEKENGLKAKELLSRANTKLLGVVLNKKEKKGSHYQEYYARSK
>gnl|bykdb|A0A1H4DXQ9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Thalassobacillus cyri] (length=231 residues).
MRRSKKKLSNKKARTLIAKMNPRSPISEQYRTIRTNLQFASVDQELRTMMVTSAGPAEGKSLTVSNLAVTFAQQDKKVLL
VDADMRKPTLHYTFRLDNSRGLSSVLIGDKLMHDVVQQSDLDNLNLMSSGPIPPNPSELLGSRAMENFLQAAKQSYDVVI
FDTAPVLAVTDGQILSNICDGVLLVTRSKQTEIDAGKKAVDLLHQVNANVLGAVLNDVEQKKSNYYYYYGS
>gnl|bykdb|A0A1H4EFH1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Eubacterium aggregans] (length=244 residues).
MRNSIVTYKSPKDPISEAFRNMRTNITFSDIDNEIKVLTITSAGKGEGKSTIMANYAVALAQSNKRILIMDCDMRKPRIH
RLFERNNRVGLSNILVREVDIADAIQRTEVEGLHLISSGPIPPNPSEMLGSRRMAELVSLLKESYDYVLIDAPPVGVVTD
AAVLSRVTDGFILITALEVTNKEGIKLAIANIENVGGHIVGVVANNTPTNKRSGYYYYYSAYEEDKPKNHTEKRAQRKMN
KQKK
>gnl|bykdb|A0A1H4EVA2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. 112mf] (length=229 residues).
MVLKKKILRARRQLIAYEQPKSSVSEQYRNIRTNIEFASVDKKIRSLIVTSANQSEGKTTTAANIAIVFAQQGKKVLLID
ADLRRPALHQMMQVDNIFGLTNVLTRSKTLETCVTQTKIGNLTFLPCGPIPPNPAELLGASSMKDLLSEAYGTYDLVIFD
TSPILPVTDAQIMANQCDASVLVIRSGATEKEAALKAKQSLDSAKGTLLGVVLNDKEQNGSEYYYYGSN
>gnl|bykdb|A0A1H4GBH2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. 276b] (length=227 residues).
MPRLTNDQGSLVTMANPKSTSSEAYRKLRTNIQFSSIDSQIQTIMIASALSGEGKTTTIGNLAVTYAQEGKKVLLMDTDL
RKPTVHRMFNVPNHVGLTSVLSSQYKVTEVLRETGVEGLHVLSSGPIPPNPSEMIGSRKMTALLEDLKDEYDVILFDTPP
VLAVTDALIISSLCDGVILVVSAGKVKKDLVKKAKAHLEHVNARILGAVLNNVQVPKSRNAYYGENA
>gnl|bykdb|A0A1H4PVX7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. GP183] (length=229 residues).
MSQSTNKNPLITDVNPKSPISESYRTLRTNIQFSAVDEDLKVLMVTSAGPGEGKSTTIANLAVAYAQSDKKVLLIDADLR
KPTMHHTFRLTNRWGLTNLLTNQAEIEEVINSSSIPNLDVLTSGPIPPNPSEILSSKRMNTLLEELKKRYDIILIDSPPA
IAVTDAQILATRCDGVILVIDSGKVKREIALKAKANLEHVQARLLGVVLNNVDRKNKDAYYYYYYGNKE
>gnl|bykdb|A0A1H5T1P8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Caloramator fervidus] (length=237 residues).
MKLITIKDQKSPISEAYRTLRTNINFSLPDTKVKTILITSSGPGEGKSTTSANLAVVFAQNGYKTIIVDCDLRKNTVHKK
FGISNIVGLTNILIGEQEFDEKLFKYESVENLYVLPAGTRPPNPVELLSSRKMERFIEYLKQNFDVIIIDAPPVLVVTDA
QILSQYVDGVVFVVASEEADKHAAKRAKELLEKANTKILGVVLNKLDTTKKGYYGYYYYYYYGHEKIEQRKARFLGR
>gnl|bykdb|A0A1H5TB81 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lachnospira multipara] (length=232 residues).
MQTINIERLIKLDYRANESYKNLRTNIQLCGSDIKTIMFTSTTPGEGKSTVSFNLAVSLAEAGKKVIFIDADLRKSVLVG
RYKINKSVKGLTHFLSGINKFEDVMYGTNVDNLNVVFSGPVPPNPTELLGNKVFKTLLKVLRDLYDYIIIDTPPIGSVID
SAIVAQECDGTVVVVGSNMVGYKYAQKAIEQLKKTNTTILGAVLNKVDVNDNKYYGKYYGKYYGRYSDAGEE
>gnl|bykdb|A0A1H5UPQ5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Butyrivibrio sp. Su6] (length=274 residues).
MQNAKLHFSQSENNYQIKEAYKTLRSNIEFSGQNVRIISVTSCTPGEGKTTVAMALARAFAEAGKKTILVDADMRKSVLV
GRYRTGSVRLGLTHCLVGRERLSSVICETDTPNLYVVFSGPVPPNPSELLGGRIFEKVLENMKQVFDYVIIDTPPLGSVI
DAAVVSKQCDGTVMVIESNSISYRFAQRVKDQLDKAGAKILGVVLNKVDISGKGYYGHYGNYYGKYYGKYYGKYYGNGED
TADKQVRPKAAEPAPPDDDDLDELNYLAGVTRKD
>gnl|bykdb|A0A1H5V240 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. UNC499MF] (length=231 residues).
MLASTNNSKVLIADINPKSQISEAYRVLRTNIQYSSIDRKITTLLVTSAQPAEGKSTTVSNLAITYAQEEKKVLLIDADL
RKPTMHKLFGISNRSGLTNLLLGDAPIHEVAIPSHLPNLHLIPSGPATPNPAEMLASKRMTQFIEQAKTEYDIVLIDSPP
ILAVTDAQILATKCEGVILVLNYGKVKREVARRAVDSLEHVGVKPLGVVINNKTNTKNSSSYYSYYGEVSQ
>gnl|bykdb|A0A1H5XQ19 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Eubacterium ruminantium] (length=243 residues).
MKINFENLTQLEFKTNEAYKALRTNISFIGDDVKVISITSAQPNEGKSEVAFRLACSMAEDGKRVLFVDADIRKSVTVTR
YGVDKETQGLSHYLAGKAKLEEVIYTTNIERLDIIFTGKVAPNPAELLGNSRFEKLLEVSREAYDYVIIDCPPLGSVIDA
AIISQKCDGALIVIETDGVSYKAAQNVKKQLENSGVRILGAVLNKIEANGKGYGRGYYGKGYGYGYGYGYGYGYGYGEQK
DKK
>gnl|bykdb|A0A1H5Y6E3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Butyrivibrio sp. Su6] (length=237 residues).
MFDIKIERKNYPFAMAEEFKNLRTSIIFSGEDIKTVLFTSCFANEGKSTITLELARSFAELDKKVIFIDCDLRKSILKRK
IRDGIIKKGLTHYLTGQCSLEDIIYRNNPGREKDVEFFVIPAGPSTNSPTELLSSQKFSDLLTELRDEYDVIIIDAPPLG
SVVDASIIGSKVDGSVLIVEAGGANYKVVKKVADKLVSSGSRLLGVVLNKVDKSKKSYSYYKYGKDYGYGDKYGYGN
>gnl|bykdb|A0A1H5ZD68 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. UNC499MF] (length=227 residues).
MSQSSKQRPIIAHSNPMSPISETYRTLRTNIQYSGVDGEIRTLMVTSASPWEGKSTTIDNLAVVYAQTDKKVLLIDADLR
KPTAHRTFGLSNRTGLTDVLTRQAEVEEALKETDIPGLYVMTCGTVPPNPSEILGSRRMTDLLERLKREFDVILVDTPPV
LAVSDAQVVATQCDGVVLVVNAGGVKRELVQKARDSLQFVHARILGVVLNKVARKDAKMNTYYDYSS
>gnl|bykdb|A0A1H6DS65 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. ok061] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A1H6SHG6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. 45] (length=250 residues).
MPQLELVRAKAQMVKSLEEYYNSIRTNIQFSGRNLKVITLTSAQPGEGKSTTATNLAVSFAKAGFRTLLIDADTRNSVMS
GTFKSQERYEGLTSYLSGNAELSDVICDTTVDNLMVIPAGKIPPNPTSLIQNDNYDKMIETVRDLYDYVIIDTPPLGRVV
DAAIIAHSSDASLLVTKPGVDKRRTLTKLKDQLEQSGSVFLGVILNRFDFKADKYGYGYGYGYGYGYGYGKYGKDEKEKS
DKSSRKKAKK
>gnl|bykdb|A0A1H6TLJ9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Alkalibacterium gilvum] (length=234 residues).
MLFKRKKNRKDIDHPSLVVVNKPLSVISEQFRTMRTNIQFSMVDEAIRTLVVTSAGPSSGKSTIAANLAATFASEDKRVL
LVDSDLRKPTVHKTFKVRNSDGLTSLLTNKETKLQDVVSQTNTAGLYILTSGAIPPNPADLLSSNRMQEVKREMIEYFDM
IVFDTPPVLAVTDAQVMATITDGTLFVVPQGQVSKDELVTAKDTLDKVKVNVLGAVLNRVDKSNDTYAYYYGEE
>gnl|bykdb|A0A1H6UXC3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bhargavaea ginsengi] (length=239 residues).
MAIRKKNRKKQQLEQRARKLVVHASPKSIVSEQFRTLRTNINFSVPAGDLKTILFTSASPGEGKSTVSANMAMLFAQDGQ
KVLLVDGDMRKPTVHYTFHLSNTQGLSNVLTRQETPETVIRETEFSPNLHVMTSGPIPPNPAELLGSETMHQFMDYISSQ
YELVIFDAPPVLSVTDAQILANKCDGTVFVINTGETEKDNANKAKELLDASKSRILGAVLNNFKLGKDHYYYHYYGSGE
>gnl|bykdb|A0A1H6VMG2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Sharpea azabuensis] (length=464 residues).
MENNVSQEEIVVRIVCIIRSLLKHIGTILIVFMIFGMAFDVYKTMHYVPHYRSSLTATLSGEKNTYSNLSNIEGYLSTFN
YALNSQNAKSYVMNKLGKNSLDLTVTTTQSTGNMIIVSATSNRKEATYHALDYLMEWYNNNQDRFKFPYRMTLIEKDSFV
ENSINPNSHIRNVGMAGLIGAAICIVYFILQSLLKGTAMTSTDVKQKVKTRLYSRLPHVYKRRGILFWRKNRSALLITSL
KTPFDYKEAVHKLAGKVERSAQHHQYKTFMVTSTLENEGKSSVAVNLALSLAQQEKRVLIVDADIRNPSIQKILNLKDTS
SLNDYLSGKKEWTDVVEYLEKYHLFVLKSHQDLDNVYSLISNGMLDKMLVEAKKVFDYIIVDVSPSYQLIEPMIINESID
ATLYVVKQDEAPIEIINETITRLNNINNNVIGVVYNQSVKDFSRRHKAYGHRYGYGRYRQGEER
>gnl|bykdb|A0A1H7IL51 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Butyrivibrio sp. ob235] (length=287 residues).
MQQTTLHFSESENNYQIKEAYKTLRSNVEFSGQDVRAVSVTSCTPGEGKSSVSMALARAFAEAGKKTVLVDADMRKSVMV
GRYKTGSVRLGLTHCLVGREKLSNVICETDTPNLYVIFSGPIPPNPSELLGGQIFSKILDNMKNVFDYIIIDTPPLGSVI
DAAVIAKQCDGTIMVIEDNAISYRFAQKVKSQLDKAGAKVIGAVLNKVDMTGGVYGHYGRYYGRYYGKYYGKYYGKNDSY
SDGSMTGGKPGRIMQPQVKSERPAPSSAAAKGNLDELDYIEGVVRKD
>gnl|bykdb|A0A1H7M2U2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. OK003] (length=214 residues).
MANPKSTSSESYRKLRTNIQFSSIDSQIQTIMIASALSGEGKTTTIGNLAVTYAQEGKKVLLMDTDLRKPAVHRMFNVPN
HVGLTSVISSQYKVTEVLRETGVEGLHVLSSGPIPPNPSEMIGSRKMTALLEDLKDEYDVILFDTPPVLAVTDALIISSL
CDGVILVVSAGKVKKDVVKKAKAHLEHVNARILGAVLNNVKLPKSRSSYYGGNA
>gnl|bykdb|A0A1H7M465 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus albus] (length=262 residues).
MASINRNPAFTNRNAKRRTLMDKDVAFPVTEAYKTLRTNISFALSTKKNKIFAVSSALASEGKSTVAANIAITLAQNNDH
VLLIDGDLRKPVQHRVFTLKNEVGLSTLISGSNTFKEIVHHEVIENLDVVPCGPIPPNPSEMLGSDNMKMLLEQLSAHYD
YIVIDTPPINIVTDALTLLDSIAGVLLVANHGKSTYDALEESIQAIKMSDGSLLGIVVNNVSVSGGKYGGKYSYKYKYGY
KYGYGYGDYSDYTPKASDNKDK
>gnl|bykdb|A0A1H7NN12 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Alkalibacterium pelagium] (length=234 residues).
MMIFNKKKKVETADRPGLVVVNKPSSVVSEQFRTIRTNIQFSMVDETLRTVVVTSAGPASGKSTVSANLAATFASKEKKV
LLVDADLRKPTVHKTFKVRNNDGLTTLLTDRNADLDEMIYRTHTDGLYVLTSGAIPPNPAELLASKRMEEIKKEMLDYFD
IVIFDMPPLLAVTDAQVMASKTDGVLFVIPKGMANKDEVFKAKDLLEKVQANVLGAVLNRVDKSDDNYYYYYGE
>gnl|bykdb|A0A1H7QN06 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Alkalibacterium putridalgicola] (length=233 residues).
MLFKRKKEMNNTERPGLVVVNKPSSVVSEQFRTIRTNIQFSMIDETIKTVVVTSAGPSSGKSTIAANLAATFASEDKRVL
LVDADLRKPTVHKTFKVRNTDGLTTLLTDKLTHVEDVVYRTHTDGLYILTSGAIPPNPAELLSSKRMEEVKQQMLDYFDM
IIFDMPPVLAVTDAQVMSTKTDGVLFVIPQGQASKEEVHKAKDLLEKVKANVLGAVLNRVDKSDDSYYYYYGE
>gnl|bykdb|A0A1H7UG53 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus gallolyticus] (length=248 residues).
MPQLELVRAKAQMVKSMEEYYNSIRTNIQFSGRDLKVITLTSAQPGEGKSTTSVNLAISFARAGFRTLLIDADTRNSVMS
GTFKSNERYQGLTSFLSGNAELSDVICDTSIDNLMIIPAGQVPPNPTSLIQNDNFKAMIETVRGLYDYVIVDTPPLGLVI
DAAILAHHSDASLLVTKAGADKRRTITKLKEQLEQSGSVFLGVILNKYDIHLDKYGSYGSYGGYGSYGSYGEYGKNTGKK
LKSKDMKE
>gnl|bykdb|A0A1H7XXP0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Candidatus Frackibacter sp. WG12] (length=235 residues).
MNRKEEIRDDELITKYNPKSPAAEAYRSLRTNISFLSPDQPLKTIVLTSSNPGEGKSLTVANLAISIAQTGKRVIIIDAD
LRKPTQYRFFRMTNHTGLSKILTDKIEFDEGLRTTKIKGVQLISSGPIPPNPAELIGSAKMKEVIKTARAKADLVLIDTP
PVIAVTDTTVLADKVDGFVLVVAAQMTSKEVLIKARETLDKVRANVIGTVLNRDTIYYGNEKYYDYYYYGERVNA
>gnl|bykdb|A0A1H8BUU5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. OK076] (length=227 residues).
MPRLTNDKGSLVTMANPKSTSSEAYRKLRTNIQFSSIDSQIQTIMIASALSGEGKTTTIGNLAVTYAQEGKKVLLMDTDL
RKPAVHRMFNVPNHVGLTSVLSSQYKVTEVLRETGVEGLHVLSSGPIPPNPSEMIGSRKMTALLQDLKEEYDVILFDTPP
VLAVTDALIISSLCDGVILVVSAGKVKRDLVRKAKAHLEHVNARILGAVLNNVQVPKSRNAYYGENV
>gnl|bykdb|A0A1H8CGR4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lihuaxuella thermophila] (length=220 residues).
MKDREAAGKLICLYNPKSPIAEAFRTLRTNIQFTAMNRGIKTIMITSALPGEGKSTIISNLAVAMAQSGKQVLLIDADFR
RPDLHHIFRMPNNKGLSNVLMNQAEAGEVISEVPDIWLDVITSGQPPSSPADLIGSRRMQDLLEEVKEQYDVIFIDTPPI
LAVTDPQLLASFVDGVLLVISSGKVSYDDAKKVKAMLEYVKANLIGTVLNDKEVETIAYY
>gnl|bykdb|A0A1H8DUM9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lysinibacillus sp. SG45] (length=232 residues).
MLFKRKTKRIPMARKLITVSDIMSIPSEQYRTIRANIKFSQPNQDVKTILVTSSIAGEGKSTNAANIGVVFSQEGKRVLI
IDADMRKPTLHHTFYLDNIFGLSSVLSRQATLQEVIQETFVEGVDIISSGAIPPNPTELLASETMTFLLHEVKEQYDIVM
IDAPPLLFLSDAQILSNKCDGTLLVVNTGTVGKAAVVKSKSILTISKANILGVILNNYKMKGSTYEQYYGKE
>gnl|bykdb|A0A1H8EHQ5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenisporosarcina quisquiliarum] (length=231 residues).
MFKKKRMHHARKLVISTDRKSIVAEQIRTVRANIKFAMKDKECKTLLVTSTSIGEGKSTIASNIAISFAQEGQKVLLVDA
DLRKPTMHYTFNKPVSPGLTNFLMSNWCLSNVLKDSGVIGLDLITCGPMPSNPAELLGSSTMNIFLEETISLYDLIIFDA
PPLLSVADAQILSAKCDGTILVTSSGTTEKRNLYKVKEVLEVSNANVLGLILNHFKLEKNHYYYEYYGEKD
>gnl|bykdb|A0A1H8FDK9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Terribacillus saccharophilus] (length=230 residues).
MAKRKKQFKTNVRSLITKQNPKSPISEQFRTLRTNIEFASVDEKIHSILVTSSGPSEGKSSVTANLAIVFAQQGKKVLLI
DADLRKPTTHYTFKLDNRTGLSTVLIGEKTLEEAAQQTDVPNLDLLTCGPIPPNPSELLGSNAMKRLLEIAEESYDMVVI
DTPPVLAVTDAQILANICDGSIIVVRSEQTEYDSIHKAKELIEPAQAKLLGVVLNDVAQKHSNTYYYYGN
>gnl|bykdb|A0A1H8GZM3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus persicus] (length=233 residues).
MGPKKKANKPTAENRRKLVTSIDPKSPISEQYRTIRTNIQFSAVDDDVQVIMVTSAGPMEGKSTTAGNLAVVFAQQEKKV
LLVDADLRKPTMHYTFNQTNTFGLTTVLAGQVPMNEAVNPTDVFNLSVLTSGPIPPNPAELMGSKSMNRFLKEAKESYDI
IIFDTPPILAVTDAQVLANLCDGSVLVVYSGKTEMEEAAKAKELLTSAKGKLLGAVLNHKKLESSDYYYYYGK
>gnl|bykdb|A0A1H8HXZ7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. OV219] (length=230 residues).
MSKLASKRRLISLVEPKSPISEAYRSLRTNIDFSSVDDKVQVIMVTSASPGEGKSTTIANLAVVYAQADRSVVLIDADMR
RPTSHHTFRLSNRHGLSSVLSRQCEVEEAVQATDIPNLSIMTSGPVPPNPAEMLASKRMSLLIEQLREQFDVILVDTPPT
LAVTDAQIVSTKCDGSLLVLESGKVKRDMVVKAKQQLTQVNARILGVVLNNVKQKNGDGYYYYHYNDANK
>gnl|bykdb|A0A1H8N5X8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Amphibacillus marinus] (length=230 residues).
MARQRKGPANNTIRHLITKLNPRSPISEQYRTIRTNLQFAAVDEQLNTMLVTSAGPAEGKSSTVANLSIVFAQQGKRVLL
VDADMRKPTVHYTFRVDNRRGLSSVLVGELELDEALTKSDIENLDILPSGPIPPNPSELLGSNAMRKLLELAKQHYDLII
FDTPPVLAVTDAQILANEVDGSLLVVRSKQTEQDAAVKAKELLTPAKSKLLGVVLNDREVTKNQYYYYGE
>gnl|bykdb|A0A1H8QH97 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sophorae] (length=228 residues).
MSQLQNKQRHLITVTNPRSTVSEAFRALRTNIDFSSIDEKIQVIMVTSSGPEEGKSTVTGNLAVAYAQADKKVVLIDADL
RKPTGHRTFSLSNRFGLSSLLSQQANLDEVIQVSGVPNLSIITSGPIPPNPAEMIASNRMSATLQELRQRFDIILIDTPP
LLAVTDAQIMSSKSDGVIMVVSYGKVKRDIAVKAKASLDRVGARMLGVVMNNVKRKASEGSYYYYYGN
>gnl|bykdb|A0A1H8RBY5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. OV219] (length=233 residues).
MGPMSQPDNKQRHLIAAINPKSPVSEAYRTLRTNIQFSAIDQQMQVLMVASATVGEGKTTTLTNLAVTYAQEGKKVLLID
ADLRNPSLHQVFQQSNRVGLTSAFLNHQPITDVISETNIDNLFIIPSGPIPPNPSEILGSQRMQMLMDDLKRIFDVILLD
TPPVLPVADSLIVSSYCDGVILVVHAGKVKKELVKKAKANLDHVKARILGVVLNNNERSKNEGQYYYYYGRKK
>gnl|bykdb|A0A1H8Z1B1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Butyrivibrio sp. TB] (length=237 residues).
MQRIMIRDNELDFRTKEAYKTLRSNIEFSGRDIRTIAITSSTPNEGKSEVAFELARTFAQADKKVLLIDADLRKSVMREH
FKNGKIRFGLTNFLVGHCKIDDCLCQTDEPGFYMIFSGPNTPMPSELLGGEVFGQLLKEAHDVFDIIIIDTPPLGSVIDA
AIVGKQCDGTVLVIASGRISYRFVQNVQNQLRKAGCHVLGAVMNMVSMDGNKYYGKYYGKYYGKYYGKYYGNYGDYQ
>gnl|bykdb|A0A1H8ZEE2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus equinus] (length=255 residues).
MPTLELAKTQAEMIKKLEEYYNSIRTNIQFSGRNLKVIAVTSSQPKEGKSTTATNLAISFARAGLRTLLIDADTRNSVMS
GTFRSKESYDGLTSYLSGNAELSDVICNTSVDNLMVIPSGKIPPNPTSLIQNDNYERMIETVRDLYDYVIIDTPPLGRVV
DAAIIAHSSDASLLVAKPGVDKRRSITKLKDQLEQSGSVFLGVILNKFDFKADKYGYGYGYGYGYGYGYGYGYGYGKYGK
DEKEKLNKKGKKQLS
>gnl|bykdb|A0A1H9EHH6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Butyrivibrio sp. TB] (length=230 residues).
MIDIELETKNLPFGMTEEVKNLRTSIAFAGDGIKSVLFTSTMTNEGKSTITIEAAKSFAELGKKVVLVDTDLRKSILKMK
IVSGKMKYGLTHYLSGQCEVDDIIYHNTAEGFENMYIVPTGPATKAPTELLSTEKLGKLLDDLRKDYDMVIIDTPPVGTV
IDAAIIAPHTDGAVFIVEAGKVNYKSVQKAIEKFEASGCKVLGVALNKVDKSKNSYGYYKYGKEYGYGND
>gnl|bykdb|A0A1H9JXX4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Granulicatella balaenopterae] (length=215 residues).
MGKITIRVPNKDFFVNEANKSLRTNLGFCGKDKKVITFTSYSPGEGKSTTVINLALSLTDIHQKVLIIDADLRKSSLMHK
LKAVGIEKGLSHYLSRQARVEDVIYETNVKNLDMMFSGPFPPNPAELLGSQLFGMTVTSLKEYYDYILIDTPPIGSVIDA
AVVAEKSDGAIIVIESGAISHKLEQESIKQLEKTGCPILGVILNKVKNIGKAYYD
>gnl|bykdb|A0A1H9K964 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Granulicatella balaenopterae] (length=222 residues).
MEQITINLPYMDYFANEAYKALRTNLGFCGKEKKAITITSYSPAEGKSTTIINLARTLTESGQKVLIIDGDLRKSSLVSK
LKAIGANKGLSHYLSHQASLEEVIYSTNVNKLDIIFSGPVPPNPAELLEGDLFSMTLNSLKDYYDYILIDAPPVGSVIDA
AVIAESCDGIIMVIESGTVSHKDEQEVKKQLEKTNSPILGVILNKVKHSGKGYYQKYGKYEH
>gnl|bykdb|A0A1H9NTT2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Butyrivibrio fibrisolvens] (length=237 residues).
MQRIMIRDNELDFRTKEAYKTLRSNIEFSGRDIRTITITSSTPNEGKSEVAFELARTFAQADKKVLLIDADLRKSVMREH
FKNGKIRFGLTNFLVGHCKIDDCLCQTDEPGFYMIFSGPNTPMPSELLGGEVFGQLLKEAHDVFDIIIIDTPPLGSVIDA
AIVGKQCDGTVLVIASGRISYRFVQNVQNQLRKAGCHVLGAVMNMVSMDGNKYYGKYYGKYYGKYYGKYYGNYGDYQ
>gnl|bykdb|A0A1H9QCY4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus gallolyticus] (length=247 residues).
MPQLELVRAKAQMVKSMEEYYNSIRTNIQFSGRDLKVITLTSAQPGEGKSTTSVNLAISFARAGFRTLLIDADTRNSVMS
GTFKSNERYQGLTSFLSGNAELSDVICDTSIDNLMIIPAGQVPPNPTSLIQNDNFKAMIETVRGLYDYVIVDTPPLGLVI
DAAILAHHSDASLLVTKAGADKRRTITKLKEQLEQSGSVFLGIILNKYDIHLDKYGSYGSYGGYGSYGNYGKSEEKTKIG
RGKRKNS
>gnl|bykdb|A0A1H9QIT5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Salisediminibacterium haloalkalitolerans] (length=236 residues).
MARKNKTNQPDMSEKQRSLITEFDQRSPVSEQFKTLRTNIQFSSIDRKLKTIMVTSSNPGEGKSTTVANLAVVMAQQHNR
VLLVDTDLRKPTVHFTFQVPNHVGLSNVVTGQSTLEDAKMETAIPRLDVLPSGPVPPNPSELLASRAFEKFVKSVSDSYD
YVIFDAPPVNAVTDPQIIASLTDGTVLVIRSGVTEIEDAQHAVANLKKVEAHLLGTVLNDRAVEKSNYYYYYTEGK
>gnl|bykdb|A0A1H9RB85 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Gracilibacillus ureilyticus] (length=233 residues).
MVRGKKQFKKGVKMRQLITKLNPRSPISEQYKTVRTNLQFASVDGELNSLLITSSGPAEGKSTITANLAVVFAQQGKKVL
LIDADMRKPTLHYTFQMDNLQGLSSVLVGGYTLDESIISSEISGLDLLACGPIPPNPSELLGSKKMEQLVEEAVAQYDLV
IFDTPPVLAVTDAQILGNLCEGVVMIVRSKQTEYESAQRAKELLDKGNAKLLGVVLNDKEIKRGSQYYYYGTT
>gnl|bykdb|A0A1H9RGR4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Psychrobacillus sp. OK032] (length=239 residues).
MAKAKTKKTKKSAIQTVARKLVTSVNTRSIVSEQFRTLRTNINFSMPDKELKTFLITSSSPGEGKSTVAANTAVVFAQEG
KKVLLVDADMRKPTVHYTFHLTNTLGTSNLLTRQATVAEVVKMSEIENLDIITCGPIPPNPAELLSSQTMNNVIEEMKES
YDIIIFDAPPVLSVADAQILSNKCEGTILVMSAGTTEKDGVLKAKEALVSSQANIIGVVLNNFQLQKDNYYYQYYGNAE
>gnl|bykdb|A0A1H9SL88 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Isobaculum melis] (length=239 residues).
MFNKKRKNTKQQKQGTSLITLTKPSSVITEQIRTIRTNIQFSMIDRELKTLVFTSAGPGEGKSTVSANVAVVFAKQGKKV
LLVDADMRKPTVHKTFKVPNNEGLTTLLTEKEMNLENVIKETVDENLSILTSGPIPPNPSELLDSNKMNFTIEMLASSFD
LIIFDMPPIVTVTDAQIMASKTDGTIVVVRSGIANKEAVLKAKQLLTIVNANVVGTVFNGVEKTSDTAYKYYGLEGDQK
>gnl|bykdb|A0A1H9UN32 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Butyrivibrio fibrisolvens] (length=234 residues).
MIDIELETKNLPFGMAEEVKNLRTGITFAGDNIKSILFTSTMTNEGKSTITIEIAKSFAELNKKVVLVDTDLRKSILKMK
LVSGKMKYGLTHYLSGQCDVDDIIYHNTTKGLESFYVVPTGPVTKAPTELLSTEKLSKLLEKLRRDYDIVIIDTPPIGVV
TDAAIVASYADGAVFIIESGKVNFKIAQKAIEKFEMSGCKVLGVALNKVDKSKNSYGYYKYGKEYGYGYSDSSI
>gnl|bykdb|A0A1H9X9J0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Salipaludibacillus aurantiacus] (length=233 residues).
MARNKQNKELSDKQRALIAEFDKKSPISEQFRTLRTNIQFASIDRQIKTIMVTSSSPAEGKSTTIANLGVVLAQQHNRVL
FVDSDMRKPSAHFTFQVPNHTGLTTVLTQQTKLEDTVLDSSIPRLDILPSGPVPPNPSELLGSRAMKAFVTEVAKKYDYV
LFDAPPVNAVTDPQLLSRLVDGTILVVRSGKTEEEDAKKAVDQLKKVDAHIIGAVLNDRELENSQYYYYYGEG
>gnl|bykdb|A0A1I0A5J4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Oceanobacillus limi] (length=225 residues).
MLKRKRKIGDRGNLVTIERNNNQSSEQFRSLRSNINFASINKDVKSLVITSPSPGDGKTLTASNLAVVFSQEGKRVLLVD
ADLRKPSIHHIFRITNNFGLSNYLIGQKDMESLISTIDFNLDIIPSGIIPPNPPELLGSMQMKEFISTVSDQYDLVVFDT
PPVLAVTDSALVASQCDGALLVVRTKKNDVKDVEKAKEQLGFSGANLLGAVLNGKKEPKNNYYYK
>gnl|bykdb|A0A1I0CTZ9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerobranca gottschalkii DSM 13577] (length=359 residues).
MIRNLNLNMSYGEFSGKVQVTSIRDTEVIEIKVQDTNPQLAARIANELSEVFIRRIHEFIKKENVQILDYAVIPTNPIKP
RPMLNITIAFVLGVMIGVGLVFLLEYLDNSVKGPDDVEKRLNLPVLGAVPLMEGNENQLKLITMKDPKSPISEAYRMLRT
NIQFSNLDNELKTILVTSSGPAEGKSTSISNLAVTMVNMGHKVLLIDADLRKPQIHKIFNLDNDAGMTNILMGEKIENVV
HSISGMKLDIITTGPIPPNPSEILGSKAMKNFIEQCKEKYDIILIDSPPVAVVTDAAVLSKITDGTLFVVAAGQTTMDIA
MKAKDMLDKVQAKVIGVLVNKVNIERKKYQYYYSYYLED
>gnl|bykdb|A0A1I0FJT7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Clostridium] lavalense] (length=244 residues).
MRQTVALNRSMKDDYHYNEAIKTLRTNIQFCGSGIRVIMMTSALPDEGKSDMAFALASSLAQIGKRVLLIDADIRKSVLV
SRYQLEDEVCGLSQYLSGQKPLEEIRYATSVENLHMVFSGPYSPNPAELLEEELFGALIRQMRQEYDYLIIDTPPMGNLI
DGAIVGRQCDGAVMVVESGAVSYRLEQRVKNQLEKSGCRILGVVLNKIDPEYNSYGYYTRYGKYGKYSRYEKYAKNDKSE
ITEG
>gnl|bykdb|A0A1I0FNB1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Clostridium] lavalense] (length=239 residues).
MSDAVCLKHVEKGDYAYEEAIKTLRTNIQFCGSNLKTVMFTSSMPDEGKSEVVMALAVSLASIGKKVLLVDADIRKSVLI
TRHGVRGRINGLSQYLSGQKTMEEILYHTNIEGMDIVFAGPYSPNPAELLEENSFKELIRAAREDYDYLLIDTPPMAGLI
DGAIVAGLCDGAVIVIESGAISRRLVQRVKAQLEKSGCRILGVVLNRMDTSRDRYYGKYGKYNSYKRDAYEQYYEKKKE
>gnl|bykdb|A0A1I0RLQ5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Clostridium] fimetarium] (length=225 residues).
MTAINIERKENLDYKSNEAYKSLRTNIQLCGSDIKVIMITSTAPNEGKSMVSFNLAVSLSETGKKVIFIDADLRKSVMVG
QYMINMSVMGLTHFLSGICKFEEVVYSTNYENLDTVFAGPVEPNPAELLSDISFKHLISTLRETYDYIIIDTPPLGNVID
GAIVAQECDGAVFVIAAKFVSHKFVKNAVAQLKKTDCKILGAVLNKVDMSENGNYGKYYGKKYGK
>gnl|bykdb|A0A1I0RLX5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Clostridium] fimetarium] (length=226 residues).
MAAINIEGIRKLDYRSNEAYKNLRTNIQLCGSDVKVIMVTSATPNEGKSSVSFNLAVSLAESGKKVIFIDADLRKSILVG
RYKINKSVKGLTHFLSGICKFEEVMYATNVENLLTVFSGPVPPNPSELLGNKTFKLLIKTLRETYDYVIIDTPPLGNVID
SAIVAQECDGAIFVIAANTISYKFIQNTMVQLKKTDCKILGAVLNKVDMSENGYYSKYYGKYYGKY
>gnl|bykdb|A0A1I0TBL6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Parageobacillus thermantarcticus] (length=232 residues).
MAVSNRKKFQKMERNLITFEDPKSPISEQYRTIRTNIQFSFIDETMRSLMVTSAGPAEGKSTTAANLAVVFAQQGKKVLL
IDADLRKPTAHYTFRLNNYAGLTSVLTHSSSLSSACQETGAENLYVLTSGPIPPNPAELLSSKTMDNCLRELQSEFDLII
FDTPPVLAVTDAQILANKCDGTILVVASGKTEIAAAVKAKELLEAANAKLLGVVLNQRKHREGQHYYYYEYK
>gnl|bykdb|A0A1I0TSS9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anoxybacillus pushchinoensis] (length=220 residues).
MRSLITKTNPKSPISEQYRTIRTNIQFSVVDRPLRSIMVTSSAPAEGKSTTVANLAVVFAQQGKKVLLIDADLRKPTVHY
TFRKDNYIGLTNVLTKQAPFQAAVKETDVDNLFVLTSGPIPPNPAELLGSSAMEELLAEAYKQFDLVLFDTPPVLAVTDA
QILANQCDGTILVVHSGKTEIEAAQKAKELLINAKGKLLGVVLNQKKQKESSYYYYYGNK
>gnl|bykdb|A0A1I0XKJ6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lentibacillus halodurans] (length=233 residues).
MARRRKKNQSKNSKIRHLVAKVNPKSPIAEQYRTVRTNLEFSSADSELKSLLLTSSGPAEGKSSSIANLAVTYGQQGKKV
LLVDADMRKPTVHYTFRLDNLSGLSNILVGDTSLQDTAANTDVENLDVVACGPIPPNPSELLGSKKMEQFIQEAKMSYDV
ILFDTPPVLAVTDAQILSNMVDGSMLVIRSKQTEYETAGKAIDVLQSSTAKFLGTVLNDVEKKKMNYYYYYGV
>gnl|bykdb|A0A1I1ECI4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Butyrivibrio sp. YAB3001] (length=274 residues).
MQSAKLHFSQSENNYQIKEAYKTLRSNIEFSGQNVKVVSVTSCTPGEGKTSVAMALARAFAEAGKKTVLVDADMRKSVLV
GRYRTGSVRLGLTHCLVGRERLSSVICETDTPNLYVVFSGPVPPNPSELLGGRIFGKVLENMKQVFDYIIVDTPPLGSVI
DAAVVAKQCDGTVMVIESNTISYRFAQRVKDQLDKAGAKMLGVVLNKVDISGKGYYGHYGNYYGKYYGKYYGKYYGKYGE
DNIDIPKPRNIVEAQQDEDDMDELNYLAGVMRKD
>gnl|bykdb|A0A1I1G1F8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus albus] (length=262 residues).
MASINRNRGIGGRNTVRRTLLDKEVAFPVTEAYKTLRTNISFALSTKKNKIFAVSSALASEGKSTVAANIAITLAQNNDH
VLLIDGDLRKPVQHRVFTLKNEVGLSTLISGSNTFKEIVHHEVIENLDVVPCGPIPPNPSEMLGSDNMKMLLEQLSAHYD
YIVVDTPPINIVTDALTLLDSIAGVLLVANHGKSTYDALEESIQAIKMADGSLLGIVVNNVSVSGGKYGGKYSYKYKYGY
KYGYGYGNYGDNTTKPLGENKD
>gnl|bykdb|A0A1I1GEU1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Alkalibacterium subtropicum] (length=234 residues).
MFNKRIEESSGNRLALVVKNNPSSVLTEQFRTIQTNIRFSMVNKRLQTMVVTSATPSSGKSTISANLAATFASKNKRVLL
VDADLRKPTVHKTFNVRNNDGLTTLLTDDDTKVVDVIYHTHTEGLYILTSGIIPPNPAELLASDRMLEIQEEMKTYFDLI
IFDSPPVLPVTDSQVLAAETDGVIFVIPKGRVKTDEVLKAKELLEMTQANILGAIMNRVETSGDHYYYYYGDKE
>gnl|bykdb|A0A1I1GI15 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Alkalibacterium subtropicum] (length=232 residues).
MLFKKKKQLNQTSPGLVTLNKPMSHISEQFRTIRTNIQFSMIDDTLKSIVVTSANSDAGKSTLAANLASTFASEEKRVLL
VDADLRKPTVHKIFSVRNTEGLTTLLTDREAELDDLVVRTRSAGLYVLSSGAIPPNPAEMLGSNRMKEVEKEMMAAFDLV
IFDMPPVLVVTDAQVMASRADGVLFVIPKGQEHKDSILKAKDLLDKVQANVLGAVLNKVEDTDTYTYYYGLD
>gnl|bykdb|A0A1I1JW12 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. OV322] (length=230 residues).
MAPKKKLFEHKRKLVTRLNPKSPISEQYRTIRTNIQFSSVDKEIRTLVVTSSGPTEGKSTTVANLAVVFAQQGKSVLLID
ADLRKPTAHYTFNLTNTFGLTTVLTKQMELREAAVKTKEKNLYILTSGPIPPNPAELLGSRAMEEFMDDVQEEFDIILFD
TPPLLTVTDAQILANRSDGTILVVSSGRTEKDAALKAKEALVTVNATILGIVLNNKKVKEGQYYYYYGGK
>gnl|bykdb|A0A1I1PJE5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. UNCCL81] (length=231 residues).
MVKKTAKEKLKRFLITLTNPKSPFAEQYRTVRTNIQFSSVDKKIKSILVTSSEPSEGKTTTIANLAVTYAQQEKKVLLVD
ADLRKPQLHSDFKLENFKGLTTAIAQEKSLKDVIQKTDISNLSILTSGPIPPNPSELLSSERMKKLIAQMHEQYDVILFD
APPLLAVTDAQIISQVCDGTILVVRRGYTAKEKIKKAKELLTLVNANILGVVLNRAEQDKDGYYDYYGSEK
>gnl|bykdb|A0A1I1W0J8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lentibacillus persicus] (length=230 residues).
MARKRKKNQSKMRHLVSKMNPRSPIAEQYRTVRTNLQFSSADHELKSLIVTSSGPEEGKSSSAANLAVVYAQQGKKVLLV
DADMRKPTVHYTFRLDNLNGLSNILVGDATLQDTVTFTDVDNLDVISCGPIPPNPSELLGSRKMEQFIKEAKMAYDIILF
DTPPVLAVTDAQILANICDGSMLVIRSKQTNYESAEKSVEVLTSATAKFLGTVLNDVEKKKANYYYYYGT
>gnl|bykdb|A0A1I1XYD1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus catalpae] (length=232 residues).
MQQSTIEKSKLITTINPDSPIAEAYRSLRTNILFSSIDEPVKTLMVTSCQSGDGKSTTIANLAVAFSQEGKRVLLIDADL
RRPSLHTFFMQSNQTGLSNVLANQMEWQDAVHSTSIDNLFFIASGPTPPNPSEMLGSKKMNQFIEELTAHYDMILFDAPP
SLVVTDGLVLASKCDGVVAVISVGMTKRQQAKKMYASLEHVKARLLGVVLNNKKKKSKEQPYYTYYGTNRRM
>gnl|bykdb|A0A1I2BL52 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Alteribacillus iranensis] (length=236 residues).
MKKLARKSRKNKSSSSRNLVTWEDPKSTVSEQYRTIRTNIQYASVQREMKTIVVTSAGPEEGKSTTVANLAVTMAQQGKK
TLIVDADLRKPTVHYTFRTMNTHGLTNVLIHQSRFSEVIQETTVENLFILPSGPIPPNPAELLSAKKMEQLLLEAKQEFD
VILFDTPPVLPVTDAQILAGQSDGCILVIRNGKTDKQAGMKAKELLEKADATMIGAILNERKISQKQEYYYYYGKS
>gnl|bykdb|A0A1I2DJI2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus rogosae] (length=232 residues).
MQTINIERLRKLDYRANEAYKNLRTNIQLCGSDIKVIMLTSTTPGEGKSTVSFNLAVSLAEAGKKVIFIDADLRKSVLVG
RYKINTSVKGLTHFLSGINKFEEVMYATNVENFNVVFSGPVPPNPTELLGNKVFKTLIKVLRDLYDYIIIDTPPIGSVID
SAIVAQECDGVAYVMAANDVSYKYAQKGLEQIKKTDCKLLGVVLNKVDMDDNKYYGKYYGKYYGKYGEHANK
>gnl|bykdb|A0A1I2DV59 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus catalpae] (length=230 residues).
MSQSENKRRLISVVNPRSPVSETYRTLRTNIEFAAIDSALQVIMVSSAGPGEGKSTTIANLAVTYSQSDRKVVLIDADMR
KPTAHKTFQISNRFGLSSVISQQSTLQEVIQSTDIPNMDVITAGPIPPNPAEMLASKRMTALLDELRTMYDIVLVDTPPL
LAVTDAQIAATKSDGVVLVVDQGRVKRQFAQKAIQNLQNVNARILGVVLNNVKRRSNEEAYYYYYSADVK
>gnl|bykdb|A0A1I2DZ30 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus catalpae] (length=228 residues).
MSRSDLKIRPVVADANPTSPISEAYRTLRTNLQYAETDRPLQLLMVTSAGPEEGKSTTIMNLAVTYAQMERRIILVDADL
RKPTAHFTFGLSNRTGLSHVLSGQADLKEVIKESRIPGLDVLTSGPVPPNPSELLGSSRMDDLLGKLREQYDMVLIDTPP
VLAVTDAQVVASRCDGVLLVVNARTGKRQHAIKAKNALQFVQARIVGIALNQTAHRDAGPYYEYVDRT
>gnl|bykdb|A0A1I2EK32 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus rogosae] (length=309 residues).
MQTINIETNQQDDYQVRESYRNLRTNIFLSGKDTKVVMFTSCGPNEGKSTVTMNLASSIADGGKRVLFIDCDLRKSVLVG
RYRVKKGVKGLTHFLSGQNTLEEVIYQTNVPDMDVILAGPVPPNPSELLDSPLFKETVRQMREKYDYVIIDTPPLGSVID
AAIVAQVCDGAVLVIAANQVSYKFAQNVMGQLKKTKVKIIGSVLNKVDLSENGYYGRYYGKYYGKYYGSYYGHYNSEESP
DKSFEKARNASSARKNTNNASKPVKRQAGSVGEVAARKKANVAGNNTGVRKKPSADEFDGDFLMDYDEK
>gnl|bykdb|A0A1I2F4H1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. OV194] (length=233 residues).
MSRKLRKTISNLTQRSLITHNNPMSPISEQYRTIRTNIQFSSIDKQYKTLLVTSAGQGEGKSTTVANLAVVLAQQGKRVL
VVDGDLRKPTVHYTFRVSNIQGMTSVLTKQLTFEDAVQKTNIDHLYVLPSGPIPPNPSELLNSKAMEALVEEANSKYDYV
LFDSPPVLAVTDAQILSNRCDGVVLVASSGRTEKEEALKAKELLENANAKILGVVLNGKETNDSSYYYYYGSK
>gnl|bykdb|A0A1I2GII3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus algorifonticola] (length=230 residues).
MRRLTSETNLVALTNPNSPISEVYRTLRTNIQYAEIDTPKQILMIASSQPDEGKTTTITNLAVTIAQEERKVLLVDADMR
KPSLHQVFDKPNRIGLSSVISNQFSWQEAVMDTMVEHLSVITSGPIPPNPSEMLGSNKMKALVQEWKNHYDVILFDTPPV
LAVTDALIVSAFCDGVVLVVLAGKVKKEMVKKMKANLDRVQAQIVGVVMNKINPKDSEDIQLQYYETVRS
>gnl|bykdb|A0A1I2GRM1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus algorifonticola] (length=225 residues).
MSRSKPNWPLITETNPKSPISEAYRILRTNIDFSNLEEEIRTLMVTSTKMNEGKSTTSANIAVTYAQSNKKVLLIDADMR
KPTQHQLFRVSNQVGLTSVLSNQKEWEAAIQTTSVSGLSILPAGPVPPNPSEMLASKRMDQLLEKMKERYDIIIVDTPPI
MVVTDAQIVASKSDGVVLVIDSGTVKKEAAIKAKASLEHVKARILGVVLNKIKRSSSEGYLYYYQ
>gnl|bykdb|A0A1I2K164 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Halobacillus alkaliphilus] (length=232 residues).
MALNKKQKNQQTSVRTIIANDNPKSPISEQYRTIRTNLQFASVDKELETMIVTSAGPSEGKSLTTANVAVVFAQQGKKVL
LVDADLRKPTVHYTFRADNTSGLSNYLVRNRSLKELAKESRIENLDLLPSGPIPPNPSELLGSTMMEKLIEEAKEHYDII
IFDTPPVLAVADSQVLSKFVDGALLVVRSKQTEQEAAGKAKEQLEQSRANILGVVLNDMDAKDSNYYYYYGN
>gnl|bykdb|A0A1I2SGT2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus megaterium] (length=236 residues).
MARNKKNQKDDKMLTLKRRLLSHNSPKDPVAEQYRTIRTNIQFSGTDEEIKSLLLTSSGPSEGKSTTAANLATVYAQQGL
NVLLIDGDLRKPTAHYTFRLENHTGLTNVLTRQSSLGQAVQSTEVPNLYVLTSGPIPPNPSELLASKQMGEVLDEMKERF
DMVIFDTPPILAVADAQILANQVDASLLIVSSAKTEKDAALKAKELLTQAKSKLLGAVLNNRKMEEGNYYYYYGSN
>gnl|bykdb|A0A1I2UJG9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lachnospiraceae bacterium C7] (length=228 residues).
MREIRINYMRDEKDFRTNEAYKTLRTNIEFAGDINKSIVLTSCTPREGKSSIALGLAVTLTEAGKNVVFVDADLRKSVIA
GRCGIRGKVKGLTHLLAGRASITEVLFRTNISGLHMIFSGLVPPNPSELLGGKRFEQLIMFLRDHYDYVIVDAPPIGSVI
DAAVVAKNCDAAVLVVEQGKITGKFIQQTKMQIEKAGCNILGVVLNKVDLSNDKYYGKYYGQYYGEQA
>gnl|bykdb|A0A1I2W0G0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Sporolactobacillus nakayamae] (length=233 residues).
MRRNKQSLSKQRHLIAFYKPKSTTAEQFRTIRSNVDFSQVDSELKTIMLTSSGPGEGKSTSSANLAVVMAQQGKRVLLID
ADLRKPTMHYTFRLSNTEGLTTLLRKLTTFDDSVKKTEVDNLFVLTSGPIPPNPAELLSSVGMASFIKHALTLFDTVIID
TPPILAVTDAQVLANLCDGAILVVRSGVAEKEAALKAKDLLTKAKARILGVILNAKPINKGSDYYYYNYYGND
>gnl|bykdb|A0A1I3AAB2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lachnospiraceae bacterium NLAE-zl-G231] (length=308 residues).
MQTVTFNAIEKLDFRTKESYKTLRTNLEFSGKDRRVISITSSTPNEGKTSVSFQLAMSIAEGGKKVILVDADLRKSVLKG
RYKSNAARYGVSHYLSGQASISDIFCKTNIPNFYVIFSGPVPPNPSELLGNDAFRILLEYLRKEYDYVIVDTPPLGSVID
GAVAARYCDGTLIVIESGAISYKFAQKVKEQLEKVDCRILGVILNKVNMSGKGYYGAYYGKYYGKYYGKYYGNNEEGGLH
AAVVQKGLKNGKAAKGEENTHSHEIKNGSDPVKEKIPEENQIPEDDMIQLDIDMVELTEDTEPIEELK
>gnl|bykdb|A0A1I3AVI1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pisciglobus halotolerans] (length=235 residues).
MFNKKKKTHYRPKHEIVTITRPQSFIAEEYRTLRTNIQFSMAGKKLQSLQLTSSSPNEGKTTIAVNTAVVFASQGKKVLL
VDADMRKPSLHDLFQVPNQKGLSTILTEEYPDPEATIYPLPHEHLFLLPSGIQPPNPSELLASEQMNRLIQYFKEQYDLI
IFDLPPVLPVTDALIMSDKVDGTVFVIRHHTAHLHEVLQAKEMLERVQANVIGAVFNGKPNDKKISGTYYKQDDQ
>gnl|bykdb|A0A1I3BA72 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lachnospiraceae bacterium NLAE-zl-G231] (length=308 residues).
MQTVTFNAIEKLDFRTKESYKTLRTNLEFSGKDRRVISVTSSTPNEGKTSVSFQLAISIAEGGKKVILVDADLRKSVLKG
RYKSNASRYGLSHYLSGQASISEICCKTNIPNFYVIFSGPVPPNPSELLGNDTFELLLEYLRKEYDYVIVDTPPLGSVID
GAVAAQHCDGTVIVIESGAISYKFAQKVKEQLEKVDCRILGVILNKVNMSGKGYYGAYYGKYYGKYYGKYYGNDEEGGLH
AAVVQKGTKAAKAVKGDTSERSHEGKNGSGSGKEKGLEENGYPEDDMIQLDIDMVQLVEDTETIEELK
>gnl|bykdb|A0A1I3BJX9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lachnospiraceae bacterium NLAE-zl-G231] (length=308 residues).
MQTVTFNSIEKLDFRTKESYKTLRTNLEFSGKDRKVISITSSTPNEGKTSVSFQLALSIAEGGKKVVLVDADLRKSVLKG
RYKTNAARYGLSHYLSGQASISDISCKTNIPDFYVIFSGPVPPNPSELLGNDAFRLLLEYLRKEYDYVIVDTPPLGSVID
GAVAAQHCDGTVIVVESGAISYKFAQKVKEQLEKVDCRILGVILNKVNMSGKGYYGAYYGKYYGKYYGKYYGNSEEGGLH
AAVVQKGTKGAKAVKGEGNLHSHDNKSTRESGKEKTAEEGVIAEDDMIQLDMDIVELAEDTELIEELK
>gnl|bykdb|A0A1I3DJC5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pisciglobus halotolerans] (length=237 residues).
MFKKKSRELRSNGERPSLITLTRPSSVIAEQFRTIRTNINFSMIDNDLKTISVTSAGPGAGKSTISANLAVTFAQEGKKV
LLIDTDLRKPTVHKTFHVPNRDGLTTLLTDRETEITDIVHHTETDNLYLITSGIIPPNPAELLGSNRMTQLIDGLEQIFD
LVIFDLPPIVAVTDAQIISNKTDGTIFVINKGGADKEMVLKAKELLEKVNANILGAIFNRVEIEENHYYYTYYGEDK
>gnl|bykdb|A0A1I3LV28 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. UNC496MF] (length=229 residues).
MPQSSTNHNLITMENPKSPISEAYRSLRTNIQFSAIDQNMKVLMVASAKSGEGKTTTVTNLAITYAQEGKSVLLIDADLR
KPSLHQVFQLTNRTGLTSALMNQHALPELIRSTSVDNLSVITSGPIPPNPSEILGSQRMLSLLEEFKGMYDVILFDTPPV
LAVTDSSIVSSFCDGVILVVLAGKVKKDLVKKAKASLDHVKAKILGVVLNNNTRSKSGEHYYYYYGTRE
>gnl|bykdb|A0A1I3R032 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Terrisporobacter glycolicus] (length=229 residues).
MLGLYDSGCFEVNEAYREIRTNISLNTDLKTIVFTSAEMNEGKTTTACSIAKCFSDLENHKILLIDCDFRKKSVANTLEI
DNKKGIADVIINDMDMKECIKKVDEFDVLTCGISPSNTSVLLESKKFRDAIENLKGDYDYIFIDSPPLGRLNDAAILARY
SDGTIIVNASESIDQQMAKVTKDKLEKVNANVIGVVLNKFKSDDHKYYKYYGYYEDEKKKSFFRRSKRR
>gnl|bykdb|A0A1I3R106 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Terrisporobacter glycolicus] (length=248 residues).
MGKIADLDPKSPLAEAYRTVRTNISFADIDNNLITIMFTSTKQNEGKSTTICHVAHAFSRLENTKVLVVDLDLRNPSVHK
MFGIGNTYGVMDYLKNTRDLDKCINKVEENIHVLTPGAIPPNPTEILSSKKMQNFIKDVESQYDYVFIDAPPVGIVSDGI
IISKYTDGVMFVVGANETDINHTKEVIENMRKSDVNIIGSILNKYDMENNAYGYYGYYYQQDDGKHGRKNKKKKKTGLFG
KKKLNSVR
>gnl|bykdb|A0A1I3YZC3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Marinilactibacillus piezotolerans] (length=233 residues).
MLFKKKKDTNLNDRPGLVVLNRPTSVVSEQFRTIRTNIQFSMIDETLKTIVVTSAGPSSGKSTVAANLSATMASDDKRVL
LVDADLRKPTVHKTFNIRNSDGLTKLLTDRMTKLEDVIYRTHTEGLYLLTSGAIPPNPAELLSSKRMSEVIKEMGQYFDM
IIFDMPPVLAVTDAQVLSSKVDGVLFVIPKGEVSKDQVIKSKELLENVKANVLGAVLNKVAKSDDDYYYYYGE
>gnl|bykdb|A0A1I4NCW3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. 5mfcol3.1] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDMNLHSLLVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSIDNLSFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKENAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A1I4PFC2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Gracilibacillus orientalis] (length=230 residues).
MARGKKQFKLNNVRHLITKMNPRSPISEQYKTIRTNLQFSAVDGELKNILVTSSGPSEGKSSTTANLAIVFAQQGKKVLL
IDADMRKPTLHYTFRIDNRRGLSSVLVGETELRESVTSSDVAGLDLLTCGPIPPNPSELLGSKAMENLISNAGLDYDIVL
FDTPPVLAVTDAQILANICDGAVMVVRSKQTEYDAATKAKDLLEVGNAKLLGVVLNDREQKKGHYYYYGN
>gnl|bykdb|A0A1I4PIU8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Psychrobacillus psychrodurans] (length=238 residues).
MVRKKIEKKKKSFQTAARKLVTGLLSKSIVSEQFRTLRTNINFSMPDKELKTLLFTSSSPGEGKSTVAANMAVVFSQEGK
RVLLVDADMRKPTVHHTFHITNTEGISDLLSRKSVLEDVVKTCEIDNLSIITCGPIPPNPAELLSSQTMQKLLEEMTDKY
DLIIFDAPPVLSVTDAQILSNKCEGTVLILNSGNTEKNALLKAKEALNSSKANILGVVLNNFKLQKNHYYYQYYGNVE
>gnl|bykdb|A0A1I4S672 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Psychrobacillus psychrodurans] (length=231 residues).
MFKKKRMHHGRKLVISTDRKSIVAEQIRTVRANIKFAMKDKECKTLLVTSTSIGEGKSTIASNIAISFAQEGQKVLLVDA
DLRKPTMHYTFNKPVSPGLTNFLMSNWCLSNILKDSGVVGLDLITCGPMPSNPAELLGSSTMNIFLEETISLYDLIIFDA
PPLLSVADAQILSAKCDGTILVTSSGTTEKRNLYKVKEVLEVSNANVLGLILNHFKLEKNHYYYEYYGEKD
>gnl|bykdb|A0A1I5BR82 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Proteiniclasticum ruminis] (length=236 residues).
MKSNLVTLTDSKSVAAEAYRTLRTNIQFSSYDQEVRVITVTSSRPAEGKSTVACNMAITFAENGKKVLLVDTDLRRPTVH
KKFKLPNSLGIVNLIMNMEMLDEVVHHNVTEGLDIITSGVIPPNPSELLGSRKFQRFVDEMRDQYDTIILDSPPLLAVTD
AQVLTTLSDGTVVVAQHGVTKKDEISQAKDLLEKVKGNILGVVLSQIPPEDNGYYYYYSYEDKKTAAAKNARRSKK
>gnl|bykdb|A0A1I5H6A4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Eubacterium callanderi] (length=247 residues).
MSCTKSLRKKESGATKMKNRIVTSLDPKSTNAEVFRNLRTNVFFAEVDHPLRTIVMTSTCGGEGKSTILSNYAVTLADMG
KRVVLVDCDLRKPMLGKLFDKTTKRGLTNVLIGNKSLEESLYETEVERLNLLDAGPLPPNPSELLGSAVMRKTLNALKER
YEYVLIDTPPIGAVTDAMMLKDIVDGYILTVEIDRLDKRELEQSVETIRKSQAYFIGTVLNKAPVHKSHYSYYGYYGYYP
ETYGEEK
>gnl|bykdb|A0A1I5JNF4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Acidaminococcus fermentans] (length=242 residues).
MEEIKLIVANDPKSPLSETYRAIRTNLQFAQAGDALKFICFTSSVPGEGKSTTISNLALTVAQDGKKVLLVDCDLRKPVQ
HKIFGVINQGITNCLAQGVPLAQVLHPNVFPNLDLLTSGPVPPNPAELIGSEKLSNLLDKAAENYDYVFIDLPPVLAVTD
AALMGNLSDGVVLVVRSGLVSPEEVQEAKKRLQAGHANILGVVLNGVPQQHKGYGYGYYYYDYYDENHEKHHKKRAKSSS
HS
>gnl|bykdb|A0A1I5M2B7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Eubacterium callanderi] (length=244 residues).
MKDSIITYKSPKDPISEAFRNMRTNITFADIDEELRVLTITSTGKGEGKTTIIANYAVALAQSKKKVLLIDCDLRRPRIH
RLFEQPNKRGLTNILLRECEPTEAIQTTDVENLFMISSGPIPPNPSEILASKRLIELINQFKLAFDYILIDAPPVGVVTD
AAVLSHVTDGYIVVAAISVTNKEGVRMALETLRNVNGNIVGVVANNAPVSKRSGYYYYYSAYEEDQHQSKKEKKHRKIKE
KRGK
>gnl|bykdb|A0A1I5M9J1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Halolactibacillus alkaliphilus] (length=181 residues).
MITSSGPGEGKSSTTANLALVFAQQGKKVLLVDADLRKPTAHYTFRVDNRVGLSSVLVGEMDYLKAVDASEEENLDILSS
GPIPPNPSELLGSKAMQHFIEQAKESYDLIIFDTPPVLAVTDAQVLANLVDGTLFVVRSKATDQESAKKAKELLAPAKAK
LLGAVLNDKEVSKNSYYYYAN
>gnl|bykdb|A0A1I5QG69 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Halolactibacillus halophilus] (length=229 residues).
MARREKQAKQMFRHLITRNNPRSPISEQFRTIRTNLQFSAVDGDLRTMLVTSSGPSEGKSSTVANLAVVFAQQEKRVLLI
DADLRKPTVHYTFRADNRRGLSSVLVGDFSLLDAVSKTEESTLHVLPSGPIPPNPSELLGSKAMVKLIEEAKEIYDLIIF
DTPPVLAVTDAQILANIVDGSLLVVRSKVTDKEAALKAKELLLPAKSKLLGVVLNDKEMPKGHYYYYGH
>gnl|bykdb|A0A1I5T8K5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Butyrivibrio proteoclasticus] (length=275 residues).
MQSAKLHFSQSENNYQIKEAYKTLRSNIEFSGQNVRIISVTSCTPGEGKTTVAMALARAFAEAGKKTILVDADMRKSVLV
GRYRTGSVRLGLTHCLVGRERLSSVICETDTPNLYVVFSGPVPPNPSELLGGKIFEKVLENMKQVFDYVIIDTPPLGSVI
DAAVVSKLCDGTVMVIESNSISYRFVQRVKDQLDKAGAKILGVVLNKVDISGKGYYGHYGNYYGKYYGKYYGKYYGKYGE
DTAENQPRPKPAEPSPPDDDDLEELNYLAGVTRKD
>gnl|bykdb|A0A1I5XCL3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Desemzia incerta] (length=234 residues).
MFNHKKTSHSEKLNSLITLIKPSSIISEEFRTLRTNIQFSMVDKQLSTLMFTSAAPGEGKTTVASNVAVVFASQGKRVLL
IDADMRNPSIHRLFNFVNHRGLTNLLTENKTTIQDVVHRTTKKNLFVLTCGLIPPNPSELLASKRMDQLIENLKKHFDMI
IFDLPPILAVTDAQVMANKTDGTVFVIRNGVAEKNNLYKAKELLEHVHANVIGVVYNDKKREENPAYQYYGIEE
>gnl|bykdb|A0A1I5XPV2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Caldicoprobacter faecalis] (length=258 residues).
MLKSTRLAIHADPKSPVAEAYRILRTNIEFSSTDRKIKVILVTSSGPAEGKSTTAANMAIAMAEANRRVLLIDCDLRKPA
IHRMFGLVNIKGLTNILVEGLKYSEIANVTEVENLEIITSGPKPPNPSELLGSKRMREFLDKVREDYDMVIIDTPPVLPV
TDAAVLSQYVDGVVLVAGYGLTTFDAAVQAKASLQKVNARILGVVLNGVPVDRRGGYYYYYYYYYDESGRKKKRRRVTME
QPLSVDGISISRSEGMNL
>gnl|bykdb|A0A1I5Z5W1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Psychrobacillus psychrotolerans] (length=236 residues).
MAKKKNRKRIIQTVARKLVTSANSKSIVTEQFRTLRTNINFSMPDKEIKTFLFTSSSPGEGKSTIAANAAVVFAQEGKRV
LLVDADMRKPTVHYTYHVTNTIGLSNLLTRQATLEEVVKDTEIENLQIITCGPIPPNPAELVGSQTMDRMIDEMKEKYDV
IIFDAPPVLSVADAQILSNKADGTILVMSAGETEKTEILKAKEALVSSNANIIGVVLNNFELSKDHYYYQYYGNVE
>gnl|bykdb|A0A1I6A177 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Psychrobacillus psychrotolerans] (length=230 residues).
MFKRRKKVKPIARKLVTSSNPQSIISEQFRTVRTNIKFSMPNREIKTLLFTSSSIGEGKSTIAANVAIVFAQEGKKVLLI
DADLRKPTMHYTFLKTITPGLTNLLTGHWNLNQVVKETGVNGLDLITSGPIPSNPAELLGLPSMDMLITEVKEKYDIIIF
DAPPILSVSDAQVLTDKCDGTILVISSGSTEKGNAIKAKEVLQASKANILGTILNNYKIGKDHYYYQYYG
>gnl|bykdb|A0A1I6BG88 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. ok634] (length=229 residues).
MVLKKKILRARRQLIAYEQPKSSVSEQYRNIRTNIEFASVDKKIRSLIVTSANQSEGKTTTAANIAVVFAQQGKKVLLID
ADLRKPALHQMMQVDNIFGLTSVLTRSNTLETCVTQTKIGNLTFLPCGPIPPNPAELLGASSMKDLLSEAFGTYDLVIFD
TSPILPVTDAQIMANQCDASVLVIRSGVTEKEAALKAKQSLDSAKGTLLGVVLNDKEQNGSEYYYYGSN
>gnl|bykdb|A0A1I6C5M8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. cl95] (length=239 residues).
MGLKDLFTRKNKKINVMEHRRKLITTFDPKSPISEQYRTIRTNIQYSAIDENIKTLLVTSSGPAEGKSTTAANLAVVFAQ
QGKKVLLVDADLRKPTVHYTFGTANTFGLTTVLTKQTTLEKAVVESDEKNLFILTSGPIPPNPAELLSSQSMEQLLTQVA
EQFDMVILDTPPLLAVADPQILSNQCDGTILVVFSGKTETEQVLKSKELLQAAKSKLLGVVLNNKQIQKSNYYYYYGSK
>gnl|bykdb|A0A1I6CZQ7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Desulfallas geothermicus DSM 3669] (length=230 residues).
MLYHKLVAWHDPKSPIAETYRILRTNIQFMSIDSKIKSVLITSSSPNEGKSLTTSNLAISMAQNNNKVIIIDGDLRKPVL
HDLFDVSSGPGVTDVLLGQVEITSALQETVVENLRVLTSGQLPPNPAEMVGSARMKQLIREAENIADVVLIDSPPLLPVT
DGALLAAGVGGVIIVITRGLTKKNQAIKAKEIINSSQARLLGMVFNKSGTERKGYYYYYYSGKQNNNAPK
>gnl|bykdb|A0A1I6PF45 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. 453mf] (length=229 residues).
MPRSTNNSHNLVTATNPKAPISEAYRTLRTNVQFSAIDEQIKVLMVASAHSGEGKTTTVSNLAVTYAQEGKKVLLIDTDL
RKPSIHQVFRVSNHAGLSSALAGQYLVQEVLQKTSLYNLDVLPSGPIPPNPSEMLGSKKMVTLLEELKKTYEMILFDTPP
VLAVTDAMIVSSLCDGVIMVVGSRKVKKELVKKAKSRLEHVNSRLLGVVFNNLQLDKNQSSYISYYGEK
>gnl|bykdb|A0A1I6UNV6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. BC26] (length=229 residues).
MSQQDNKQRHLISAINPMSPISEAYRTLRTNIQFSAIDQPMKVLMVASASEGEGKTTTVTNLAVTYAQEGKKVLLIDTDL
RRPTLHHVFQLTNRSGLTSAILNQQVLADVIRETSVENLFVLTAGPIPPNPSEILGSQRMQLLVEELKGLYDVILFDTPP
VLPVADSLIVTSYCDGIILVIHAGKVKKELLKKAKTSLEHAKSRILGVVLNNNERSKHDGQYYYYYGRK
>gnl|bykdb|A0A1I6V2V6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Halolactibacillus miurensis] (length=226 residues).
MARREKQTFRHLITRNNPRSPISEQYRTIRTNLQFSAVDGDLSTMLVTSSGPSEGKSSTVANLAVVFAQQEKRVLLIDAD
LRKPTVHYTFRADNRRGLSSVLVGDYSLLEAVSKTDEATLHVLPSGPIPPNPSELLGSKAMIKLIEEAKQFYDLIIFDTP
PVLAVTDAQILANIVDGSLLVVRSKVTDKEAALKAKELLLPAKSKLLGVVLNDKEMPKGHYYYYGQ
>gnl|bykdb|A0A1I6VJ54 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. 103mf] (length=234 residues).
MVLKSLFKKKKNHRQRRQLIAYHQPKSPISEQYRNIRTNIEFASVDMKIHSLMVTSANPSEGKTTTTSNIAVVFAQQGKR
VLLVDADLRKPATHQMFQIENIFGLTNVLTAGEQLEKCIQKTAVDKLDFLPSGPIPPNPAELLGSNAMKELLSQTFSLYD
LVIFDLPPILPVTDAQIMASQCDASVLVVRSEQTEKEAALKAKTLLESAKGKLLGVVLNDREREQSLYYYYGAN
>gnl|bykdb|A0A1I6VJ80 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. 103mf] (length=224 residues).
MFFRKRLQSKRKLIAYEKPQSVLAEQYRNIRTNIQFASIDQKIRSLVVTSANQGEGKTTTAANLAIAFAQQGEKILLIDA
DLRKPVLHQLFRVDTVFGLTSVLSKQRTLQECIAKTDIENVHLLACGPIPPNPAELLGSTMMGELLQEAKEYYDLILFDT
PPVLAVTDAQIIANQCEGTILVLRSEKTEKEQALRAKNVLHHANTTLLGVVLNAKPQSEHTYGY
>gnl|bykdb|A0A1I6WH40 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. BC26] (length=230 residues).
MSKLGNSRYLITYYEPKSPISEAYRAMRTNIDFSSVDDHIQVVMGTSASPGEGKSTTIANLAVVYAQANKKVVLIDSDMR
KPTMHHTFGISNRNGLSSMLSRQCDLDEAVHATDIPNLFIMPSGPVPPNPSEMVASQRMSALIEELRTKFDIVLIDTPPT
LAVTDAQLISTKCDGVLLVIESGKVKRDAVIKAKQQLNHVKARILGVVLKNIEQKNSDGYYYYYYSETEK
>gnl|bykdb|A0A1I7G5F9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Alicyclobacillus macrosporangiidus] (length=235 residues).
MALSNRNPQPITIAQPKSPVSEAYRNVRTNIQFSTAVNGARTLMFTSSVPEEGKTSTATNVAVVSAQAGKRVLLVDADLR
KPQVHHRFQVSNLDGLSTVLIRERSLEECVIASRVPNLFLVPSGPIPPNPSEMLSSRMFVDFLQHCADEYDLVMIDTPPV
LSVTDALIVSRQTDGVVFVVNALKTNRNLARQAVAALEQVNARVLGVVLNRVQQRDRQYGYAYSYYYASEEKLSM
>gnl|bykdb|A0A1I7GU36 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Butyrivibrio sp. INlla21] (length=276 residues).
MQSAKLHFSQAENNYQVKEAYKTLRSNVEFSGQNVRVISVTSCTPGEGKTTVAMALARAFAEAGKKTILVDADMRKSVLV
GRYKTGSVRLGLTHCLVGRERLSSVICETDTPNLYVIFSGPVPPNPSELLGGRIFSKVLENMKQVFDYVIIDTPPLGSVI
DAAVVAKQCDGTIMVVENNAISYRFAQRVKDQLDKAGAKMLGVVLNKVDLNGKGYYGHYGHYYGKYYGKYYGKYYGNGGD
SDSSSMTRPKAPEPDIGLDDDDLDELNYLAGVTRKD
>gnl|bykdb|A0A1I7HU40 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Butyrivibrio sp. M55] (length=277 residues).
MQTAKLHFSQAENNYQVKEAYKTLRSNVEFSGQNVRVISVTSCTPGEGKTTVAMALARAFAEAGKKTILVDADMRKSVLV
GRYRTGSVRLGLTHCLVGRERLSSVICETDTPNLYVIFSGPVPPNPSELLGGRIFAKALENMKQVFDYIIVDTPPLGSVI
DAAVVAKQCDGTVMVIESNSISYRFAQRVKDQLDKAGAKMLGVVLNKVDINGKGYYGHYGHYYGKYYGKYYGKYYGKYGE
GEAMQVTRPKTQETVPEPDDDDLDELNYLAGVTRKDR
>gnl|bykdb|A0A1I7JM73 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. DSM 8431] (length=221 residues).
MFIVDKKPKSITAESYRTLRTNIQYSSFDKEIRVIVVTSSEAGEGKSTTAGNLAISFSQAQKKTIIIDCDLRKPSLHKKF
KISNMTGLSDLLKGRENLGETVHAFNEYLDVLTSGKIPPNPSEMLGSRAMEHLIQSLKNEYEMIILDSAPLQAVTDAQIL
STKADGTILVVRAEKTKRDSVRQAKELLKKVDANILGVVLNGVENIRKKYYYYYGSEERQK
>gnl|bykdb|A0A1J0GKT7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium estertheticum subsp. estertheticum] (length=241 residues).
MKELDLITFKEPNSPMSESYRTLRTNIQFSSFDKKIKTLLLTSSGPGEGKTTTSSNLAMVMAQGGNKTLLIDCDQRKPQV
HKVFGFSNEKGLSNMLVSDDDGGEINMNIGIHETVQKNLHVLTSGTRPPNPAELLGSAKMKNFIEELKKTYDYIILDTPP
IILVTDAQILAQYTDGCLLVVSSKEAERDAAVKAKGLLEKVNAKILGIVLNKVDLKKKGYYNYEYKYGETVKGEKIRKIA
K
>gnl|bykdb|A0A1J0H585 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Virgibacillus halodenitrificans] (length=233 residues).
MARRKNQSRPNNKMRHLIAKLNPKSPITEQYRTIRTNLQFASVDEELTSMLVTSSGPSEGKSMTTANLAVVYAQQGKKVL
LIDADLRKPTVHYTFRLDNLRGLSNILVGEHTIEETVNRTDVDNLDVISSGPIPPNPSELLASRKMQTFLDEAKQSYDMV
IFDTPPVLAVTDSQILANIVDGTLLVIRSKKTELEAAQKAKEALEPAKAKLLGTVLNDREKKGSNYYYYYGTN
>gnl|bykdb|A0A1J1CXY5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium botulinum] (length=236 residues).
MNRNLELITIKDPKSPISESYRILRTNIQFSSFDEKISVIFVTSSTPGEGKSTTSANLAITMAQNGAKTILVDCDLRKPN
VHKLFKLSNIRGLSNLLIEDNSIDGVIQQSSVENLHILTSGVKPPNPSELLSSRKMNNFIETSKKHYDYIILDTPPVGVV
TDAQLVSQYSDGGILVTASGQVERELAIRAKQLLEKVNAKIIGVVLNKVDTEFGNGYRYYNYYYEEDGEKKKRNKK
>gnl|bykdb|A0A1J3ZVG7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus sp. HMSC036D05] (length=230 residues).
MAEKRKKLEQPLFVNDKPKSIISEKFRGIRSNIMFSRAKDEIISIIVTSEKPAAGKSIVSANIATTYAQAGYRTLIIDGD
MRKPTQNYIFEEANYDGLSNLIIGKSDYDKAIRSTRVPNLDLLTSGPIPPNPSELIDSDRFYEIYNELLRRYDFVLIDTP
PVNTVTDAQVFLQYVKDAIIVIDAEKNNKYEVKKAKSLIEKADGKIIGAVLNKTPRDKSSSYYSYYGEEE
>gnl|bykdb|A0A1J5WU29 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. FMQ74] (length=238 residues).
MALRKSRGSWMRRNVIAMTEPKSLNSEQYRTIRTNIEFASVDRQMKSVMITSACPGEGKSTTAANLAVVFAQQGKKVLLI
DADLRKPTVHTAFFLENTVGLTSVLLKKRSLEQAVQASNAKHLDVLTSGPIPPNPAELLSSKWMKELVDEASAAYDMVIF
DTPPILAVADAQILGNVADGSVLVISSGKTEKEQAAKAKEALESCNSKLLGAIMNGKKLSKHSEYGYYGNKDNFMQNK
>gnl|bykdb|A0A1J5X6Y0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. FMQ74] (length=227 residues).
MIFRKKKARRGLAQISVLHNKSVVAEQYRTIRTNIEFSSVQTNLRSILVTSSVPGEGKSFSAANLAAVFAQQQEKKVLLV
DADLRKPTINQTFQVENVTGLTNVLVGNASLSETVQKTPIDNLYVLTSGPTPPNPAELLSSKAMGDLISDIYEQFSLVIF
DSPPLLAVADAQILANQTDGSVLVVLSGKTKTDTVLKAKDALEQSNAKLLGALLNKKKMKKSEHYSY
>gnl|bykdb|A0A1J6VTD7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus aquimaris] (length=235 residues).
MLANNKKLKKLMMATKRKLITKTDPKSPISEQYKTIRTNINFSSVDRDLRSIMVTSSGPGEGKSTTAANLAVVFAQQGKS
VLLVDADMRKPTAHYTFNLTNTFGFTTVLTRQKTLREVVHPSDVDNLDLLTCGPVPPNPAELLSSRSMEEFLVDVYADYD
LVIFDTPPVLAVTDAQVLANQCDGTVLVVSSGTTEIEGAQKAKDLLQATKGKLLGVVLNNREVKDTSYYYYYGKR
>gnl|bykdb|A0A1J7UI79 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus agalactiae serogroup III] (length=229 residues).
MTRLEIVDSKLRQAKKTEEYFNAIRTNIQFSGKENKILAIASVREGEGKSTTSTSLALSLAQAGFKTLLIDADTRNSVMS
GTFKATGTIKGLTNYLSGNADLGDIICETNVPRLMVVPSGKVPPNPTALLQNAYFNKMIEAIKNIFDYIIIDTPPIGLVV
DAAIIANACDGFILVTQAGRIKRNYVEKAKEQMEQSGSKFLGIILNKVNESVATYGDYGNYGKRDRKRK
>gnl|bykdb|A0A1J9ULY2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus albus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDKNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPEMHKMLLIDNIVGLTSILTRNDQLEKCVQKTAVEKLHFLPCGPIPPNPAELLGSKSMQEFLAQVYSMYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKKTAVKAKGLLESAKGKLLGVVLNDHEREQSLYYYYGEN
>gnl|bykdb|A0A1J9USA8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus paramycoides] (length=234 residues).
MALNSLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFASVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKK
VLLIDADMRKPAMHQMFQVDNISGLTNVLTNSERLEKCVQMTSIDNLHFLACGPIPPNPAELLGSKSMQELLGQAYSMYD
LVIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A1J9VTR5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTQSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A1J9Y483 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus pacificus] (length=233 residues).
MALNLFKKKKNHRQRRQLITHQQPKSPISEQYRNIRTNIEFAAVDKNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSTYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTDKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A1J9Y5Z3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus paranthracis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNVEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQPTAVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSMYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A1J9Z304 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus mobilis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAQQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMITSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTNSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSMYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A1K0BM42 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus luti] (length=234 residues).
MALNSLFKKKTNHRQRRQLIAHQQPKSPISEQFRNIRTNVEFASVDTNLHSIMVTSANPSEGKTTITSNMAVVFAQQGKK
VLLIDADMRKPAMHQVFQVDNIFGLTNVLAHSERLEKCVQTTAVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSMYD
LVIFDLPPILAVTDAQIMANVCDASILVVRSEATEKEAAVKAKGLLQSAKGKLLGAVLNDREREHGLYYYYGAN
>gnl|bykdb|A0A1K1KS73 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus acidipiscis] (length=251 residues).
MALFKKKKQLDSSSMKNGVGLITVTKPTSSIAEQFRTIRTNVQFSSADRQLKTLLFTSADPSEGKSTISSNVAVTWADQG
NKVLLIDSDLRRPTVARSFRVSNSQGLTTILTAKQANLSESIHETEVPNLYVLPSGPVPPNPSELLNSSKMDQLLKVLKE
QFDIIILDVPPVNTVTDAQILASKVDGVILVVPQGIALKGAVLRARDLLKKVNANLIGAVLNRVTDAASGGYYVGYYGGY
YGGYYGTDDKK
>gnl|bykdb|A0A1K1NPJ8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. UNCCL117] (length=233 residues).
MQPSTNNRRPIITHENPKSPISEAYRTLRTNIQFSAIDEELRVIMVTSAGPGEGKSTTLTNLAVAYAQTDMKVVVIDADL
RKPTMHHTFSVTNRWGLTSILAGQAKLGDVVQHTYVDNLSLITSGPIPPNPSEMLASKRMTALLDELKGIYDIILIDAPP
TLAVTDSQIVATKCDGVILVVDSGKVKRDMAIKAKANLDHVKARILGVVLNNMDRKNAESYYYYYYGTTESPK
>gnl|bykdb|A0A1K1P4I7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus sp. YE71] (length=246 residues).
MTTNNRRPPKRYFTLLDKELSFQATEAFKTLRTNLMFSLATKDSKAFAVTSSIQHEGKSTMTANLALTFVQMQAKVLLID
ADLRKPTQQRLFKLKNKEGLSTLLAGLSTFRDVVCRDIIPGLDVLTSGPIPPNPSEMLGSERMKKMLSDLSSRYDYIIID
TPPINIVTDALTLSDSIAGVVLVAMSGVTTVDSYKQAVEAVEFANGTILGSVITNVPAGTGRHSYKNYGKLGYGYYGKKT
DRPIDD
>gnl|bykdb|A0A1K2AYY9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. ru9509.4] (length=227 residues).
MIFKRKKREKRDLSCISVLNPHSVIAEQFRTIRTNIEFTSIQTRLKSILVTSSLPKEGKSFTAANLAAVFAQQKKRVLLM
DADLRKPAIHEYFDLSPHTGLTNVLLNNCSLEEAILPTPIEHLELLPSGTIPPNPAELLSSSVMKQLFYEIEQQYDMVIV
DSTPLLPVADAKILANRTDGSILVVLSGKTKIAAVKKSKEVLEGTTGKLLGAMLNGKKVKKGRHYMY
>gnl|bykdb|A0A1K2HCZ0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactococcus chungangensis CAU 28 = DSM 22330] (length=231 residues).
MSKNKKNIGDNRYTITSMNPKSPISEQYRTIRTTIEFKMIDQGIKSFLVTSSETSAGKSTTIANLAITFAQQGKKVLLID
ADLRKPTVNLTFKVQNRVGLTNVLMNQSSITDAQQRTRVSENLTIISSGPIPPNPSELLGSIAMKRLIESVTEFFDVILI
DTPPLSLVTDAQVLSNYVGGVVIVAQANQTKKDGLLKTKKLLNQVQANILGVVLHGAEMSDSNSYYYYGVE
>gnl|bykdb|A0A1K2HF96 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactococcus chungangensis CAU 28 = DSM 22330] (length=235 residues).
MGIFHKGKKDDKPNPVSLITMFNKRSVISEQCRTIRSNIRFSMVDKDLKSLVITSAGPKEGKSTVANNLAVVFADAGLKT
LLVDADLRKPTADLTWALSRDEGLSNLLVDKTSNYENYVSKTKVEGLFVLTSGHVPPNPSELLGTERMQEILQTLTQNFD
LVIFDTPPLTAVTDAQILASRTDGTILVVRERQRDKREIMLSKQLLDMAQANILGVVFNGTKASRDDYYYYGSKS
>gnl|bykdb|A0A1K2I489 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus rennini] (length=251 residues).
MALFKKKKQLDSSSMKNGVGLITVTKPTSSIAEQFRTIRTNVQFSSADRQLKTLLFTSADPSEGKSTISSNVAVTWADQG
NKVLLIDSDLRRPTIARTFSVSNSQGLTTILTAKQANLSESIHETEVPNLYVLPSGPVPPNPSELLNSSKMDQLLKVLKE
QFDIIILDVPPVNTVTDAQILASKVDGVILVVPQGIAIKGAVLRARDLLKKVNANLIGAVLNRVTDAASGGYYGGYYGGY
YGGYYGTDDKK
>gnl|bykdb|A0A1K2I9P6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus rennini] (length=251 residues).
MSLFRKKKKLDSHSMKHGVGLITVTKPNSTIAEQFRTIRTNIQFSSADRQLKTIIFTSANLSEGKSTVSSNVAVTWADQG
SKVLFIDADLRRSTAHRTFRVSNTHGLTTILTAKQADLNESIKKTEVNNLYVLPSGPVPPNPSELLNSSKMDQLLKALVD
QFDMIILDAPPVNTVTDAQVLASRVDGVILVVPQGVALKGAVLRARDLLEKVHANVLGTILNRAVDTDSGGYYGGYYGGY
YGGYYGTDDKK
>gnl|bykdb|A0A1L3KD73 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus delbrueckii subsp. sunkii] (length=259 residues).
MAFGRKKHLDNETMKNGAKLITLANPQSVISEQFRNIRTNINFMNVDKEVKTIAFTSAMASAGKSTVSANVSITMAQAGK
KTILIDADLRRPTLHSTFNVSNSNGLTTLLTSRAKEMGANSVIRESGVENLSILTAGPIPPNPSELLSSKHMLDLIEDLK
QEYDMVVIDLAPILDAAETQQLTSSLDGTILVVRQAHSQKSAVKRAVELLKLTNSPILGYVMNDVDADGDDGYGYGYGYG
YGYGYGEEEEKKGLFGRKK
>gnl|bykdb|A0A1L3MMA3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus weihaiensis] (length=233 residues).
MARKDRKQLFQLQNRSLISMTSPKSPIAEQFRTIRTNIQFSSIDQELQTIIVTSSGPAEGKSTTTANLAVVFAQQGKRVL
LIDSDLRKPTVHYTFRLENHVGLSNVLTRQSTLQEAVKETAQEKLWVLSSGPIPPNPSELLGSKGMQVLLEQAKEEYDVI
ILDTPPVLAVTDAQVLSNIADGVVLVVSSGKTETESAKKAKELLDSAKAKILGVVLNNKKAEDSQYYYYYGGK
>gnl|bykdb|A0A1L4C164 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Marinilactibacillus sp. 15R] (length=232 residues).
MLFKKKKDTNLNDRPGLVVLNRPTSVVSEQFRTIRTNIQFSMIDETLKTIVVTSAGPSSGKSTVAANLSATLASDDKRVL
LVDADLRKPTVHKTFNIRNSDGLTKLLTNRMTKLEDVIYRTHTDGLYLLTSGAIPPNPAELLSSKRMGEVIEEMGHYFDM
IVFDMPPVLAVTDAQVMASKVDGVLFVIPKGEVSKDQVFKSKELLENVKANILGAVLNKVDKSDDYYYYYGE
>gnl|bykdb|A0A1L4D6C4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus faecium] (length=232 residues).
MARTQKQKAAQTHVVSLITLTNPSSPIAEQYRTIRTNIQFASAAGQQIKTIVVTSSGPGEGKSTIAANIAVVFAKSGQRV
LLVDADLRKPVVYETFQLNNASGLSTALSSSGSVADEIQRTPVENLSILPSGPKPPNPSELLSSPRMDQILAEARQLFDV
VIFDMPPVVAVTDAQIMSSKTDGTLLVVRENTSRKESLTKAKELLEMVQARVLGVVYNGAEHSKDAGYYYRN
>gnl|bykdb|A0A1L5FBB4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium kluyveri] (length=244 residues).
MEKPNIVTVKDPKAPISEAYRTLRTNIQFSSFDKKIQTIMLTSSGPGEGKSTTCSNLAVVMAESGASTILVDCDQRKPRL
HKIFFVSNDKGLSDVLVGKVEFEEAVKKTQIENLKLLTSGTIPPNPSELMASKKMENFLESLKDKFDYIIMDTPPVVAVT
DAQLLSRYADGCILIAASSQVEREAAIRAKELLLKVNANILGVVLNKLEIKEKGYYGYYYQYYYGEDGKSSSSKKKNRER
IRKK
>gnl|bykdb|A0A1L6H8U2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pediococcus acidilactici] (length=248 residues).
MFFKKKPKLDNESLKNGVGLITYNDPTSTIAEQFRTVRTNIQFSSVDKQLKSIVFTSSAPSEGKSTVSNNVAVTWADQGK
SVLIVDADMRRPTVHRTFRTSNAVGLSNLLAGTGSLDDAIHSTVVENLSVMPSGPIPPNPSELLGSSKMVNLLGVLTTKF
DLVIIDAPPVNTVTDAQVLAARADGTVLVVPQGIADKAGVRHAKQMLETVQANILGAILNRASAGKSTGYYGGYYGGYYG
GYYGTDDK
>gnl|bykdb|A0A1L6ZFE7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus safensis] (length=227 residues).
MIFKRKKREKRDLSCISVLNPHSVIAEQFRTIRTNIEFTSIQTRLKSILVTSSLPKEGKSFTAANLAAVFAQQNKRVLLL
DADLRKPAVHEYFDLSHHTGLTNVLLNNCSLEEAILPTPIEHLELLPSGTIPPNPAELLSSSVMKQLFYEIEQQYDMVIV
DSTPLLLVADAKILANRTDGSILVVLSGKTKIAAVKKSKEVLEGTTSKLLGAMLNGKKEKKGRLYMY
>gnl|bykdb|A0A1L7GUZ8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus fermentum] (length=246 residues).
MGLFKHRYTKSTDTMNNGVMLITLADPKSGPAEQFRTIRTNIHFMSVDRPLKTVAFTSSGISEGKSTVAANVAIAWAQEG
KRVLLIDADLRRSTLHATFGLSNQKGLTTILTGDSKEVDLSNVVQKSGVENLEVLTAGPVPPNPSELLGSQRMQSLINGV
REAYDIVVLDVPPMLQVTDTQVLSSNLDGVILVVRQGVTQKAAIRRAVEMLKISQANVLGYVMNDVYDDDAGYGYGYGYD
YEGGEG
>gnl|bykdb|A0A1L8CHL0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus kunkeei] (length=239 residues).
MGLFNKSPKKKLNDDSSKFGVNLVAELYPTSSVSEQFRTVMTNISFANINGNLKSIMVTSSDPSEGKSTFSANLAVTYAK
QGRNVVLVDADMRRPTVHKSFNVSNQKGLSTILSGNSTIEDTIKYTSIDNLNVITSGPIPPNASALLGNRKIVDIINKFN
KPNDLVIVDVPPVNTMTDASIVSTTVDGTIFVLPQGVAEKKRAKMAVEQLKKVNANILGGVMNMSKDNITNDYYYYYSK
>gnl|bykdb|A0A1L8MNU0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus bovimastitidis] (length=247 residues).
MAQLELVKSKLDLYTLAEEYYNSIRTNIQFSGRDLRVIVLTSVQPGEGKSTTSVNLAVSFAKAGFKTLLIDADIRNSVMS
GTFKSDEKYEGLSSYLSGNADLSAVISRSNVENLMVIPAGHVPPNPTTLLQNNNFNYMIDTLKEVFDYIIIDTPPIGLVI
DSAIVAQKADASVIVTEEGAIKRRFIQKAKEQMEQSGAQFLGIILNKVDSTIDSYGGYGSYGAYGNYGNYGKKETSKKSK
RLTRKRK
>gnl|bykdb|A0A1L8P9C9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Alkalibacterium sp. 20] (length=234 residues).
MIFKKRKEVNGSERPGLVVVNKPSSVISEQFRTIRTNIQFSMIDEAIRTMVVTSAGPGAGKSTVAANLASTFASEDKRVL
LVDADLRKPTVHKTFKVRNSDGLTLLLTDKQAHVEDVVYRTHTEGLYILTSGAIPPNPAELLSSKRMEELKREMLDYFDM
IIFDTPPVLAVTDAQVLASKTDGVLIVIPKGQASKEEMHKAKDLLDKVKANILGAVLNRVEKSDDNYYYYYGDK
>gnl|bykdb|A0A1L8PG07 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Alkalibacterium sp. 20] (length=232 residues).
MYNKREEIYNDVDLVTINSPHSIISEEFRTLRTNIQFSMFDRSFKTILITSSVSSEGKSTIAANLAVIFSTQGKKVLLVD
ADLRRPSLHRKFGLPNNRGLTSFLIGSEPSLSLILDKPYKENLHVLTSGLVPPNPSELLASQRMTDFIETTKEHFDIIIF
DAPPVIAVTDAQILASKIDGTVFVVRNGLAERHKLIKAKEQLKKVNANVIGTVFNEKKKIKSNDYGYYRTNE
>gnl|bykdb|A0A1L8Q558 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis] (length=230 residues).
MPTLEIAQKKLDLARKAEEYYNALRTNIQLSGNNLKVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSQGLCDTNVENLFVIQAGSISPNPTALLQSENFATMLDTLRKYFDYIIVDTAPIGVVI
DAAIVTQKCDASVLVTATGETNRRDVQKAKEQLEQTGKPFLGIVLNKLNTSVEKYGSYGAYGNYGNYGKK
>gnl|bykdb|A0A1L8QQV6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus aquimarinus] (length=230 residues).
MSKKQNKEASKRAVGLITLTNPSSPISEQYRTIRTNIQFAASVDRRLQSMVITSSGPSEGKSTTAANLAIVFAKSGQRVL
LVDADMRKPTVDQTFHLPNARGLSTVLSTNQSAVESCQPTFVENLDVLTSGPKPPNPSELIDSKRMDQVKMELKQVYDFI
IFDLPPVITVTDAQIMSSKVDGTLLVVRENVTSKESIAKAKEALGLVQARVLGVVYNGATHTRDQGYYYY
>gnl|bykdb|A0A1L8R418 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus canintestini] (length=235 residues).
MAKKHTERKGTQTHPVSLITLVDPSSPISEQFRTIRTNIQFASSADRQIKTIVITSSGPGEGKSTSSANLAVVFAKSGQR
VLLVDADMRKPTVYKTFKLNNEVGLSTVLSTQKSVLEAAQQTTVENLSVLTSGPKAPNPSELLGSARMDQVIDEARNLYD
IVIFDMPPVVAVTDAQIMASKADGTVLVIRENVSRKESLIKARDLLKMVGARVLGVVYNGAQHTKDQGYYYYYGS
>gnl|bykdb|A0A1L8RFH3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus canis] (length=228 residues).
MSKKKSKVEPVSLVAIADQNSTITEQYRTIRSNIQFTSVDKELQTMVVTSSGPSEGKSTTSANLAVVFANSGKRVLLVDA
DLRKPTVALTFQIPNARGLSNLLGDRTADSKDYAQTTIVENLWVMPSGPKPPNPSEMLGSKRMEEVIAELSQEFDLIIFD
MPPVATVTDAQILAAKTDGTLLVVRERQTKKQNLVKAYDLLKIAKANILGVVYNAAKKGDDSSYYYYG
>gnl|bykdb|A0A1L8SYP8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus devriesei] (length=236 residues).
MSKKERKKRSEIPEAVSLITLVDKSSPVSERYRTVRTNIQFASSADRQIKTLVVTSSGPGEGKSTTSANLAVVFANSGQS
VLLVDADMRKSTVHKTFQLTNNVGLSNVLSSDMGVKEAVQRSVVPNLYVMTSGPKAPNPSELLGSTRMDQLIMELRDSYD
FIIFDMPPIVAVTDAQIMASKADGTLLVVRENVTRKDSLQKARELLSMVNANVLGAVFNGSTDENDQGYYYYGTDN
>gnl|bykdb|A0A1L8ULT5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus mundtii] (length=225 residues).
MKKNTILPVSLLSITDKNAMVSEQYRTIRSNIQFASVDRELKTMVVTSSGPGEGKSTTAANLAVVFANSGKRVLLVDADL
RKPSVALTFQLPNVNGLSNFLGDREGRPESYYHTSSVENLWVMTSGPKPPNPSELLDSKRMEEVIEQLKAVFDLIIFDLP
PIATVTDAQILAAKTDGTLLVVRERKTMKQELIKAKELLSIAQATILGVVYNGAKKNADFNYYYY
>gnl|bykdb|A0A1L8WIJ3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus ratti] (length=226 residues).
MKRRENSRLVPLINALDRFSMIAEQYRTIRSNIQFISVDQAVKTLVVTSAGPEEGKSTVSANLAIVFANSGKKILLVDAD
LRKPSVADTFQFSVHTKGLTNLLGEKEKTLEAYVNKTGMDHLWIMTSGPKPSNPSEMLDSMRMKEIIEGLKMQFDLVIFD
MPPVATVTDAQILASKTDGTLLVVRERKTSKHELVKAKKLLTMAQANILGVIYNGAKENNDFSYYY
>gnl|bykdb|A0A1L8WLJ0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus ratti] (length=235 residues).
MRKTRRKRKTRNGAVRKNLITITDKTSPITERYRTIRTNIQYSFPYGEKLQTLVITSPGAGEGKSTTAANLAVVYANFGQ
RVLIIDADMRKPTLDKIFSLEKHVGLSTLLGTNVKVEECIQESFEKNLFIMTSGPKPPNPAELLGSVRLEKMIEELKNMY
DVIIFDTPPLSAVTDAQILASKVDATIMVVSEKLTKKTNFQIAKHLLELVNANVLGVVYNASKEDEDQGYYYYGS
>gnl|bykdb|A0A1L8WPS3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus ratti] (length=233 residues).
MKRIIKRRAAQKQPSGLVTVTNPFSGISEQYRTIRTNIQFVSPNGQQTKTIVVTSSEPEEGKSTTVANLAVVFAKSGQKV
LVIDADMRKPALYKTFQLDNGYGLSNILSSNEAISEGIQKTPIDHLSVLPSGPTPSNPSELLSSQRMDQLLVEVRQFYDI
VMIDVPPVVAVTDAQIVASKVDGTLLVVRESASRKESLLKAKKLLEIAQANMLGIVYNGAKQSKDASYYYYGN
>gnl|bykdb|A0A1L8WXI7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus raffinosus] (length=227 residues).
MKVRETRLISIENRFSPITEQYRNVRTSIQFAASAGDPLKLLLVTSTEQEEGKTTLAANLAVVMSETNKKVLLIDGDLRR
ATAGKYFNMRSSQAVGLSTLLNNGRSSLNEAIQRTQVKNLDFLPAGPIPPNPSELLNSLRLNELFSELEDQYDAIIVDSP
PLLVVTDAQIFSSKVDGVILVVRENRTKRNNLIKCKTLLERSKARLIGVVYNGAKSMGAGNYKYYKY
>gnl|bykdb|A0A1L8ZNP1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus obstructivus] (length=229 residues).
MNRKKKKNYINAVDLVSYKFPHLPITEQYRLIRTNILYSSVDKEIKTIMVTSPDPSEGKSTTSANLAIVLAQQGKRVLLV
DADLRKASIHYTFNVSNIDGLTSVLTKKISLLDGISKTYVPNLEILTSGPIPPNPSELLNSEAMERIIVELNSRYDYIVF
DTPPVLAVTDSQILANKCDGIVFVIYSGKTRKDRAVKAKQLLQKAKSQILGVVVNGLESKNEVYYSQYK
>gnl|bykdb|A0A1M2Z7K9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridiales bacterium 43-6] (length=265 residues).
MFRARRKIHYSRETHLVDEKSSFNLKESYKSGRTNTIFSLPQEKCSVIVLTSSWPMEGKTTNCINLGIAFAQTGAKTLIL
DADLRKPRVAKVFKLQTKFGLTNALRKFCEIKEAIHPTQYDNLFVMPSGHIPPNPAELLSSVEMKELLAQLKEEYQYILV
DTPPVNLLTDALLLAKEASGSIVVARQGITDHKSLSDALEKLKFSESKILGFVLNDASEERSGYYKYRSGYGKYNYYKNK
YYGSYEYTQSEAEKPEIEKKPKGKK
>gnl|bykdb|A0A1M2Z8I6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridiales bacterium 43-6] (length=247 residues).
MAFLKKNKTPSTVAPRRDSIARPKSDISVVEAYRTIRTNFMFAINKKDKCKKIIFTSPVPRDGKSTTCVNLGISLAQIDA
KVLLIDCDMRKPRIHKFFNCDNTPGLSNVLGGFNELSETIKQTDHHNLFIIPSGIIPPNPAELLSGPRMANIMEELETMF
DFILVDTPPCNVVSDALLLTKICDGVILIVKQSVTIHPDLTRCIKSLEFINADILGIILNEATQNRKYTYKKYKYGEYRY
GYNYSSY
>gnl|bykdb|A0A1M4N7U3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. N3C] (length=229 residues).
MVKNLVAFKNPKSRAAEAFRTLRTNIQFSGLDDSLSSIVVTSSVPSEGKSTVLINLAITIAQSGKSVLVVDCDLRRPTVH
KKLGLPNTEGLTNLLIQEKNSFNDVVLSTKVPNLSALTSGPIPPNPAELLGTKRMKHLLGELTKAYDMVLIDAPPVIAVT
DAQILSTIAEGTLIVSSYGTTEKIGLVKTKELLDKVGAKILGVVLNKVPEKSEHYYYGKYYTTYYKEEN
>gnl|bykdb|A0A1M4NDJ8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus paracasei] (length=250 residues).
MKWSFKQLFHRQQEDQETQKNGVILVTFAEPKHVVSEQFRTVRTNIEFAGAALDKCQVVMFTSSVMSKGKSTVSANVAVT
WAQAGKKVLLIDCDLRRPTVHATFRTLNLEGVTTVLTGKSSAHNIVEQTFVSNLDILTSGPLPPTPSELLNSQRMANLVD
WARDNYDIVVLDAPPVLAVSDVQVLVPKTDGVVVVAKMGKTLKGDLRRTIEVLKLAKAKLLGCVERVNVKRGDRGYGYGY
GYGYGNEGTK
>gnl|bykdb|A0A1M4WLV8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Caloramator proteoclasticus DSM 10124] (length=228 residues).
MSNFIVEKNPKSPISESYRTLRTNIQFSSFDKDIKTIVVTSSAPGEGKSTTIGNLALVMAQSGKRVLLIDADLRKPTVHK
KFKLSNQTGLTNILIEDKNPFEVIQKYSDNLYILTSGILPPNPAEVVASNKLRNFINEMKNHFDYILLDSPPVIAVTDAQ
ILSSFLDGVILVVSSGEAEKELVKKAKDLLDKVNANIIGVVLNKLELKSRKGYGYYYYYYGEEGSAKK
>gnl|bykdb|A0A1M4WLW2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Caloramator proteoclasticus DSM 10124] (length=240 residues).
MVGIDLVTVEKPKSPIAEAYRTLRTNIQFSSLDKKVKKIVITSSAPGEGKTTTALNLSITLAQNGHKTLLLDCDMRKPSI
HKKLKISNLYGISDLLVGEAKYESVIIKGPVENLDIITSGTKPPNPAELLSSQKMLNFISDVEKNYEYIIIDTPPVLMVT
DAQVLSKYADGTILVVASGEAEKDAVVKAKELLTKVGANILGVVLNKLDTNRRGYYGYYYHYYYGQEQEKKKKKGFLFNR
>gnl|bykdb|A0A1M4WP74 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Atopostipes suicloacalis DSM 15692] (length=237 residues).
MFDKRRKKLKQMSRSQKNPSSMIAAISPNSRVAEQFRTIRTNIQFSMVTKNLQTILFSSSGPYEGKSTICTNVASVFADQ
GKRVLVVDADMRLPSIAKIFHLNNKVGLSTLMTSQHLKVEEAIQHVEAVHFDVLPSGIVPPNPSELLDTERMDEIIDELK
QQYDLILFDLPPIVSVTDAQIMATKVDGVILVIRKDIAEVEEVYKAKELLDLVNANVLGAVFNGETNNYDYSNSYYR
>gnl|bykdb|A0A1M4YMK3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactonifactor longoviformis DSM 17459] (length=230 residues).
MEKLEIRDDVELSNREKEVYRTLRTNLEFTGVENRAIAVTSCTPNDGKSVVSYNLSLALAESGKNTLFVDADLRKSVLVH
RLNMKNPSKGLSHLLSGQVGANDVIYSTNKKNLFMIPSGIFPSNPTELLSNGRFEKLVAGLKGTFDYIVVDTPPLGSVID
AAVIAKICDGSVLVLAADKSSRNEAKSVVGQLKAANSNVLGVVLNKVDYKGNGYYGKKYGGYYGKYTSYY
>gnl|bykdb|A0A1M4ZUV4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Alkalibacter saccharofermentans DSM 14828] (length=222 residues).
MKNTIVTQLDPKSAISEAFRNLRTNVHYTNIDNQVNLLQITSSVQGEGKSTITANYGVTLAQSGKKVLIVDCDLRRPQIH
KIFNISNTNGLSNVLVGDNKMDKNIKDTKVPNLFVLTSGPIPPNPSEMLDSKRMRELILSLKDHFDMILLDSPPIMPVTD
GLILSQIVDGTIVIVSLGSTERDALKKTMDSLEKIGANILGTVINKASSKAGYYVNYEYEYK
>gnl|bykdb|A0A1M5GGZ4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ornithinibacillus halophilus] (length=231 residues).
MARRKKQKTISNVRNLIAKLSPKSVIAEQYRTLRTNIEFSSVDEKLQTILVTSAGPGEGKTSTISNLAVVYAQQGKKVLL
VDADLRKPAVHYTFRIDNINGLSNILVGDMSVAEAVNDGGVPGLDVISSGPIPPNPSELLGSNKMKKFLDLVKGNYDIVL
IDTPPVIAVTDAQILANHCDGAILVVRSKHAEYEAVNKAIDLIKPAKAKLLGTVLNDRDKKESNHYYYYGA
>gnl|bykdb|A0A1M5M7V5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Asaccharospora irregularis DSM 2635] (length=246 residues).
MSRIISIEDSKSPIAEAYREIRTNIEFSNIDSEKKVILTTSSRANEGKSTVLSNLAVTFANLDKKVLIIDGDLRNPTIHK
TFGLSNIYGLTDILLEKLNFMECVQPSGITDLHILACGDIPPNPSEMLASNKMKTFLEIIRERYDYIFIDAPPIGVVTDA
GIISGYSDGVIFVVESNGADIEQIKMAKERLLNINAKILGVVLNKFDNKKSGYDYYNYYYQQDETSKKGRKERKKDKKKA
GRKSWR
>gnl|bykdb|A0A1M5QJU7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Virgibacillus chiguensis] (length=233 residues).
MLRGKNPSRPGTKMRHLIAKLNPKSPISEQYRTIRTNIDFASVDNEIRSLLVTSSGPAEGKSMTIANLAVVYAQQGKKVL
LVDADLRKPTVHYTFRIDNLRGLSNLLVGENSLDQVIQRTDVDNLDVMSCGPIPPNPSELLASKKMKSLLEELKGNYDMV
IFDMPPVLAVTDAQIMANIVDGSILVVRSKYTEIEGAQKAIEALQPAKAKLLGAVLNDREKKQSNYYYYYGAK
>gnl|bykdb|A0A1M5RDT7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Desulfosporosinus lacus DSM 15449] (length=249 residues).
MEQETRGGEKIQLAYSLITIEQTKSPISEAYRTLRTNVQFTDVDSETKKIMITSSGPREGKSSTVANLAVSMAQTGKCVL
VVDADLRNPTQHKLFGLDNRQGLSVALVQEQDYRNYIRETAVPGVKVLTGGPIPPNPAELVGSNRMKRLIKEFSEEYDIV
LIDTPPVIAVTDAAVLAQEVDGVILVLASGEVNKDYALRAKELLDKVGAKILGAVLNKADLKTGEYNYYYYYHGSDDSNK
KKQKRQKDR
>gnl|bykdb|A0A1M5SI25 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Desulfosporosinus lacus DSM 15449] (length=237 residues).
MAFSLITHEETKSPISEAYRTLRTNVQFTSVDSKTKKIMITSSGPREGKSTTVANLAVSIAQSGKSVLVIDADLRNPTQH
KLFQLGNFEGLSSFLVQDQEDSHNFIKETEIPGVKVLTGGPIPPNPAELVGSQRMKRLIEEVSEQFDVVLIDTPPIIAVT
DAAILAQQVDGVILVLAAGEVNKEYAQLAKEQLDKVGAKILGAVLNKADMNTSDYYYYYYYHGTDDNKKKHKGHKHG
>gnl|bykdb|A0A1M5T813 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium grantii DSM 8605] (length=246 residues).
MLIVKRDAKSVSAEAYRTLRTNIQYSSVDKEMKTILLTSAGPGEGKSSTTGNLAYTLATVDKKVVIVDCDMRKPSVHKKM
RLSNTVGLSNYLAGEVKLEEALQLIDKNIFVITSGPIPPNPADMLGSNKMKALISKLEENFDYVLLDTPPVIAVTDAQVL
AGNVDGVVLVVASKQADKDAVVRAKELLLKVGANIIGVVLNKVEMRKGKGYGYQYYYYYGQDDKKSTKGKKTKKPKKPEL
NSAAVK
>gnl|bykdb|A0A1M5X3I4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium collagenovorans DSM 3089] (length=234 residues).
MEKLVMRDDPSSLSAEAFRTLKINLDFFNVDNNLKTLAITSSNPGEGKSTAIANLAIAFAQSGKRVILIDCDLRRPSVHK
KFKISNTHGITDMIVDTELKHDYIHSSKIDNLFILPCGTKPPNPAELLASEKMDMLLEKLKGMCDIVLLDIPPILSVADS
RIICGKVDGVILLCAYGQSEKELILKSKQELDKVNAKLIGTILAKVPESQSHYSYYYDDNLNASNRKKNKRHSR
>gnl|bykdb|A0A1M5X3M9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium collagenovorans DSM 3089] (length=237 residues).
MNNLIIKDKPQSLSAEAFRTLKTNIDFFNFDNKLKTLAITSATPGEGKSTSIANLAIAFAQAGKRVVLVDCDFRRPTVHK
TFNLSNSKGITDMLIAKSLDLDFTTFSGTENLYILPCGVKPPNPAELLSSRKMELLIESLKAKFDLVLLDIPPVLPVADS
RIICGKVDGVILLCTYGKTQKEDILRCKHELTKINAKLIGSVLNKIPEREHKYGYYYNNESASKGLRFRKKLKRKKH
>gnl|bykdb|A0A1M5Z8V2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Butyrivibrio fibrisolvens DSM 3071] (length=237 residues).
MQRVMIRDNELEFRTREAYKTLRSNIEFSGRDIRTIAITSSTPNEGKSEVAFELARTFAQADKKVLLIDADLRKSVMREH
FKNGKIRYGLTNFLVGHCKIDDCLCQTDEPGFYMIFSGPNTPMPSELLGGEVFGQLLKEAHDVFDIIIIDTPPLGSVIDA
AIVGKQCDGTVLVIASGRISYRFVQNVQNQLRKAGCHVLGAVMNMVSMDGNKYYGKYYGKYYGKYYGKYYGNYGDYQ
>gnl|bykdb|A0A1M5ZJ36 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Desulfosporosinus lacus DSM 15449] (length=225 residues).
MYSLITFEQTKSPISEAYRVLRTNVQFTSVDSETQIIMVTSSGPREGKSHTVANLGVSMAQSGKSVLIIDADLRNPTQHK
LFGLDNGEGLSVSLVQDQDYHKYIRETTVPGVMVLSAGPVPPNPAELVGSKRMKCLIEEVGDQFEIVLIDTPPIIAVTDA
AILAQEVDGVILVLAFGEVNKDYAQKAKGLLDKLGIKILGAVLNKVDMDTNDYYYYNYHNSSEQK
>gnl|bykdb|A0A1M6DLS2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium intestinale DSM 6191] (length=233 residues).
MIKDLIAYSDPKSAAAEAYRTLRTNLQFSMLDKDSNIIAITSCAPGEGKSTIISNLAISLAQSGKKVLLVDCDLRKPIIH
KKFGISNTTGLTSLLLKESTLEEAIYKVDIPNLGLIPSGPVPPNPSEILGSKKMGKILEDLKNYFDVILLDSPPVLVVSD
LHVLASTLDGILLVATYGITEKNAILRAKESIIKVGGKVLGVVENKIPQDAKEYGYGGYGYNQYQGYYSSETE
>gnl|bykdb|A0A1M6FLI8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. cl25] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A1M6FNP0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Butyrivibrio fibrisolvens DSM 3071] (length=230 residues).
MIDIELETKNLPFGMTEEVKNLRTSIAFAGDGIKSVLFTSTMTNEGKSTITIEAAKSFAELGKKVVLVDTDLRKSILKMK
LVSGKMKYGLTHYLSGQCEVDEIIYHNTADGFDNMYIVPTGPATKAPTELLSTDKLGKLLDDLRKDYDMVIIDTPPVGTV
IDAAIIAPHTDGAVFIVEAGKVNFKTVQKAIEKFEASGCKVLGVALNKVDKSKNSYGYYKYGKEYGYGND
>gnl|bykdb|A0A1M6GUA6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Parasporobacterium paucivorans DSM 15970] (length=240 residues).
MKTVKINKLIKLDYYADEAYKKLRTNIQFSGHDIKTVGITSCLDDEGKSSIAFNLALSTASAGKRTVFVDADLRKSVTMG
RYRIEENVEGLSHYLSGIDAEESVYPTSISNLYMLFSGPLPPNPSELLNGERFRNLVRRLRQEYDYVIIDTPPLGKVIDA
AVVAGVCDGVILVISTNRVSYKFAQAVKEQLEKTGCRILGAVLNNVEISKSGLYGKYYGKYYGKHNEKYAGDESPGNGGS
>gnl|bykdb|A0A1M6J321 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Thermoclostridium caenicola] (length=225 residues).
MAEKNTIIVHSNPKSPVSEAYRVLRTNIQYSGIDKPLKSILVTSSVPMEGKTTTVTNLAITFAQAGSKVLLIDGDLRKPK
IHKVFMVSNDTGLTNYLVSREDYKEYVRHSDVPNLDIMTSGTIPPNPSELLNSDAMKMFIKSLSDDYDVILLDAPPVCSV
TDASIISTYADATILVVNSGKTHIDEAKKAKELLERVNANIIGVVLNKVNKKEKGNYYYYKYYQE
>gnl|bykdb|A0A1M6KM22 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium amylolyticum] (length=227 residues).
MIKDVISFDNPKSRAAEAFRTLRTNIQFSSFDDTLKTIVITSSTPAEGKTTVLTNLAVTFAQSGSKVLIIDCDLRKPSIH
KKLALSNSEGLTNILVQSKKIEECLKVTEQQNLFVLTSGPTPPNPSELLGSKKMKNIIGEFEQIFDYILIDAPPLLAVTD
AQVLSTISDGVILISSFGQTEKNAVVKSKDLLDKVGAKLLGVVLNKIPEKEDSYYYSKYYNYYGESE
>gnl|bykdb|A0A1M6KR88 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium cavendishii DSM 21758] (length=225 residues).
MDKKITSIINSKSREAEAFRTLRTNIQYSSLDEEIKTLVVTSSAPSEGKSTVISNLAVSMAQAGKKVLLVDCDFRKPTIH
KKFALSNNNGLTNIIIGDAKIEECLKATETERLYVLTCGTIPPNPSEMLGSKAMRKYINDFKEIFDLILIDAPPVLAVTD
AQLLAVNVDGVVLISSYGKTEKKAIIKSKELIENVGGKVLGVVLNMVPTKANEYYYSKYYGHYGK
>gnl|bykdb|A0A1M6LPB9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Dethiosulfatibacter aminovorans DSM 17477] (length=232 residues).
MKGLYELIVKRRPKSPISEAYRSLRTNIEFANLDNNMKSILITSATSGEGKTLTLINLAVAMAQIGKKVMIIDCDMRKPR
VHKALETSNMFGLAEYLMDGGDIGEYIKRIDDLGIDVMTSGRIPSNPSELLHSNVMKNTVEKLKENYDYILFDTPPVIPV
TDAVVMSSYVEGAIMIIEHGKVDIDLGRRAKDALVSGGTNLLGVVLNRIPVNDSKSYQSYYYYYEERKAKSV
>gnl|bykdb|A0A1M6LPX4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Desulfofundulus thermosubterraneus DSM 16057] (length=237 residues).
MFKSNGYAPQLIAHKHPKSAAAEAYRVLRTNLGFAALDHPCRSILVTSAGPEDGKSTTAANLAVVLAQAGNKVILVDCDL
RKPVLHKIFEVENHRGLTNCLLQNLDPAEVSKNGLVENLTLVTSGPIPPNPAELLGSGRVRALWPALLERFDYLIVDSPP
VLAVTDASLLAAQVDGVILVVRAATTRVEIAREARDQLLKASARIIGVVLNQVKMPARDYHYYYYYHRREKEEEVRL
>gnl|bykdb|A0A1M6PLE3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Megasphaera elsdenii] (length=232 residues).
MAEIDFITHYDSRSPVSEAYRAIRTNLQFAGAGKTLKTIVFTSTVPGEGKSTTVANLAIAMGQDNKKILLIDCDLRKPIV
HRRFGLLNKGLTNCFAEDKNLSDVIQKDVFPNLDIVTCGPIPPNPAELLGSPKMEELLKEAADLYDYVFLDMPPVLVVTD
AALMASKADGVVMILGSGDVSPDEAKEAKEALERGHANILGVILNKVPQKRRSGYYYYYYYDEEHHKKRRRR
>gnl|bykdb|A0A1M6Q376 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Hathewaya proteolytica DSM 3090] (length=220 residues).
MFVVDNEPKSIAAENFRTLRTNIQYSSIDDKYKVIAVTSSEPGEGKSTISGNLAIALSQNDNKVVLLDCDLRKPSLHKKF
RISNSEGVSELILGKDNLTAVGYKYNDNLVVITSGKIPPNPSEMLGSKSMNSLIEMLKKAFDYVILDTPPLQAVTDAQIL
SARADGVIIVVEAGKTKKNLVQNSVNLLKKVNANIIGIVLNKLDNANEKYYKYYGKTEKK
>gnl|bykdb|A0A1M6S918 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Hespellia stercorisuis DSM 15480] (length=243 residues).
MKKLKFGIIEEQDYYTREAYKSLRTNLQFCGDDVQVVALTSCTLNEGKSACSFNLARTFAVADKRVILVDADLRHSVIVG
HRKIEFEGEELLGLTHFLSGQCKLEDAIYATNVENMDVIVAGTFAPNPTELLGGAGFKALLETLRQAYDYVVIDTPPLGS
VIDGAIVAPNTDGMLLVIESAAISYRLVQKVKNQLEESGCRILGTVLNKVDVGGKGYYGKYYGKYYGKQYGKYYGEYGQE
GQE
>gnl|bykdb|A0A1M6TIV6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Tepidibacter formicigenes DSM 15518] (length=244 residues).
MRNDSRKLIVRDNPKSPISEAYRNIRTNIQFANIDKNLKTIMLTSATQGEGKTTTISNIAVTLADLGKKVIVIDCDLRKP
KVHKIFKISNTNGITDILLENTSYKEYVNKDIIENLHVLTAGQTPPNPAEMLSSNKMKDLIETIKKDYDYVLIDTPPVAV
VTDAAIISTFTDGVVLVCASGQVEIDLVKRSKENLKKVNANILGVILNKLPLDISKSYYYYSNYYGGETNNSKKRKGILS
KVVG
>gnl|bykdb|A0A1M6V3S0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Desulfotomaculum aeronauticum DSM 10349] (length=240 residues).
MTRSNLVVIEDPKSPIAEAYRIARTNIQFAAVDKELKTLLITSSGPAEGKSTTVANIGAAFAQSGKSVIIIDADLRKPTQ
HKVWEIDNFRGITNVLLGDAEIDSVLQKTPIDNLQVSTTGPIPPNPAELLGSQRMSNLLARFKEYADIIIIDTPPVIAVT
DAALLAPQVDGVVLVVASGQAKIEAAQRSKQMLVNGRARILGTILNMVDEDTEDYYYYYYYGEGSGDKKSRKGKNKVATL
>gnl|bykdb|A0A1M7BZ87 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerocolumna jejuensis DSM 15929] (length=233 residues).
MQSVNIELAASLDFRSYEAYNTLRTNIQFCGKEIQVICITSCTPGEGKSTVALRLSASLAETGKKVLFIDADLRKSILVK
SLKVNQAVLGLSQYLSGMNTSEEITYETNVAGLDIIFTGPMPPNPSDLLSNKFFKALLENQRKIYDYIIIDTPPLGLVID
SANVAESCDGAVVVIQADVNSYKFVQKIIKQLEKSNCRVLGAVLNKVESKHQKRYYGKQYKRYYGTAYASAEV
>gnl|bykdb|A0A1M7CU82 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Salinicoccus alkaliphilus DSM 16010] (length=238 residues).
MEMNRGHRDEGTRPRYLVVDKQPHATVSEQFRTIRTNIMYSSVNRDIRSVLFTSDMASAGKSTVAANMAVAYAQAGKKTL
LLDADLRRPTSHETFRVDNRTGLSTLIVNDIPLEEVIKATEFERLDLITSGPIPPNPAELLSAPKLDSIMLRLMTHYDMV
IIDSPPVLSVTDGQLLSKNANGVIMVTNVENNNRERLNEAKDLLNKAGANIIGIVLNGRSPEYKKDNQYHYYQEPRAT
>gnl|bykdb|A0A1M7D573 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. bc15] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTNSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A1M7G1Y5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Salinicoccus alkaliphilus DSM 16010] (length=235 residues).
MFGKNKKHTYASGPRELIVEKEPKSPISEQFRTIRTNIMYSSIDREIKTVVFTSASPGAGKSTTAANLAIAYAQSGKRTL
LVDADLRRPTTHYTFEVGNQRGLSTVIVNDMPAGDVVKQTDIENLEILTSGPIPPNPSELLSSRKMNLLLRTFAMDYDMV
IIDTPPLLAVTDAQVLSKVVDGVVLVTNVEENNKERLHDAKTLLEKADANILGVVMNNKNMGRKKDEYYYYYGTE
>gnl|bykdb|A0A1M7K3Q5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Gracilibacillus kekensis] (length=230 residues).
MVRGKKQSKLSNVRHLITKMNPRSPISEQYKTIRTNLQFSSVDGELKTMLVTSSGPSEGKSSTTANLAIVFAQQGKKVLL
IDADLRKPTLHYTFRIDNRKGLSSVLVGETELQDSIANSDVAGLDLLTCGPIPPNPSELLGSKAMETMISNVSLEYDVVL
FDTPPVLAVTDAQILANICDGVVMVVRSNQTEYDAAIKAKELLEVGSAKLLGVVLNDREQKKGHYYYYGN
>gnl|bykdb|A0A1M7RVY5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Butyrivibrio hungatei DSM 14810] (length=277 residues).
MQTAKLHFSQSENNYQIKEAYKTLRSNIEFSGQNVRVISVTSCTPGEGKTTVAMALARAFAEAGKKTVLVDADMRKSVLV
GRYRTGSVRLGLTHCLVGRERLSSVICETDTPNLYVIFSGPVPPNPSELLGGRIFSKVLENMKQVFDYVIIDTPPLGSVI
DAAVVSKQCDGTVMVIESNAISYRFAQRVKDQLDKAGAKMLGVVLNKVDISGKGYYGHYGNYYGKYYGKYYGKYYGKYGD
DAEMSSGSGRPKTPEADLPDDDDLDELNYLAGVTRKD
>gnl|bykdb|A0A1M7YAC1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerocolumna xylanovorans DSM 12503] (length=233 residues).
MQSVNIELTASLDFRSYEAYNTLRTNIQFCGRDTQIICVTSCTPGEGKSTVALRLAASLAETGKKILFIDADLRKSVLVK
RLKVNQSITGLSQYLSGMSKPEEVIYATNTAGLDIIFSGPMPPNPSDLLSNKYFRALLEDQRKVYDYIIIDTPPLGLVID
SANVAENCDGAVIVIQADANSYKFVQKIIKQLEKSNCRVLGAVLNKVDEKHQKRYYGRRYKQYYGSAYASADV
>gnl|bykdb|A0A1N6HDA7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Carnobacterium alterfunditum] (length=240 residues).
MFKKTINNNQYEGKSLITLKDPSSFISEEFRTLRTNIQFSMIDKELKTLMVTSSRQGEGKSTIAANLAVIFASQGDKVLL
VDADMRNPSLHKLFKVRNQQGLTSILTAKNRQLSDIVHRTGQENLVLLTSGIIPPNPSELLASRRMTQFIEAVKNDYDLI
IFDLPPINIVTDAQVMGNKTDGTVFVIRKEVADLSDILKAKELLNLVHANVLGAIFNSKERIKGMKYGYYAKEKEPDGIR
>gnl|bykdb|A0A1N6HI30 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Carnobacterium alterfunditum] (length=234 residues).
MFNKKQKQLDNNERPSLVTLTRPSSVIAEQFRTIRTNIQFSMVDKNLKTLVITSAGPGAGKSTISANLAVTFAMQGKKVL
IVDADMRKPTVHKTFRLPNRDGLTTLLTERDVEIKDIAHRVDTEGLFIITSGVIPPNPSELLASKRMDQLITEFEDLFDL
IIFDMPPVIAVTDAQVMASKADGTIFVVNKDGADKEMDTKSKELLEKVKANVIGVVFNRVELKGDNYYYYYGAE
>gnl|bykdb|A0A1N6LYK3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus agalactiae] (length=229 residues).
MTRLEIVDSKLRQAKKTEEYFNAIRTNIQFSGKENKILAITSVREGEGKSTTSTSLALSLAQAGFKTLLIDADTRNSVIS
GTFKATGTIKGLTNYLSGNADLGDIICETNVPRLMVVPSGKVPPNPTALLQNAYFNKMIEAIKNIFDYIIIDTPPIGLVV
DAAIIANACDGFILVTQAGRIKRNYVEKAKEQMEQSGSKFLGIILNKVNESVATYGDYGNYGKRDRKRK
>gnl|bykdb|A0A1N6LYL9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus agalactiae] (length=232 residues).
MTRLEIVDSKLRQAKKTEEYFNAIRTNIQFSGKENKILAITSVREGEGKSTTSTSLALSLAQAGFKTLLIDADTRNPVMS
GTFKATGTIKGLTNYLSGNADLGDIICETNVPRLMVVPSGKVPPNPTALLQNAYFNKMIEAIKNIFDYIIIDTPPIGLVV
DAAIIANACDGFILVTQAGRIKRNYVEKAKEQMEQSGSKFLGIILNKVSESVATYGDYGDYGNYGKRDRKRK
>gnl|bykdb|A0A1N6LYN7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus agalactiae] (length=229 residues).
MTRLEIVDSKLRQAKKTEEYFNAIRTNIQFSGKENKILAITSVREGEGKSTTSTSLALSLAQAGFKTLLIDADTRNSVMS
GTFKATGTIKGLTNYLSGNADLGDIICETNVPRLMVVPSGKVPPNPTALLQNTYFNKMIEAIKNIFDYIIIDTPPIGLVV
DAAITANACDGFILVTQAGRIKRNYVEKAKEQMEQSGSKFLGIILNKVNESVATYGDYGNYGKRDRKRK
>gnl|bykdb|A0A1N6LYU0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus agalactiae] (length=229 residues).
MTRLEIVDSKLRQAKKTEEYFNAIRTNIQFSGKENKILAITSVREGEGKSTTSTSLALSLAQAGFKTLLIDADTRNSVMS
GTFKATGTIKGLTNYLSGNADLGDIICETNVPRLMVVPSGKVPPNPTALLQNAYFNKMIEAIKNIFDYIIIDTPPIGLVV
DAAIIASACDGFVLVTQAGRIKRNYVEKAKEQMEQSGSKFLGIILNKVNESVATYGDYGNYGKRDRKRK
>gnl|bykdb|A0A1N6LYZ8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus agalactiae] (length=232 residues).
MTRLEIVDSKLRQAKKTEEYFNAIRTNIQFSGKENKILAITSVREGEGKSTTSTSLALSLAQAGFKTLLIDADTRNSVMS
GTFKATGTIKGLTNYLSGNADLGDIICETNVPRLMVVPSGKVPPNPTALLQNAYFNKMIEAIKNIFDYIIIDTPPIGLVV
DAAIIANACDGFILVTQAGRIKRNYVEKAKEQMEQSGSKFLGIILNKVSESVATYGDYGDYGNYGKRDRKRK
>gnl|bykdb|A0A1N6NYR0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. RU4X] (length=231 residues).
MSRLTRNWTLITASNPKSPISESYRMLRTGVDYAGVDDPVDLLMVTSCRAGEGKSTTSANMAVTFAQAGQKVLLIDADMR
KPSQHHIFSLSNRGGLTGVLQGRSTLEQGVQASEVDNLDILTAGPTPPNPSEMLGSRAMAALLELAKEQYDQVIVDTPPI
LAVTDAHIVAGKCDGVVLVIDAGKVKSDTARKAKETLENAGSRMLGVVLNNVDRDGNSGYYYYYYGSEEQA
>gnl|bykdb|A0A1N6QZ65 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus simplex] (length=225 residues).
MRSKDKKQVNLIAQTNPKSPITEQYRLIRTNIQFASVDKDIQTIVVTSSEPNDGKSTTAANLAIVLAQEEKKVVLVDADL
RKPSVHYAFSLSNIEGLTSVLTKKMSIEKALFKTNVPNLEILTSGPIPPNPSELLNSKAIETAIDELKGMYDYIIFDTPP
VLVVPDSQIVANKCDGVIMVVASGKTNKQSAVKAKELLLKANTSLLGVVLNGVETDNSNYYYYQS
>gnl|bykdb|A0A1N6RN64 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Domibacillus enclensis] (length=235 residues).
MALKRNKQKNVPGSTKRKLITNTDPKSPISEQYRTIRTNILFSSVDETLHSILVTSTSPGEGKSTTISNLAVVFANQGKK
VLLVDADLRKPTMHYTFGLQNTVGLTNVLTKQTLLEDAVAKTGIENLSALSSGPIPPNPAELLGSLSMKEFLAHAQEQFD
YVLFDTPPVLAVTDAQVLANQCDGVVLVVDSGRTEIEGAQKAKELLQSAKAKLLGVVLNNQKLKDSAYYYYYGNE
>gnl|bykdb|A0A1N6W803 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus macquariensis] (length=229 residues).
MSRLIPKKLITESYPKSPISEGYRMLRTNIEFSTIDYKLQVIMVTSSKPSEGKSTTSANMAVAFAQSNKRVLLIDADLRK
PSQHHLFGTSNRVGLTTILFKQKELSEVIQPTNTENLWIIHAGPTPPNPSELLSSKQMATLLSTVRGMYDVIIIDTPPIL
SVTDAQIVATQSDGVVLVIDSGKVKKDVALKAKASLEHVNAKLIGVVLNNINRNESDSYSYYYGEKNDA
>gnl|bykdb|A0A1N7B5S8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. RU2C] (length=240 residues).
MGKLFKKRKGVSSSNRLTHIRSLISHKKPKSPISEQYRTIRTNIQFSSIDGEMRSVMVTSTLASEGKSTTAANLAVVFAQ
QGKRVLLVDADMRKPSVQYTFQLENHIGLTNVLAKQTNLASGIQESHVDNLWVLTSGPIPPNPSELLASQAMESLIQEMY
KQFDMVIFDTPPVLPVTDSHILANKCEGVLLVVRSGQTEREAVLKAKDILQKQQGKLLGVVLNGRPQEEGNYYYYYGSGQ
>gnl|bykdb|A0A1N7BU17 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus macquariensis] (length=229 residues).
MRQSATKPKLIMNINSRSPISEGYRNVRTNIQFSSWKQKLQVMAVTSTQAGEGKTTTISNLAVSYAQEGKRVLLIDADLR
HPSVQDIFHLANKMGLSNILAYQCSADELIRITDIDNLSIVTAGPIPPNPTELLSSGRMHEVVESWKGDYDIILIDTSPI
MAVADGIIVASICDGVILVVQAGKVKQEYIQKSKERLEHVKAHIIGVVLNNKKLNKSESNQYNYYSHLD
>gnl|bykdb|A0A1N7BY10 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. RU4X] (length=231 residues).
MPRSTSESSLITYYEPKSPISEAYRTLRTNIQFSSFDEPIKVIMVASANPGEGKSTTASNLAVTYAQEGKKTLLIDADLR
KPSVFQVFSVSNRVGLSTVVSGQCRWADAIQDTHVEQLDVLPSGPIPPNPSELLASHSMKSLLQELQAQYDVIIFDTPPV
LAVTDSLIISSLCQGVILVVQAGKVKSELVRKAKSNLEHVQARILGVVLNNMKSRKGDKYTYYYYGTKEAK
>gnl|bykdb|A0A1N7FF07 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. RUPDJ] (length=226 residues).
MGFRKKKSRRGLAQISVLHHKSLVAEQYRTIRTNIEFSSVQTHLRSILVTSSVPGEGKSFSAANLAAVFAQQEKKVLLVD
ADLRKPTIHETYQLENVQGLTNVLVGNASLGETVQKTLIDNLYVLTSGPTPPNPAELLSSKAMGELIQEMYSRYSLVIFD
SPPLLAVADGQILANQTDGSVLVVLSGKTKMDTVQKARDALQQSKAKLLGALLNKKKIKKTEHYSY
>gnl|bykdb|A0A1N7FLT1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. RUPDJ] (length=229 residues).
MLTRKKDKPGKRSVIAMSEPKSINSEQYRTIRTNIEFSSVDTEVKSLLITSAGPEEGKSTTAANLAVVFAQQGKKVLLID
ADLRKPTVHFTFKLDNGTGLTSLLLKQMPFQKAVLPADEANLDILTSGPIPPNPAELLSTGAMKDLLSEAAEVYDKVILD
TPPVLAVADTKILGSYTDGAIMVISSGKTDKEKAAKAKEALDYCPCKLLGAVMNGKKQTKHSDYAYYGQ
>gnl|bykdb|A0A1N7M9I1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Salimicrobium salexigens] (length=234 residues).
MVLKRRKHSPLMKRSLIAHENPMSPISEQYRTIRTNLDFASVDSELHMMTVTSAGPSEGKSLTTANLAVVFAQQGKKVLL
VDADMRKPTVHYTFRLDNVAGLSNYIAGHDHSLTNLINGSRVENLDIMTSGPIPPNPSELLGSQKMKDFLQEVKKKYDLV
IFDSPPVLAVTDSQVLTSQTNGTLLVVRNKKTEKEAAKRAKELLEQAKANVLGMVLNDVPQKESGYYVYYGKEK
>gnl|bykdb|A0A1N7NC70 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Salimicrobium salexigens] (length=228 residues).
MVRKQTVNKKGGYLVNGRHSLAAEQYKTIRTNLEFASVDRKLRSFFVTSPGPGEGKSTTAANLAAVFSEQGKRVILIDAD
MRKPTLHYTFSSDNVVGLSNYLAGQKTSVTNVIQETAVENLDIITSGPVPPNPAELLGGSSVKTLMNELKSTYDLIIFDT
PPVLSVTDSQLLAPHTEGVVLVVRSRKTRKEEANKAKEVLLHSRARILGAVLNGNEMGRRKKNYYYYA
>gnl|bykdb|A0A1P8Q251 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus allii] (length=259 residues).
MAFSLFKTKKQKQKLDNTSLKYGIGLVTYTDPKGQVSEQFKTVRTNIQFSAIDKKMKSLLFTSSDPSEGKSTVSNNVAVT
WADQGSRVILVDADLRRPTVHKTFGVSNRKGLSSYLLGNATFEEIIQPTVIENLYVITSGPVPPNPSELLGSMRTQDLIV
RLTDKFDLLILDAPPVNTVTDAQVLAARADGTILVVPQGIADKGGVRHAKEALETVNANILGAIMNRVTEQKSGGYYGGS
YYGGYYGGYYGTEDKDKED
>gnl|bykdb|A0A1P8Q268 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus allii] (length=238 residues).
MWNKKKKLDNNSQKNGINLITYSSPQSPISEQFKTIRTNIQFTAVDKKIKSLVFTSADPSEGKSTVSNNFAVSCATQNTK
TILIDADLRRPTIHRTFGLSNQVGLSNYLSRHAALDEIIQPSIVENLSIITSGPIPPNPSELLGGQRIKELLKELDERFD
LVILDSPPVNTVTDTQVLASVVDGVVMVVPQGIATKNGVIHAKESLELVHAHVCGAIMNRVTRSKSGYYGTEYYGIYK
>gnl|bykdb|A0A1P8VQG7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=234 residues).
MATLEIARTKKELVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMS
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVLVAEAGNVKRSSLKKVKEQLDQTGTPFLGVILNKYDIATEKYGEYGNYGNYGKKSLISQII
>gnl|bykdb|A0A1P8VQJ7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=231 residues).
MATLEIARTKKELVNKTEEYFNAIRTNIQLSGEDIKVVGITSVQSNEGKSTTVASLAIAYARSGYKTVLVDADIRNSVMS
GFFKPITKITGLTDYLAGTTDLSRGLCETNIPNLTVIESGKISPNPTALLQSKNFENLLATLRRYFDYVIVDCPPLGMVI
DAAIIAQKCDAMVLVAEAGNVKRSAVKKVKEQLEQTGTPFLGVILNKYDITTEKYGDYGNYGNYGNYGKKA
>gnl|bykdb|A0A1P8VQR8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=225 residues).
MAMLEIARTKREGINKTEEYFNAIRTNIQLSGADIKVVGITSVKSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGNVKCSSLKKVKEQLEQTGTPFLGVILNKYDITTEKYSEYGNYGKKA
>gnl|bykdb|A0A1P8VQV1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGNVKRSSLKKVKEQLDQTGTPFLGVILNKYDIATEKYSEYGNYGNYAKKA
>gnl|bykdb|A0A1P8VR01 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=231 residues).
MATLEIARTKKELVNKTEEYFNAIRTNIQLSGEDIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMS
GFFKPITKITGLTDYLAGTTDLSRGLCETNIPNLTVIESGKISPNPTALLQSKNFENLLATLRRYFDYVIVDCPPLGMVI
DAAIIAQKCDAMVLVAEAGNVKRSAVKKVKEQLEQTGTPFLGVILNKYDITTEKYGDYGNYGNYGNYGKKA
>gnl|bykdb|A0A1P8VR55 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=237 residues).
MATLEIARTKKELVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMS
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVESGNVKRSSLKKVKEQLDQTGTPFLGVILNKYDVVTEKYGEYGNYGNYGNYGNYGNYGKKA
>gnl|bykdb|A0A1P8VRD2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKKELVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMS
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVLVAEAGNVKRSSLKKVKEQLEQTGTPFLGVILNKYDVVTEKYGEYGNYGNYGKKA
>gnl|bykdb|A0A1P8VRJ2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGSVKRSSLKKVKEQLDQTGTPFLGVILNKYDITNEKYSEYGNYGHYGKKA
>gnl|bykdb|A0A1P8VRK8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=227 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMS
GFFKPVTKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLIATLRRYYDYVIVDCPPLGLVI
DAVIIAQKCDAMVAVVEAGNVRRSAVKKVKEQLEQTGTPFLGVILNKYDVVTEKYGEYGNYGNYGRK
>gnl|bykdb|A0A1P8VRN5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKREIVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMS
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFEDLLATLRRYYDYVIVDCPPLGMVI
DAAIIAQKCDAMVAVVEAGHVKRSSLKKVKEQLDQTGTPFLGVILNKYDIANEKYSEYGNYGHYGKKA
>gnl|bykdb|A0A1P8VRR1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKKELVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMS
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVVVDCPPLGLVI
DAAIIAQKCDAMVLVAEAGNVKRSSLKKVKEQLDQTGTPFLGVILNKYDITTEKSGEYGNYGNCGKKA
>gnl|bykdb|A0A1P8VRV0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=231 residues).
MATLEIARTKKELVNKTEEYFNAIRTNIQLSGEDIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMS
GFFKPITKITGLTDYLAGTTDLSRGLCETNIPNLTVIESGKISPNPTALLQSKNFENLLATLRRYFDYVVVDCPPLGMVI
DAAIIAQKCDAMVLVAEAGHVKRSAVKKVKEQLEQTGTPFLGVILNKYDIATEKYGDYGNYGNYGNYGKKA
>gnl|bykdb|A0A1P8VS94 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKKELVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMS
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVLVAEAGNVKRSSLKKVKEQLDQTGTPFLGVILNKYDIATEKYGEYGNYGIYGKKA
>gnl|bykdb|A0A1P8VSC4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=225 residues).
MAMLKIARTKREGVNKTEEYFNAIRTNIQLSGADIKVVGITSVKSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMP
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVAVVEAGNVKCSSLKKVKEQLEQTGTPFLGVILNKYDIATEKYSEYGNYGKKA
>gnl|bykdb|A0A1Q1G0L6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Auricoccus indicus] (length=237 residues).
MLSRSNKKSKNKNNNKRQLITHTEPKSPISEQYRTIRTNLSYSSVDKKMQVILITSADPSAGKSTTAANIAVAYSQSGNR
TLLIDGDMRKPTVHHTFELPNQQGLSNAIVNDEMSVYSMIHESMIPSLYVLTAGPVPPNPSELIASQKMEHMIEEFRTEF
DTIIIDTPPVLAVTDATVFSNYTDGTLMVINAQDNNRNSINKAKNNLEKANANILGIIMNNVKNKANDDYYYYKYYG
>gnl|bykdb|A0A1Q2C8C0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerostipes hadrus] (length=238 residues).
MKKLVMDLPEINDYRMVEGLNQLKTNLAFCGKDIKVITMTSSVMNEGKSSVSLSLSRTLAESGKKILMVDADLRKSVMAA
RYHIQGIDKGLSHYLTGQAEVEDIIYETEVEGLCITVAGPLSPDPTSILDSEQFEQFIEKVRDMFDYVIIDTPPLGVVID
AVIIGKYTDGAVIVIEQGVIKRKIVQDVIKQLKRGEVRIFGAVLNKVDERIGAYGNYEYKYSYSYYGESDTGKKHQNT
>gnl|bykdb|A0A1Q2D409 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Vagococcus penaei] (length=232 residues).
MARKEKNKLSRPTGSVLFTVADPKSPTSEQYKTLRTNIKFSQGDHPIKSIVMTSAGSMEGKSTTAANLAVAFAQSGLNTL
LIDADLRRPTCHMTFDLENTKGLSNLISIRSMSLQDVTQKTEISNLSVITSGPKSPNPSELLSSARMRKVIKIISQYYDF
VIFDMPPVVQVTDAQIIASQVDGVVLSVREGITNKLMLTKAMELLNQVQANVIGAVYTGVEDSHGYYAYTYN
>gnl|bykdb|A0A1Q2L2D7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planococcus sp. Y42] (length=234 residues).
MAKTTKKGLQQVARKLIANSNPKSYVSEQYRTVRTNISFSSADKEVSTLLVTSAVPGEGKSTTSANLAVVFAQSGKRVLL
VDGDMRKPTSHYTFHVNNAIGLSNLLTRQANMEDAIRRTNIENLDLITSGPIPPNPAELLASRTMDAVLQELLSGYDLVI
FDAPPVLSVTDAQILANKCEGTILVVNSGATEKENALKAKEAIQKTNGRILGTVLNNFKFEKENGYYQYYGTAE
>gnl|bykdb|A0A1Q5P5V1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Domibacillus mangrovi] (length=236 residues).
MALKRKNKTPVAPGSAKRKLITYTNPKSPISEQYRTIRTNILFSSVDQSLRSILVTSTSPGEGKSTTIANLAVVFANQGK
KVLLVDADMRKPTMHYTFGLQNTFGLTNILTKQTTLEATAVQSDIENLSILTSGPIPPNPAELLGSFSMKEFLDHSLEKY
DFVLFDTPPVLAVTDAQVLANQCDGTILVVNSGKTEIDGLQKSKDLLQSAKAKLLGVVLNNRSMKDSSYYYYYGKE
>gnl|bykdb|A0A1Q5SWQ7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Geobacillus sp. 1017] (length=232 residues).
MARKPATSIRKAERRLIAADNPKSPIAEQYRTIRTNIQFSFIDAPLRSLIVTSTGPGEGKSTTAANLAVVFAQQGKKTLL
IDADLRKPTVHYTFRLNNYKGLTNVLTGSAPLLPTCQATEIDHLSILTSGPIPPNPAELLSSKAMAQCLEQLYETFDLVI
FDTPPVLAVTDAQILANQCDGTVLVIESGGTEIEAAVKAKELLEAANAKLLGVVLNKRKHRDGGYYYYYQYK
>gnl|bykdb|A0A1Q5XGZ8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. P3E] (length=228 residues).
MSQQPSKQRHLITVTNPRSPVSEAFRALRTNIDFSSVDKQIQIIMVTSSGPEEGKSTVTANLAAAYAQADKKVLLIDGDM
RKPTAHKTFSLSNRFGLSSLLSQQADLEEVVQESGVANLFIMTSGPIPPNPAEMMSSNRMSAVLEELRQRYDMILFDTPP
LLAVTDAQIVASKSDGVIMVVSYGKVKREIAVKAKANLDRVGAKMLGVVLNNVKRKASEGYYYYYYGN
>gnl|bykdb|A0A1Q5XVK4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. P46E] (length=228 residues).
MSQQLSKQRHLITVTNPRSPVSEAFRALRTNIDFSSVDKQIQIIMVTSSGPEEGKSTVTANLAAAYAQADKKVLLIDGDM
RKPTAHKTFSLSNRFGLSSLLSQQADLEEVVQESGVANLFIMTSGPIPPNPAEMMSSNRMSAVLEELRQRYDMILFDTPP
LLAVTDAQIVASKSDGVIMVVSYGKVKREIAAKAKANLDRVGAKMLGVVLNNVKRKASEGYYYYYYGN
>gnl|bykdb|A0A1Q6J435 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridiales bacterium 41_21_two_genomes] (length=292 residues).
MARKSKKSASSSSRHLLQDISIDPSLRFRVEEAYKSIRANIMFSIMKKGCKTIVVSSASPNEGKTTTTINLAITLSQADQ
KVLLIDGDLRKPKVHQYFQFQNAPGLTDYLGSTVSSSRRDRVGLFDVIHPTQFENLSVICSGSIPPNPAELLGSELMAGF
LAEIGKDFDYIVIDTAPINVVSDALPLIRESDGVILVVRSNQTTHPDIQKAISSLEFIDAKILGFIVNFAGDGQSGKYGY
GKYGYRYGKKYGYGYGYGYGYGYGYGYGYGKNDGADYSPAKKSMRKTDPRNE
>gnl|bykdb|A0A1Q6J4T0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridiales bacterium 41_21_two_genomes] (length=228 residues).
MLCQNSPFAVKEAYNAIRTNLLFTQQGEKCPIFVVTSPTANNGKTINSINLAVSFAQMGKRTLLIDADMRNPTIHRMFSI
SVKNGLSEILAGLTDNISVSKTDVENLSVLTAGKIPPNPAELLSSARMDKLLEFVKEHYDCVFIDTPPINLVTDSTIFAQ
KVTGYIVIVKTDTTNTHDVKTTVTNIEQIDGNILGFILNDVNSEKKKYYSYYRKYNYNYSYNYNYKYR
>gnl|bykdb|A0A1Q6JLG1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridiales bacterium 41_21_two_genomes] (length=231 residues).
MAIQRVMMTDSRKEDVFYEEAIKTLRTNMQFSGVETKSIVITSCYPNEGKSDVAFQLAVEIGKMGKRVLIIDADIRKSSY
IKRYQIKQKTNGLSQYLSGQVALEEVIYSTNYRNLEIIFSGPYAPNPSELLEQGRFSRLIEETRKAYDYVLIDTPPIINM
SDAAIVAKQCDGAILVIESEAVSRRDAMKAKDQLMKSGCKLLGAVLNKVDMKKEKYYSKYNSYYYGKSKQE
>gnl|bykdb|A0A1Q6K024 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridiales bacterium 45_37] (length=471 residues).
MSKEYESKTEHKENLIDIAGLFDDLIKGIIQMKWRFLIILVICGAVFCGYKRLTYSPYYVASSTFTINSSITSENSNSYI
ENATANQMAKSFPYILKSGAFKEVLAQDLGLQSVPGTIEAEVMENTNLFTLKVTANNPKMAEKILKAVVKNYPSVAEFVI
GSSQLTLMDESGVPTTPANPFSYRHEIQIGVLIGILLCILLDVLLALGKNTVKKEEDFKRLFHAKSLGIMPRAKFHKKRT
QTQELIVLDNPRIPRSFLEAARTVRRRIERAQKETGMKSFLVTSAMPGEGKSTVSANIAISLAMKGYKVILVDADLRNPS
TAKVLGMNEQELGTLEVMKGEVNIDDAVQQYKNTSVKVLAGSTPIQDTSTVLSGKNMRQFVKELEAEADFVIIDTPPSGL
LSDAAIVAQYVDGAVFVIRQDYTDVDRILEGMEILSGSGAEITGCILNDVNVRTSESQHYMNSYRTKGETL
>gnl|bykdb|A0A1Q6KF44 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. 28_12] (length=369 residues).
MRRELIAYEDPKSHVSELFRTLRTNVQFINSNKKLRTLLVTSTIPNEGKSWISSNLAITFAQANKRVLLIDADMRKCSLY
KIFRVEACPGLSNYLAGMNENNDGNNLGKYVKETEVPNLYLLPAGNIPPNPSELLASSRMTALLNELKREFDLIIIDGTP
SKLVTDAVVLSRIVDSTIIVTGHNMVKKDDLSKVIRDIQNVGGRIAGIVYNKKPVSGKKINETYYYSFDAMKVDSRKKQE
MEFEQRRQAQRNRANDMIKRDRNSNESRNAAQQHQGNQGNQRPHNQIPQQNQQQRPQQRTQNSNINTNANSNTNQNMNQN
QGQKQPNISQQHTQPQQQAKSPEDRAAEMLKQFNDYLQKEKENRDKRNF
>gnl|bykdb|A0A1Q6L4A8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. 26_22] (length=312 residues).
MKTRKELIAQRDPKSPISEVFRTLRTNIQFMDTSKKMKTLLLTSTFPGEGKSWVSSNLAVTFAQAGKKVILIDADMRKGR
QYTIFGVSPRPGLSNYLSEIDIERPEETDISMYLQKTEVENLLLMPAGNVPPNPSELLVSPQMTKLLEDLKQVCDLIVID
GTPCELVTDSVILSRVADATVIVTAHKETKKDNLERVIKNIQNVGGKLVGVVINKMPVSAKKYNEKYYYHSTSTHNTNNF
NTKNIANELKKETQNITKINNQKSKIDIEKESDLGRPLIFNNEDRKSTLDKTNDILNQINSYLDKEKDDLNK
>gnl|bykdb|A0A1Q6LCR0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridiales bacterium 36_14] (length=251 residues).
MNEVTIGNMPTLPYAVEEAVNRLRINISFLGSDIKKIMVISTMPDEGKSFVTMQLWRQMAESGTPSILLDADLRKSIMTD
KYDITMNDGSEVWGTSYILAHDIPIQDAVLHTQISGGDILPNVKNVVNPSMLMESKQFENMLNTMADMYRYVFIDAPPLN
LVSDGEKIGSLCDGAILVVRGGFTQKKMVRNSIRQLERAGCPVLGIVLNRVGGNRGSYYYNKYGGKKYGYGYGYGYYGSN
SKGNEYYYASK
>gnl|bykdb|A0A1Q6LEF1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. 27_14] (length=344 residues).
MRKEVIAHKDPKSPISEVFRTLRTNIQFMNANKKMKTILVTSTFPGEGKSWVASNLAVTFAQAGKKVVLIDADMRKGRQY
AIFGISPTPGLSNLLSGIEEKENNITNTMADYIQETEVENLYVLSAGNIPPNPSELLVSTQMINLLEELKKVCDIIIIDG
TPCELVTDSIILSRIVDSTVIVTAYKITKREALERVIKNIQNVGGNLAGVVLNRIPVSNKKYEEKYYYYGHENIGKDTQK
TKNKHLDLPNQEEINKQKIMEVLNVEEQQNNITEETQKNNQGIQTEENINNINQEIPQQEIQQDAQQEQNQLENNEEKII
YLEKTNNILNQIKDYLSNEKKDLN
>gnl|bykdb|A0A1Q6LJ51 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. CAG:12237_41] (length=242 residues).
MKSIKINNMPDLPYAMEEAVNRLRINISFLGTKIKKIMIISTEPNEGKSFVAMQLWKQIAEAGTPSILLDADMRKSVMAD
KYEIVSEKKEEIKGLSHYLSSDYPIEEAIFHTQWENGDILPNIDNVINPSMLLESNRFEEMLAYMEEKYRYVFIDSPPLS
LVSDGERIGNLCDGAILVVRGGVTSKHLVKNSIRQLERAGCPLLGVVLNRVEGAKSGYYSKRYGSKYYGGKYYNDAYYYG
NH
>gnl|bykdb|A0A1Q6LVN4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. 44_14] (length=245 residues).
MAKVLFEGRKELDYRVNEAYKSLRTNVQFSGTDVQVIDFTSCTPNEGKSSVSFNLAVSFADSGKRVVMIDADMRKSVLAG
RYKVGGVEAGLAHYLSGQKTLDEVCLKTDIEGMDIIFSGPFVPNPAELLESQNFHDLVQYCREHYDYVLIDTPPLGSVID
SAIVAKECDGAIIVIEADAVSYRFVQNVKNQLAKSDVKILGTVLNKVPMGNGKYGYGKYGKYGYGKYGKYGEYGDYGAYG
HDGDK
>gnl|bykdb|A0A1Q6M4N2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. CAG:245_30_32] (length=315 residues).
MKKELITFRNPKSPISETFRTLRTNIQFMNVNKRLKSILITSTLPGEGKSWVASNLAVTFAQAGKQVILIDADMRKARQY
SIFGVSPRPGLANYLAENDKNAELSDMEKYVQRTEIEGLYVISAGNVPPNPSELLITPQMQRLLDKLSSQCDIIIVDAPP
CELVTDAAILSRIVDSTIVVTAHKFTKKANLQKTIKSIKNVGGRIAGVVLNKVPIDAKKYEKSYYYGSQLTTTRGKREAG
RAVSKKDFFEEEHKKPVEDKVKIEKEVVKNEKTEEPKQNEKVENDMPDKTQEILRQVNEYLQQERNNLNDTKRDN
>gnl|bykdb|A0A1Q6MC04 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. CAG:307_30_263] (length=309 residues).
MQTINIETNQQDDYQVRESYRNLRTNIFLSGKDTKVVMFTSCGPNEGKSTVTMNLASSIADGGKRVLFIDCDLRKSVLVG
RYRVKKGVKGLTHFLSGQNTLEEVIYQTNVPDMDVILAGPVPPNPSELLDSPLFKETVRQMREKYDYVIIDTPPLGSVID
AAIVAQVCDGAVLVIAANQVSYKFAQNVMGQLKKTKVKIIGSVLNKVDLSENGYYGRYYGKYYGKYYGSYYGHYNSEESP
DKSFEKARNASSARKNTNNASKPVKRQAGSVGEVAARKKANAAGNNTGVRKKPSADEFDGDFLMDYDEK
>gnl|bykdb|A0A1Q6NJ75 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Eubacterium sp. 38_16] (length=245 residues).
MKKLNLKIKDMPYAAEEALNRLRVNIKFCGKNTKKIVITSSVLNEGKSTVSVRLWKLLSEAGFPTVLVDVDLRKSEIQKK
YQVEGIKEGLNHFLSGLAEYEDVVYETNIPNGHIVPVTTLLENPSALLEDPRLGELLDRLAEDYRYVIIDTPPLDNISDG
ALIASMSDGAVLVVRCGETSKALVRQSLQQLDRVGCPVLGTVLNCAEIRSGAYKKYYGRYGKKYGDYYGAYYGGNTTEKK
AGTKE
>gnl|bykdb|A0A1Q6P2L0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Coprococcus sp. CAG:131-related_45_246] (length=250 residues).
MKKLNIEFQELPYAVEEAMNRLRINIKFCGKNTRKILITSSMPNEGKSSVAINLWKMLAEAGFPAVLVDVDLRKSVIKDR
HHIKDADKLPDLGYFLSGQSEMEDVIYETQVENAYIVPCMNLLENPSALLEDARFAELLDKLAETYRYVIIDSPPLGSVA
DAAQIASLCDGAALVVRAGETSRSLIKQSFQQLDQVGCTLLGVILNRVETTGRAYKKYYGKYGKYYSQYGYGYGTYGKEA
AASSDSTPSK
>gnl|bykdb|A0A1Q6PKE5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Eubacterium sp. 41_20] (length=241 residues).
METVVINQIKDQSYTMKESLRALKTSISFSGKGVKSILFTSSVPNEGKTTVVMDLARSMADSKKSVLIVDTDMRKSVLVG
RLRAKVESGGKIYGLSHYLSGQVSLDKVVYATNIKGVFILFAGHEVPNPTELLETKEFKELIEFGEKNFDYVLVDTPPTG
AAIDAAVVGKNVDGAVIVAAQNVTSSRAIINTKRTLEDSGVKILGAVLNKCRFEESKYGHYYGNYYGNYYGNYYGRDDDE
K
>gnl|bykdb|A0A1Q6PL57 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Eubacterium sp. 41_20] (length=237 residues).
MELVKFGKLKEQSYTMKESLRALKTNIQFCGDDIRTLLVTSSVPNEGKSTVALDLARSLTESGNRVLFIDTDMRKSVLAG
RLRATAASGGEICGLSHYLSGQRRLEEVMYGTEIPGLFMIFAGPSVPNPTEILEKKYFQELLNFGKEHFNYIIIDCAPIG
AAIDAAVVAKYCDGAIIVIGQGMASARMIQSVKKQLEASGVRILGAVLNKVNNKKNSHVSGYYGNYYGSYYGQSDKA
>gnl|bykdb|A0A1Q6PYH5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Faecalibacterium sp. CAG:74_58_120] (length=244 residues).
MKKAIIHQHYPLDYAGEEALNSICTNLAFIGTDKRKIVITSNSQSEGKSWMTMHIAEDMARRGRHVVLVDADMRRSFMVQ
RYKLELEGEGLGLAHFLAGQCDLNDVVYESDVYGMCLIPAGRDVVNPINLIDSSYFEQMLEALAQSFDMVIVDAPPVGMV
IDAAEIAAFCDGSVLVLEYNHTRLGEVAECKRQMEKSGTPVLGCIINKVNFNALSAKRYYNKNYYSHYTKGYYKHDDKDN
QAKA
>gnl|bykdb|A0A1Q6QJY0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Firmicutes bacterium CAG_194_44_15] (length=250 residues).
MSNQNKVILGNMPSLPYAIEEAVNRLRVNMSFLGEDVKKIMVISTMPDEGKSFVTMQLWRQMAETGIDSVLIDADMRKSV
MVDKYDVKKEDGGKILGCSYYLANDIPLEQAVLKTQYEHGDILPNNDNVVNPSILLENHKFADMLDELAGKYRYVFVDAP
PLNLVSDGERIGSLCDGAVLVVRGNSTPKSIVKNSALQLERAGCPLLGVVLNRVKGANGGYYYKQYGGKHYGYGYGKGYG
DGYGYYGENK
>gnl|bykdb|A0A1Q6QPB9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Faecalibacterium prausnitzii] (length=242 residues).
MNKLQIGKMPQLPFEVSEAINQLRINLSFCGSDVKTIMITSSTPNEGKSFVTMQLWRMIAELGTPAVLIDCDFRKSEMRS
KYGMSTSGQLIGGVHYLAGKAELDDVIYETNVPNGYIIPVAKTVTNPAILLESERFAQMIEHCRQRFGVVLIDTPPLGSV
ADAMNIATHCDGTVLVVRGGETPRKVVGDSVQQLKRTGVPLLGVVLDRAEMNSKSSLYYKRYYKSGYYYKGYGSERSQPV
QK
>gnl|bykdb|A0A1Q6R7Z2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Firmicutes bacterium CAG:176_63_11] (length=273 residues).
MSLDKQKGARDAGKREAAQTEQPIIGEYLSFAATEAYKLLRTNLMFALPDQGKCRVVGVTSALRNEGKSTLAINLAYTVA
QAGYRVLLIDGDMRLPTLAKRLNIPKRPGLSNLLAGLCTVQDAVQTSDLLDNLKAIAAGDIPPNPSELLASARMETLLRE
LGADYDFILLDLPPVTAVTDGLVISKLVDGMIVVVCRGYCEKKLLEAALRNMKYLNIKILGFVMTRGSVDKSGYGKRYGK
YKKGYGGYYSYGAPPAGDRRPSEPKQTGGKKLS
>gnl|bykdb|A0A1Q6S454 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Oscillibacter sp. CAG:241_62_21] (length=485 residues).
MEHTTHINTEEQAIDLSVLLRRMLRALRRLWPVCLALIVLCAALMGWRSHRSFRPMYRSEAVFSVNLSFVGGTDLSGYSQ
YYNKSAAQQVADTFPYLLTSDRMQELLLQRLGVTYLNGVISSSAIKDTSFFVLTVESPNPQDAYDILCAVIDVYPQVNRL
VLGETQLVVNQEPTLPDAPYNADPWLSSAVKGAALGLALSLVVLLIAASLRRTVSSTGDVKRLVNLSCLASIPRTTPKRR
KSGAQTGLLISHMQTDSAFCEAYRLLRLKLLRQLKEEDKILMVTSSVPSEGKSSVSVNLALSLAREGKKVLLIDGDLRGP
SDKALLGITKPSEGLGQCLSGSLDQVHFLRYEDTSLYVFAGSQPIQSPMNLLQYDKLEALMNTLRPMFDYIVLDTPPCAM
MADALALCRHVDRVVYVIREDFAATTQIFEGVQALAGADARMAGFVFNCAATARGAASGYGYGYRYGYGYGYGYGYGKTK
PKDER
>gnl|bykdb|A0A1Q6S4S1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus sp. CAG:108-related_41_35] (length=239 residues).
MKKYPKRGSFQDVKLNAEAVGFQIKESYKKARTNIAYSIVKKGCKMVSITSSSKSEGKTITAVNIAIALAQQVDTRVLII
DCDLRRPRIQSVLEIPVDKGITNYLNFECEVSDIVYTSKLDNLDAICCGTIPPNPSELLSSDNMKELIKELSKQYDYIIF
DTPPIGVVIDALPIIKQTDGVVVIVRDNVTDIRDYKKTIDILKRSEANIIGVIFNDVEPVGKRKYGGGYKYGYYGEYGY
>gnl|bykdb|A0A1Q6SC33 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Firmicutes bacterium CAG:65_45_313] (length=237 residues).
MQSIELKLEKQDFRTKEAFKTLRTNIEFSGENIRVICVTSCTPNEGKSSVSYELAKSFAQNGKKTILIDADLRKSVMRGR
HKKGKVRFGLTNYLVGKVDLDTAICETDIPNFHLLFAGPVPPNPSELLGNTRFQKMVEACRMKYDMVIIDTPPLGSVIDT
AVVSKFCDGAVIILACGEISYRFAKRVKDQLAMTGCKILGCVLNKVEMSGKGYYGKYYGKYYGKYYGKYYGNYGTEE
>gnl|bykdb|A0A1Q6T859 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Subdoligranulum sp. 60_17] (length=248 residues).
MSKASKNTSHRKLFTVGGDAPFQFVEAYKSLRTNLEFLSSAGNCKTILITSSVPEEGKTNVAVNLAMTIAASGKRVVLVD
CDLRKATISRYLRIPRNHAGLTNVITSKDEGALATALVRVKDSGITVLTAGTIPPNPAELLSAPMTEKIFASLQKAFDYV
IVDTPPVSLVTDAAVLCRMADGVLLVVRPGVTTIQSAQLSKKNLEAVNAHILGVVMNGYNGKQSGRRDGYSYAYSYSYYD
EDKKGNDA
>gnl|bykdb|A0A1Q6THA3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus sp. 37_24] (length=234 residues).
MKKITLTDKRKSNYYYNEAIKTLRTNIQLSGQSIKTILVTSCYPNEGKSDVILSLAQELGSIGKKVLLLDADIRKTAYVG
CLGVEEEVKGLSEFLSGQANVNDIIYETNFPNMDIIFGGPTAPNPSGLLSENVFQVFLKKVREYYSYILIDTPPIGTVID
AAVIGRCCDGAIFLIESGSVRYKDAQKAMSQLERSGCQILGAVMNKIDSKSDKYYSSYYKHYGEYYRKADEENK
>gnl|bykdb|A0A1Q6TPV7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Roseburia sp. CAG:197_41_10] (length=244 residues).
MKIVKFGRLKEQKYAMKESLRALKTNIQFCGDDIQTIVVTSALPNEGKSTVTMDLARSLTESGKRVLLIDTDMRKSVYVG
RLRATASDGGEIYGLSHFLSGQKRLEDVLYGTEVPGLFMIFAGPSVPNPTEILEKNYFIELLKFAKEHFNYVLLDCAPIG
AAIDAAVIAKHCDGAILVISQGMASSRLIQNVKKQLEVSGVRILGAVLNKVKMKKSSYEGGYYGGYYGGYYGSYYGKKEE
KTKE
>gnl|bykdb|A0A1Q8DDT2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=234 residues).
MAKKNEKRKKLQTPLFVEDKPKSIVSEKVRGIRSNIMFSGVEEIRGIIVTSEKPAAGKSIVSANIAITYAQAGYKTLIID
GDMRKPTQHYHFETTNYDGLSNLIIGKSDFDRAIRSTRINNLDLLTSGPIPPNPSELIASTNFTSILDKLFSIYDFILID
TPPVISVTDAQVYLRNVDDCVLVIDTEHNNKNEIKKAKRLIEQADGHLLGAILNKTPKEKSSTYYYYGDDESND
>gnl|bykdb|A0A1Q8H4I7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus paralicheniformis] (length=230 residues).
MAIRKKRSRKYQSALVALHQPNAPIVEQYRTIRTNIEFSSFEKPFKSLLITSGLPGEGKSFSASNLAVVFSQQEKKVLLI
DADLRKPTIHKIFELDNHSGVTNVLMKKTTLENVVQQSPAENLHVLTSGPIPPNPSELLSSQAMEDLLAEAYNQYDLVIL
DSPPLLPVADAQILANQVDGSILVILSGKTKLDNAIKSRDALNSSKSELLGAVLNGRKVKKARQYNYATM
>gnl|bykdb|A0A1Q8TUR9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus megaterium] (length=236 residues).
MARKNKAQKNDKMLTLKRRLLAHNSPKDPVAEQYRTIRTNIQFSNVDQDIKTIVVTSSGAEEGKSTTTSNLATVYAQQGL
KVLLIDADLRKPTGHYTFRLENHIGLTNVLTRQSTLAQAVQESEIPHLSVLTSGPIPPNPSELLASAQMAELLREMKEQF
DMIIFDTPPILAVADAQILANQVDGTILVVSSGKTEKDAALKSKELLSNAQGKLLGVVLNNRKVEEGNYYYYYGSN
>gnl|bykdb|A0A1Q8V2Q9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus pseudofirmus] (length=230 residues).
MSRKKHTKESNKRNLITHHEPKSPISEQYRTIRTNIEFASIDEKVSTILVTSAGPMEGKSTTASNLAVVMAQQGNKVLLI
DADLRKPTAHYTFGVANLAGLTSMLTKQHTAEEAVQVTEVKNLYILPSGPIPPNPAELLSSRGMSVLLEKLATAFDVVIL
DSPPLLAVTDAQILAKHANGTILVVSSGKTDQEQAVKAKDLLTAAKAKVLGVVLNAKELKEGQYYYYYGR
>gnl|bykdb|A0A1Q9B987 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus pumilus] (length=227 residues).
MIFKRKKREKRDLSCISVLNTHSVIAEQFRTIRTNIEFTSIQTRLKSILVTSSLPKEGKSFTAANLAAVFAQQQKRVLLM
DADLRKPTVHEYFDLDHHTGLTNVLLNNCSLEEAILPTPIEHLDLLPSGTIPPNPAELLSSSVMKQLFYEIEQQYDMVIV
DSTPLLPVADAKILANRTDGSILVVLSGKTKIAAVKKSKEVLEGTTSKLLGAMLNGKKEKKGRQYMY
>gnl|bykdb|A0A1Q9FMM1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus licheniformis] (length=238 residues).
MAFRKSGGSWMRRNVIAMTEPKSLNSEQYRTIRTNIEFASVDRKMQSVMITSACPGEGKSTTAANLAVVFAQQGKKVLLI
DADLRKPTVHTAFHLENMIGLTSVLLKKSSLKQAVQATNEKQLDVLTSGPIPPNPAELLSSKWMKELTDEACAAYDMVIF
DTPPILAVADAQILGSVADGSVLVISSGKTEKEQAAKAKEALESCSSKLLGAIMNGKKLSKHSEYGYYGNKDNFIQNK
>gnl|bykdb|A0A1Q9FY96 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus licheniformis] (length=227 residues).
MVFRKKKARRGLAQISVLHNKSIVAEQYRTIRTNIEFSSVQTNLRSILVTSSVPGEGKSFSAANLAAVFAQQQEKKVLLV
DADLRKPTINQTFQVENVTGLTNVLVGNASLSETVQKTPIDNLYVLTSGPTPPNPAELLSSKAMGDLISDIYEQFSLVIF
DSPPLLAVADAQILANQTDGSVLVVLSGKTKTDTVLKAKDALEQSNAKLLGALLNKKKMKKSEHYSY
>gnl|bykdb|A0A1Q9I0F3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDLNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSIDNLSFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A1Q9JSQ6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerostipes sp. 494a] (length=471 residues).
MDRKYNEKKENREGLIDITGILDDLIKGALHMKWRFLVLILLCAGLFCGYKRLNYSPYYVASSTFTISSSISTESSATYM
DNATANQMAKTFPYILKSGVLKDIVAQDLGVQSIPGKIKADVMKDTNLFTLSVTADDPKMADKILKSVVKNYPTVAEFVI
GSSQLTLMDETGVPTAPANPFSFSHEIKIGILVGIALCFILDLLFALGKNTVRKEEDFKKMFSVKSLGILPHARFNKRRS
NVQELVVLDNPRLPRNFLEATRTVRRRIERASKESGMRSFLVTSAMPGEGKSTVSANIALALAMKGHKVILVDADLRNPS
TAKVLGMKEQSIGTLEVIKGEASIEEAVQPYKDTGVMILAGSNPIQDTSSVLSGENMRHFIKELEKQADFVIIDTPPSAL
LSDAAIVAQYVDGAVFVVRQDYTDVDQILDGMEILSGSGVTINGCILNDVNTGTAQSSHYGHGYHAKADAI
>gnl|bykdb|A0A1Q9K0R3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerostipes sp. 992a] (length=498 residues).
MKEYENYQHMSKDTDSPMSFDPYTILKDIQKWIVVIVLIAASISLLMYVNQGRKYVKMYESSSTFIVSSSGTNNNVYNNL
SVTSEISKKFSEILNSSILQKKIAEELGMEYFPGQATAEIVPETNLLVLKVQATSPELSFRLTKALMDNYDIVSDLLIGN
VVLDVLQEPEVPSEPINRFMPFDIMQKTFLITVAGLCIVVGIWSYMKDTIRKPKEVSKKLNTKLLETLYHEDKNKTLQAK
IKQENTHNSILITNPSTSFRYVETMRKLARKVKSSMDEAGAKTVLITSVEEGEGKSTVAANLALALAEESKKVLLIDGDL
RKPAQYKIFGYTEEETDQFGKMLEGKAKADRLINQITNTNLYVLLNSIGYENSTEMLTTGLFEKILSYLKQQVDYIVIDT
SPMAQVADTEELVDMADVSVLVVKQHVAQTKDINDAIEVLNSTGMKLLGCIYNDAFVGVAEKTRNYGYGYGYGYGYGYGG
YGKYGYGGAYEKNRSKHV
>gnl|bykdb|A0A1Q9KTY5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. MB366] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A1Q9MFF6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus casei] (length=247 residues).
MNWSLKNVLHPHREDHETQKNGVMLVTFAEPKHVVSEQFRTVRTNIEFAGAALNRCQVVMFTSSAMSEGKSTVSANVAVT
WAQSGKKVLLIDADLRRPTVHATFRKLNLDGVTTILTGKAAPEDVVEDTFVENLDVLTSGPIPPNPSELLNSGKMGGILK
WARDAYDIIVLDTPPILAVSDVQVLVPRTDGVVIVANIGKTTKGDLKRTVEVLKLAKAKILGCVERVRTKHGDRSYGYGY
GYENDNS
>gnl|bykdb|A0A1Q9PXH5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus pseudofirmus] (length=235 residues).
MLKRNQSASTRTQQQRKVVSHSNPKSPIAEQYRTLRTNIQFANMDGQEIRSILVTSAGPGEGKSTTIANLSIVLAQQGKR
VLLLDADLRKPTVHYTFQVDNTFGLTNVLTKQHTLSDAVKETKVEELHVLTCGPIPPNPSELLSSKAMADLLEEAFQYYD
YVLLDTPPTLAVTDAQILANLTDGSILVVSSGKTNRDGAKKAAEQLKQAQAKLIGAVLNDKKKDNTSYYYYYGDK
>gnl|bykdb|A0A1Q9Q3C1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. MRMR6] (length=234 residues).
MVLKRNKKLKTTDPSRKLIAQLDPKSPISEQYKTIRTNIQYSSIDQEIRTLMVTSAGPAEGKSTTVANLAVVFAQLGKKV
LLIDADLRKPTVHRTFGVNNLFGFTTVLTKQATLEKTVLETEEENLFILTSGPVPPNPAELLSSKSMEQLVVEAKEHFDY
VIFDTPPLLAVADPQILANKCDGSILVVYSGKTEIDQAKKAKELLSNAKSKLLGVVLNHKEIKNNDYYYYYGSK
>gnl|bykdb|A0A1Q9YC37 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Erysipelotrichaceae bacterium NYU-BL-F16] (length=238 residues).
MAKNVIRKNDDMNLDEVYRQLRTNIEFSQMDETLRSINVLSTNPNEGKSSVSLNLAKIFADKYQKVLLIDCDLRNPSLNK
FLRVSNSKGLTNLLTHYQKGDLIQEQDELKIIDFGNNTQLYFLSTGSKVPNPTEVISSRRFSTFINEAKKQFDAVIVDCP
PVFAVADGIPISHVVDGTLFVLSAKDTDKYDAREAVQDLQRNGANLIGVVMTKVPGFRSKHYYGYGYGKYGGYGDSND
>gnl|bykdb|A0A1Q9YJF0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Faecalibaculum rodentium] (length=243 residues).
MAKKKKSVSNNSSRRTNRNDQLNLEEVYRQLRTNIEFSQMDSELRVLNVLSTHPNEGKSSVSSNLAKVFADKYEKVLLID
CDLRNPSLHKMLRTSNGEGLTNLLTHYRQDDPLLEQDEIQELELDDQSSLFFLPAGSRVPNPTEIISSRRFASLINSARS
QFDQVIIDCPPAFAVSDGVPISNLSDGTLFVLSAKDTDKNDAREAVDDLKRNGANLIGTVMTKVPGFMSRHYYGYGYGDR
NER
>gnl|bykdb|A0A1R0WIM9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. FSL H7-0326] (length=229 residues).
MPRSTSNQHNLVTAVNPKAPISEAYRTLRTNIQFSAIDDQIKVLMVASAQSGEGKTTTVSNLAVTYAQEGKKVLLIDTDL
RKPSLHQVFTVSNHAGLSSAIAAQYPVQEVLQKTAVHNLDVLPSGPIPPNPSEMLGSKKMTALLEELKGIYDIILFDTPP
VLAVTDAMIISSLCDGVVLVVNSGKVKKDLVKKAKGHLEHVNARILGVVLNNIQLNKNQSNYYYYYGER
>gnl|bykdb|A0A1R0WKZ9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus odorifer] (length=201 residues).
MRTNIDFSSIDQTIQVIMVTSSGPEEGKSTVSANLAAAYAQADKRVLLIDADLRKPTAHKTFTLSNRFGLSSLLSQQAVL
EDTVQESGVNNLSIMTSGPIPPNPAEMMASNRMSTLLQDLRQRYDVILIDTPPLLAVTDAQIVASKSDGVIMVVSYGKVK
RDIAVKAKANLDRVGAKMLGVVLNNVKRKASEGYYYYYYGN
>gnl|bykdb|A0A1R0XSS8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus odorifer] (length=228 residues).
MSQLPSKQRHLITVTNPRSPVSEAFRALRTNIDFSSVDETIQVIMVTSSGPEEGKSTVSANLAAAYAQADKKVLLIDADL
RKPTAHKTFSLSNRFGLSSLLSQQVVLEDTVQDSGVPNLSIMTSGPIPPNPAEMMASNRMSTLLQDLRQRYDVILIDTPP
LLAVTDAQIMASKSDGVIMVVSYGKVKRDIAVKAKANLDRVGAKMLGVVLNNVKRKASEGYYYYYYGN
>gnl|bykdb|A0A1R0YGR4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus borealis] (length=229 residues).
MSQQPNNQQRHLITVTNPRSPISEAFRALRTNIDFSSVDEQIQVIMITSSGPEEGKSTVSANLAAAYAQADKKVLLIDGD
LRKPTAHKTFSLSNRYGLSSLLSQQAVLKEVVQESGVNNLYLMTSGPIPPNPAEMLASNRMSTVIQELRQNFDVILIDTP
PLLAVTDAQIVASKSDGVIMVVSYGKVKRDIAAKAKGNLDRVGAKMLGVVLNNVKRKASEGYYYYYYGN
>gnl|bykdb|A0A1R0YQ44 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus odorifer] (length=228 residues).
MSQLPNKQRHLITVTNPRSPVSEAFRALRTNIDFSSVDQTIQVIMVTSSGPEEGKSTVSANLAAAYAQADKRVLLIDADL
RKPTAHKTFTLSNRFGLSSLLSQQAVLEDTVQDSGVNNLSIMTSGPIPPNPAEMMASNRMSTLLQDLRQRYDVILIDTPP
LLAVTDAQIVASKSDGVIMVVSYGKVKRDIAVKAKANLDRVGAKMLGVVLNNVKRKASEGYYYYYYGN
>gnl|bykdb|A0A1R0ZA12 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus odorifer] (length=228 residues).
MSQLPNKQRHLITVTNPRSPVSEAFRALRTNIDFSSVDETIQVIMVTSSGPEEGKSTVSANLAAAYAQADKKVLLIDGDL
RKPTAHKTFSLSNRFGLSSLLSQQAVLEDTVQDSGVSNLSIMTSGPIPPNPAEMMASNRMSTLLQDLRQRYDVILIDTPP
LLAVTDAQIMASKSDGVIMVVSYGKVKRDIAVKAKANLDRVGAKMLGVVLNNVKRKASEGYYYYYYGN
>gnl|bykdb|A0A1R1A5J7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. FSL A5-0031] (length=230 residues).
MSRLIPKWNLITELNPKSPISEGYRMLRTNIEFSTINQKLQIIMVTSSKPSEGKSTTCANMAVAFAQANKKVLLIDADLR
KPSQHHIFGKSNRSGLTTALLNQLKLEDIIQFTNTENLSIIQAGPTPPNPSELLSSEQMAELLKTARERYDVVIIDTPPI
MSVTDAQIVATQSDGVVLVIDSGKVKKDVALKAKASLEHVKANLIGVVLNKINRNHSDIYSYYYGEKTEA
>gnl|bykdb|A0A1R1A9C2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. FSL A5-0031] (length=230 residues).
MSRLKNKRQIITLTNPRSPISESYRALRTNIEFSSIDEKLQVLMVSSAGPGEGKSTTITNLAVTFAQSEKKVVLIDADLR
KPTAHHTFSISNRYGLSSIISQQCSLEEGIQVTDIPNLDVITSGAIPPNPAEMMGSKRMTATIEQLRQMYDIVLIDTPPL
LAVTDAQIVATKSDGVILVVDQGKVKRDIASKAVKNLESVNARILGVVLNNVKRKANEEAYYYYYGVQEK
>gnl|bykdb|A0A1R1BUJ8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. FSL H7-0331] (length=227 residues).
MYPSSRQYPLLIQSQSKSSVSEAFKTLRTNIQFSVKDVEPKVVLVTSAEKGEGKSTTTANLAAAYALDNKRVIMIDADLR
KPTLHHFFSKTNRVGLSNLLVQQCNLEEAIWETGIPGLMLIGAGTIATHPTEMLGSDRMKALIHKLAQSFDIILIDSPPV
MMFSDAQILASQCDGVLMVVNCGRVKKRIARKAKEQLDFVGARILGAIMNNVKKHDEDFQYYYGANS
>gnl|bykdb|A0A1R1CGF6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. FSL H8-0259] (length=228 residues).
MSQQPSKQRHLITVTNPRSPVSEAFRALRTNIDFSSVDERIQIIMVTSSGPEEGKSTVTANLAAAYAQADKKVLLIDGDL
RKPTAHKTFSLSNRYGLSSLLSQQADLSEVIQESGVNNLSLMTSGPIPPNPAEMMASNRMSAILQELRQLFDVILIDTPP
LLAVTDAQIVASKSDGVIMVVSYGKVKRDIAAKAKAGLDRVGARMLGVVLNNVKRKASEGYYYYYYGN
>gnl|bykdb|A0A1R1CGN3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. FSL H8-0548] (length=230 residues).
MSRLIPKWNLITELNPKSPISEGYRMLRTNIEFSTINQKLQIIMVTSSKPSEGKSTTCANMAVAFAQANKKVLLIDADLR
KPSQHHIFGKSNRSGITTALLNQLELKDIIQYTNTDNLSIIQAGPTPPNPSELLSSEPMANLLKQAREQFDMIIVDTPPI
MSVTDAQIVAVQSDGVVLVVDSGKVKKDVVLKAKASLDHVKAKLIGVVLNKINRNHSDIYSYYYGEKSDA
>gnl|bykdb|A0A1R1D543 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. FSL H8-0548] (length=230 residues).
MSQSKNKRQLITITNPRSPISESYRALRTNIEFSSIDEKLQVIMVSSAGPGEGKSTTITNLAVTFAQSEKKVVLIDADLR
KPTAHHTFSISNRYGLSSVVSQQCSLEESIQLTNVPNLDVVTSGPIPPNPAEMMNSKRMTLILERLRQLYDIVLIDTPPL
LAVTDAQIVAAKSDGVLLVVDQGKVKRDIASKAVKSLESVNAHILGVVLNNVKRKANEEAYYYYYGVQDK
>gnl|bykdb|A0A1R1F3L7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus rhizosphaerae] (length=228 residues).
MRQSANRNKLIMNVNRRSSISEGYRNIRTNIQFSGWNQKLQVLAVTSTQAGEGKSTTISNLAVAYAQEGKNVLLIDADLR
HPSLQSIFNVPNRLGLSNLLAEQCAFGDVVQTTVVENLSLVTAGSVPPNPTELLSSDRLQEVIDGWKPVYDIILIDTSPV
MAVADGLIVSSVCDGVILVVLSGKVKREYIQKTKEKLELAKATILGVVLNQKKYSKSEANQYRYYGHQ
>gnl|bykdb|A0A1R1F5S5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. FSL R5-0490] (length=233 residues).
MVLKAKKTNKQNSKRSLITHSDSRSPISEQYRTIRTNIQYSAVDEDLRTIMVTSAGPGEGKSTTAANLAVVFAQQGKRVL
LIDADLRKPTMHYTFHQNNHKGLTNILTKQANLKDASVETDIENLSILTSGPIPPNPAEILGSQSMDGMIEEALSEYDLV
IFDTPPVLAVTDAQILANKCDGAILVVKSENTEVEASLKSKELLLNAKGKLLGVVLNQKKVKDNQYYYYYGGK
>gnl|bykdb|A0A1R1G3Z8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. FSL R7-0337] (length=228 residues).
MSQQPNKQRHLITVTNPRSPVSEAFRALRTNIDFSSVDEQIQIIMVTSSGPEEGKSTVTANLAAAYAQADKKVLLIDGDL
RKPTAHKTFSLSNRYGLSSLLSQQANLSDVIQESGVNNLYLMTSGPIPPNPAEMMASNRMSAVLQELRQLYDVILIDTPP
LLAVTDAQIVASKSDGVIMVVSYGKVKRDIAAKAKDNLDRVGAKMLGVVLNNVKRKASEGYYYYYYGN
>gnl|bykdb|A0A1R1GEJ2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. FSL R7-0333] (length=228 residues).
MSQQPNKQRHLITVTNPRSPVSEAFRALRTNIDFSSVDEHIQIIMVTSSGPEEGKSTVTANLAAAYAQADKKVLLIDGDL
RKPTAHKTFTLSNRYGLSSLLSQQANLSDVIQESGVNNLYLMTSGPIPPNPAEMMASNRMSAVLQELRQLYDVILIDTPP
LLAVTDAQIVASKSDGVIMVVSYGKVKRDIAAKAKDNLDRVGARMLGVVLNNVKRKASEGYYYYYYGN
>gnl|bykdb|A0A1R1QCG4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus swezeyi] (length=230 residues).
MGIRKKRSHKYQSSLVALHQPNAPIVEQYRTIRTNIEFSSFAKPFRSLLITSGLPGEGKSFSASNLAIVFSQQEKRVLLI
DADLRKPTIHKIFELDNHSGVTNVLMKKSSLEHVVQQSQAENLHVLTSGPIPPNPSELLSSQAMEDLFAEAYRQYDLVLL
DSPPLLPVADAQILANQVDGSILVILSGKTKLDNAIKSRDALNSSKSELLGAVLNGRKVKKTRQYNYATM
>gnl|bykdb|A0A1R1RUV1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus haynesii] (length=230 residues).
MGIRKKRSRKYQSALVALHQPNAPIVEQYRTIRTNIEFSSFEKPFKSLLITSGLPGEGKSFSASNLAVVFSQQEKKVLLI
DADLRKPTIHKIFELDNHSGVTNVLMKKTTLENVVQQSQAENLHVLTSGPIPPNPSELLSSQAMEDLLAEAYNQYDLVIL
DSPPLLPVADAQILANQVDGSILVILSGKTKLDNAIKSRDALNSSKSELLGAVLNGRKVKKARQYNYATM
>gnl|bykdb|A0A1R3VTI3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. RRD69] (length=227 residues).
MIFKRKKREKRDLSCISVLNPHSVIAEQFRTIRTNIEFTSIQTRLKSILVTSSLPKEGKSFTAANLAAVFAQQKKRVLLM
DADLRKPAIHEYFDLSPHTGLTNVLLNNCTLEEAILPTPIEHLELLPSGTIPPNPAELLSSSVMKQLFYEIEQQYDMVIV
DSTPLLPVADAKILANRTDGSILVVLSGKTKIAAVKKSKEVLEGTTGKLLGAMLNGKKVKKGRHYMY
>gnl|bykdb|A0A1R4K1P9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Marinilactibacillus psychrotolerans 42ea] (length=233 residues).
MLFKKKKDTNLNDRPGLVVLNRPTSVVSEQFRTIRTNIQFSMIDETLKTIVVTSAGPSSGKSTVAANLSATLASDDKRVL
LVDADLRKPTVHKTFNIRNSDGLTKLLTDRMTKLEDVIYRTHTEGLYLLTSGAIPPNPAELLSSKRMGEVIKEMGNYFDM
IIFDMPPVLAVTDAQVLSSKVDGVLFVIPKGEVSKDQVIKSKELLENVKANVLGAVLNKVAKSDDDYYYYYGE
>gnl|bykdb|A0A1S0RXZ4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus plantarum] (length=242 residues).
MFKRKEQNTTTTAPINLTAINEPMSVITEQIKTIRTNINFAASDRKLRTLMVTSAMLCEGKSTVSGNLAVEYAKEGMQVL
LVDADLRRPTIHKTFGLKNQKGLSSWLGNQLEDVNDAIHPVIGNLFVMTSGPKPPNPAELLGSNKMTEFLTSATRKLDLV
IVDAPPILPVTDSQLLANKVDGTVLVVRQGVAQKAAVRDAVRSLKKSHANILGSVLNDVRDSSHHGYYGYDNGYGYYSNE
DK
>gnl|bykdb|A0A1S1CVQ2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. HMSC063B03] (length=230 residues).
MPTLEIAQKKLDLAKKAEEYYNALRTNIQLSGNNLQVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLVDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSHGLCDTNVENLFVVQAGSISPNPTALLQSENFSTMIDTLRKYFDYIIVDTAPIGIVI
DAAIITQKCDASVLVTAAGEANRKDVQKAKDQLEQTNKPFLGVVLNKFNTSAEKYGSYGEYGSYGNYGRK
>gnl|bykdb|A0A1S1DBR4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. HMSC065H07] (length=246 residues).
MPLLKLVKSKVNFAKQTEEYYNAIRTNIQFSGAQMKVIAVSSVEAGEGKSTTSVNLAISFASVGLRTLLIDADTRNSVLS
GTFKSNEPYKGLSNFLSGNADLNETICQTDISGLDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPIGLVI
DAVIIAHQADASLLVTASGKIKRRFVTKAVEQLEQSGSQFLGVVLNKVDMTVDKYGSYGSYGSYGEYGKKSDQKEGHSRA
HRRRKG
>gnl|bykdb|A0A1S1DIF0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. HMSC066F01] (length=230 residues).
MPTLEIAHKKLDQARKAEEYYNALRTNIQLSGNNLKVIAITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEYLSGTTDLSQGLCETNVENLFVIQAGSVSPNPTALLQSENFATMIDTLHKYFDYIIVDTAPIGVVI
DAAIITQKCDASVLVTAAGETNRRDVQKAKEQLEQTSKPFLGVVLNKFNTSVEKYGSYGAYGNYGNYGKK
>gnl|bykdb|A0A1S1E8N4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. HMSC076C09] (length=230 residues).
MNTLEISKNKLQEVRKAEEYFNALATNIQLSGVDLKVIAISSVQENEGKSTTSTNLAVAFARAGYKTLLVDCDIRNSVMT
GIFRSRTKIQGLTDFLSGRSQLDQILYATDFPNLDIIESGQVAPNPTGLLQSKNYTVMMDALREHFDYIIVDTPPIGVVI
DAAIIAQRCDGTVLITESGANGRKAVQKAKDQLEQTGTPFLGVVLNKFNIKAAEYGSYGGYGSYGEYGKK
>gnl|bykdb|A0A1S1F2E0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus sp. HMSC070A03] (length=237 residues).
MIKENSQMKKKSKAINNPLMTHYDPKSVISEKFRGIRTNIMFSTANDDVKTLVITSEKPGVGKSLVSANIAVTYAQAGYK
TLLIDGDMRKPTQHYMFNTSNIDGLSNLIISKSYFEKAITKTEIDNLDLLTSGPIPPNPSELIGSIQFQNHLEELKEIYD
FIIIDTPPVNTVTDAQLFSEISGYAALVINVKNNDRKSILKSKELIENTGAKVLGVVLNKTEHEKNSSYYAYYGEES
>gnl|bykdb|A0A1S1FBN1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. HMSC034B03] (length=231 residues).
MPSLELAKNKEKTIKKTEEYYNALRTNIQLSGDNIKVIAVTSVQSGEGKSTTSTNLAIAFARSGYNTLLIDADIRNSVMS
GIFKTRDKITGLTDYLAGATDLSNGLCETNIDNLFVIEAGQVSPNPTALLQSKNFGIMIDILRNHYDYIVVDTPPIGLVI
DAAIITQKCDASVLIVESGNVKRKTLQKAKEQLEQTGTPFLGVILNKYDIQLEKYGSYGNYGNYGNYGKKK
>gnl|bykdb|A0A1S1G2U9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. HMSC76G11] (length=224 residues).
MFQLQSRSLVSMTTPKSPIAEQYRTIRTNIQFSTVDEEISSMIVTSAGPGEGKSTTAANLAVVFAQQGKKVLLIDGDLRK
PTGHYTFKVDNHVGLTNILTRQSTLNQAAKYTDQDNLFILTSGPIPPNPSELLASKGMKQLIEDAKREYDFVLFDTPPVL
AVTDAQILSNAVDGVVLVVSSGKTELESAKKAKDALEQAQAKILGTVLNNKKQQDSQYYYYASK
>gnl|bykdb|A0A1S1GYN8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus sp. HMSC62A08] (length=230 residues).
MAEKRKKLEQPLFVNDKPKSIISEKFRGIRSNIMFSRAKDEIVSIIVTSEKPAAGKSIVSANIATTYAQAGYRTLIIDGD
MRKPTQNYIFEEANYDGLSNLIIGKSDYDKAIRSTRVPNLDLLTSGPIPPNPSELIDSDRFYEIYNELLRRYDFVLIDTP
PVNTVTDAQVFLQYVKDAIIVIDAEKNNKYEVKKAKSLIEKADGKIIGAVLNKTPRDKSSSYYSYYGEEE
>gnl|bykdb|A0A1S1H1G7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. HMSC34B10] (length=230 residues).
MAKLELSVKRQAFVKKAEEYYNALRTNIQLSGDKLKVIAISSVRPGEGKSTTSINIAWAFARAGYKTLLVDADIRNSVMS
GDFMSREKITGLTDYLSGTKDLSQGLCETNVENLFVIQSGAISPNPTALLQSDKFETMIETLRKYFDYIIVDTAPIGVVI
DAAIIAQKCDASILVTEASVTKRREVQKAKTQLEQTGTPFLGVILNKFNIHLEKYGSYGSYGSYGAYGKK
>gnl|bykdb|A0A1S1H4V5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. HMSC36C04] (length=231 residues).
MPSLELAKNKEKTIKKTEEYYNALRTNIQLSGDNIKVIAVTSVQSGEGKSTTSTNLAIAFARSGYNTLLIDADIRNSVMS
GIFKTRDKITGLTDYLAGATDLSNGLCETNIDNLFVIEAGQVSPNPTALLQSKNFGIMIDILRNHYDYIVVDTPPIGLVI
DAAIIAQKCDASVLVVESGNVKRKTLQKAKEQLEQTGTPFLGVILNKYDTQLEKYGSYGNYGNYGNYGKKK
>gnl|bykdb|A0A1S1V642 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Andreesenia angusta] (length=226 residues).
MKQLIVHEKPKSPISEAYRSIRTNIQFANIDKEMKTIMFTSTNKSEGKTTTISNIALTMADAGHRVLVVDCDFRNPSIHK
AFGITNKYGVTDVLLKGKDHKEYLNHIMTHDNLDVLTAGKVPRNPSELLYSNSMRKLMEEFKKDYDYVMVDSPPILPVTD
ATVMATYMDGVVLVCASGAAEVESTRKAVDSLKKVGANIIGAVLNRTPVKYKEYHNYYYYDDKKTD
>gnl|bykdb|A0A1S1YNJ9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus oceanisediminis] (length=235 residues).
MLFKWKSKKKTGENSRKLITLINPKSPISEQYRTIRTNIQFSSVDKEIKSIMVTSAGPGEGKSTTASNLAVVFANQEKKV
LLVDADLRKPTVHYTFNSSNITGLTNVLTKKTSMNSAIAGTNEANLSVLTSGPIPPNPAELLGSLAMKEFLKAAYQEFDI
ILFDTPPVLAVADAQILANLCDGSILVARSGETEIDKAKKANDLIKSAKGKLLGVVLNHKKLKDSTYYYYGESDK
>gnl|bykdb|A0A1S1ZNN9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus parauberis] (length=240 residues).
MAHLELVKSKRELYNMAEEYYNSIRTNIQFSGRNLKVITLTSVQPGEGKSTTTANIAISFANAGFKTLLIDADIRNSVMS
GTFKADEKYEGLSSYLSGNAELSAVISHTTIENLMLIPAGHVPPNPTTLLQNSNFNFMIDTVKELFDYVIIDTPPIGLVI
DSAIISQKADASILVTEAGIIKRRFIQKAKEQMEQSGALFLGVILNKVEDTIDSYGGYGSYGAYGNYGKPAKKKNSRKRR
>gnl|bykdb|A0A1S2C844 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus aryabhattai] (length=236 residues).
MARKNKAQKNDKMLTLKRRLLAHNSPKDPVAEQYRTIRTNIQFSNVDQDIKTIVVTSSGAEEGKSTTTSNLATVYAQQGL
NVLLIDADLRKPTGHYTFRLENHIGLTNVLTRQSTLAQAVQESEIPHLSVLTSGPIPPNPSELLASAQMAELLKEMKEQF
DMIIFDTPPILAVADAQILANQVDGTILVVSSGKTEKDAALKSKELLSNAKGKLLGVVLNNRKVEEGNYYYYYGSN
>gnl|bykdb|A0A1S2LIE8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerobacillus alkalilacustris] (length=231 residues).
MPRNRKKQPANATRGLITKVDPKSPISEQYRTIRTNLQFASVDQELKTIMVTSANPSEGKSTTIANLAVVLSQQGNSVLL
IDADMRKPSVHYTFRCQNTKGLTTVLTKQSSLEEAVFASDVENLHILTSGPIPPNPSELLSSKAMELLLTSAKVTYDFVL
IDTPPVLAVTDAQVLANICEGVVLVVSSGKTEIEQAVKAKDLLDKSRAKTLGVVLNQKEAKQSQYYYYYGK
>gnl|bykdb|A0A1S2MAY8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerobacillus alkalidiazotrophicus] (length=230 residues).
MPKKRKKQPANATRGLITKVDPKSPVSEQYRTIRTNLHFASIDQELKTIMVTSSNPSEGKSTTIANLAVVLAQQGNSVLL
IDADMRKPSVHYTFRCPNTKGLTTVLTKQASLEEAVFASDVENLHILTSGPIPPNPSELLSSKAMELMLTSAKVTYDFVL
LDTPPVLAVTDAQVLGNICEGVVLVVSSGKTEVEQAVRAKDLLEKSKAKILGVVLNEKEVKQSQYYYYGK
>gnl|bykdb|A0A1S2QUN6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. MUM 13] (length=230 residues).
MAPKKKLFEHKRKLVTILNPKSPISEQYRTIRTNIQFSSVDKEIRTLTVTSSGPTEGKSTTVANLAVVFAQQGKSVLLID
ADLRKPTAHYTFNLTNTFGLTTVLTKQMELKEAAVKTKEKNLYILTSGPIPPNPAELLGSRAMEEFMEVVQEEFDIILFD
TPPLLTVTDAQILANRSDGTILVVSSGKTEKDAALKAKEALITVNATILGIVLNNKKVKEGQYYYYYGGK
>gnl|bykdb|A0A1S2QWT0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. MUM 116] (length=232 residues).
MALKKDKKMNNKRNLVSMLDPKSTIAEHYRTIRTNIQFSSVDQEARTLMVTSAGPGEGKSTTVANLAVVFAQQGKKVLLV
DADLRKPTVHYTFNKTNTFGLTSVLTKQLKLEEAVVESAERNLYVLSSGPIPPNPAELLSSMAMEVFFQNALEEYDLVLF
DAPPVLAVTDAQILANKCDGAILVVSSGRTEKDKLEKAKESLEAAQSKIIGVVLNNKKIDSKSNYYHYYGTK
>gnl|bykdb|A0A1S2S2D6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Oenococcus oeni] (length=597 residues).
MFSKKNPQKLSTNDLRFSRYGVPLVTVQDPQNVVAEQFRVLRANIDFAAASLKNFKTILFTSAEMSDGKSTAAQNLAVTW
AQTGKRILLLDADFRRPTLHKTFAIPNEHGLTTVLAMHEQPASVMHSTEIPNLYVMTSGPMPPSSSELLASDKMVKVISW
MKEQFDMVVIDSTPLLLVPDAQALIPRTDGIVLVATLGKTRRRSMATAAHILKLAKANVLGVVSRDQRRADKGYGYGYGY
GYTSTNVMKTNDASKASSSKTAPAKPKVPKTSVTDARRVEQQVPSDVKKEAAHSTAVAEKKTVTAASKTAPTSTPKSSWS
SFSYTSTGSEKSETSKQAEKPGPNNTQEIPLVDIRAHLLPRADDGSDSMTTSLQLAKEAVREGIHTIIATPNQMDGRYIN
DADKVLSDVEDFNGVLKRSQIDLKILPGQEIRLSDQFLTAFDQGRLLTLANSKKYMLIELPNNSIPEIINQVISKLREHA
ITVIIAHPERNLTFLNDPKELNRLARQGALFQVTSSSINGFFGQQVADFALAMLRQGFVTTIASETHGITSDQHYHLADA
YSIANKLIGEGKTNIIKQNAVRIVKGEPVDGTTIREF
>gnl|bykdb|A0A1S2SUD9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pediococcus acidilactici] (length=248 residues).
MFFKKKPKLDNESLKNGVGLITYNDPTSTIAEQFRTVRTNIQFSSMDKQLKSIVFTSSAPSEGKSTVSNNVAVTWADQGK
SVLIVDADMRRPTVHRTFRTSNAIGLSNLLAGTGSLGDAIHSTVVENLSVMPSGPIPPNPSELLGSPKMVNLLGVLTTKF
DLVIIDAPPVNTVTDAQVLAARADGTVLVVPQGIADKAGVRHAKQMLETVQANILGAILNRASAEKSTGYYGGYYGGYYG
GYYGTDDK
>gnl|bykdb|A0A1S2W740 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Exiguobacterium sp. KRL4] (length=231 residues).
MAKKNKMNKDARNLITVTQPKSPIAEQYRTIRTNIEFMAVDKEIQVMLVTSATQSEGKSTTSSNLAVAYAQQGKKVLIID
TDMRRPTVHYTFRVANGLGLSSLLTRQAELEKAILPTKVENLSILTAGPIPPNPAELLSSKAMENLILKLREEYHVIILD
APPLLQVADSRITSKLTDGVVLVVSCMTSDRQRVLKAKEQLELAEAKILGVVLNRRELTDDSAYQYYYSYE
>gnl|bykdb|A0A1S5WCB7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus gallolyticus subsp. gallolyticus DSM 16831] (length=246 residues).
MPQLELVRAKAQMVKSMEEYYNSIRTNIQFSGRDLKVITLTSAQPGEGKSTTSVNLAISFARAGFRTLLIDADTRNSVMS
GTFKSNERYQGLTSFLSGNAELSDVICDTSIDNLMIIPAGQVPPNPTSLIQNDNFKAMIETVRGLYDYVIIDTPPLGLVI
DAAILAHHSDASLLVTKAGEDRRRTVTKLKEQLEQSGSVFLGVILNKYDIHLDKYGSYGSYGGYGSYGNYGKSEEKTKIG
RGKRKK
>gnl|bykdb|A0A1S6ECY6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus delbrueckii subsp. bulgaricus] (length=261 residues).
MAFGRKKHLDKDTMKNGAKLITLANPQSVISEQFRNIRTNINFMNVDKEVKTIVFTSAMASAGKSTVSANVAITMAQAGK
KTILIDADLRRPTMHATFNVSNSNGLTTLLTSRSMEMDANSVIRESGVENLSILTAGPIPPNPSELLSSKHMLYLIEDLK
QEYDMVVLDLAPILDAGETQQLTSSLDGTILVVRQAYSQKSAVKRAVELLKLTKSPILGYVMNDVDADGDDGYGYGYGYG
YGYGYGYGEEDEKKGLFGRKK
>gnl|bykdb|A0A1S6IM75 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Jeotgalibaca dankookensis] (length=248 residues).
MTIMFGRKQKKKIQKMDQEQKQGTSLVTVTKPNSVVAEQFRTIRTNIQFSMIDKELKTIIFTSSGPFEGKSTVAANIASV
FADQGKKVLLVDADMRKPTVFKTFKLQNTVGLSTLISSRSTKIEDVVQRVEEADLDIIASGPVPPNPSELLNSNRMNELI
EELEKTYDLVLFDMPPVVSVTDAQIMATKTDGVVFVVRRNIAHTEDVKHAKELLDMVQANVLGVVFNGAEKKSDRSYSYY
GYGYTDEE
>gnl|bykdb|A0A1S6ZDD9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus flexus] (length=237 residues).
MARKVKDAKNDKLLTLKRRLLAHNSPKDPVAEQYRTIRTNVQFSNADENIKSILLTSTGPGEGKSTTSANLATVYAQQGL
KVLLIDADLRKPTAHYTFRLENHIGFTNVLTKQSTLEQAVQECEVPNLHILTSGPIPPNPSELLGSKYMGEVLAQMKREF
DMVIFDTPPALAVTDSQILANQVDGTILVVSSGKTDKEAAQKAKEVLVNANSKLLGVVLNNRKVEEGSNYYYYYGAN
>gnl|bykdb|A0A1S7FE56 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDRKREEGLYYYYGAN
>gnl|bykdb|A0A1S7FQM4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeria weihenstephanensis] (length=230 residues).
MRNKKFRDKTSGKNKLVAKNDTQSPYAESFRYIRSNIDFSGIDNEYKSIMITSPDPDSGKSLISANLAITYAALDKRTLI
IDLDLRKPTIHKIFPECHSSYGVTGLLKNILEIEEAIVPSDVPNLFVLPVGITPADPAALLNSAKMKQLYTRLYQEFDCI
IIDTPPVMSVADAQTISSWVDGSILVVRNNYTKQENAKKALQKLDSTGVKVIGTIFNNTNMKMKDYYYGE
>gnl|bykdb|A0A1S7FQZ5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeria weihenstephanensis] (length=238 residues).
MRSSKKKKDAELRHRRQKTSEPQKLVAKLSPKSPHSELFRSIRTNIEFSSVDKVMKSILITSSEPDSGKSLICANLAVVF
AQQGKKTLLIDGDLRKPTVKKIFPEAISHGLTGILTNKITIDEAICETDTENLYVLPAGIVPPNPSELLGSERMKQVYAD
LYEQFDQIIFDTPPIQLVVDAQLLCSLVDGSILLVRSDHSSKENSKKALQKLQTASAHVIGSIFNNQKMKMEGYYYAE
>gnl|bykdb|A0A1S7FRC2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeria weihenstephanensis] (length=223 residues).
MVQKERSKLLIKHQKGSKIAEQFRMIRTNIEFISKKRALKTIMITSTKPQEGKSTIIANLADVMGRQNMNVLIIDADLRL
PSQHYILGVDNAVGLTDILEETLAVNAVIQKTTLHNVDIISAGQSPNNPSELLSKPALTELFETVKEHYDYILVDAPPVI
VADTTIVAQEIDGIIMVAEENKTPKQKFQKAMTTLKSTHTPIIGIILNKTKQDKGSKYYYYNK
>gnl|bykdb|A0A1S7FX11 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeria weihenstephanensis] (length=228 residues).
MLSLSRKKNKPPVNRLAQLGENKSVNEQFRIIRTNIEFVSMGQNNVYLITSSIPGEGKSTITSNIAMTFGQQNKKVLLID
GDMRRPTQDKLFRRLNNVGLSTLLANQHTLEESIQPIEEYNIDFLPSGPVPPNPAELLSSTKLEKLLEECKQKYDLIFID
SPPLIDIADGPILASKVDGTFLIVRAYKTYKAEIQKSVQILEQSNSKVMGYILNDVKKQGQGKNYYVY
>gnl|bykdb|A0A1S7FXC6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeria weihenstephanensis] (length=233 residues).
MPFKLRSKKKQNISIMQKKSNSISSEQLRTIRTSIQFASTEKLRTMVITSPEQGAGKSFISMNLAISFAEQGNKVLLIDA
DLRRPTVHTTLRLKNDMGLSNYLAGQGKLEECLQEIIMHENLFVITSGVIPPNPAELLSSNKMMEFVQIISNMFDIVIFD
APPVLPVVDPLIIGNMVDGLILVLRSEHTDQHDAVQTLDKIKQSKIKMIGAVLNGRKNRGESYQTGYYTRNQK
>gnl|bykdb|A0A1S7FY12 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeria weihenstephanensis] (length=231 residues).
MRSKQFRDKSTGKDKLVTKYESQSAYAESFRYIRANIDFAGIDQEYKAMMITSPDPDSGKSLISSNLAVTYAALNKKTLL
IDLDLRKPTAHKIFPECYSSYGLTGFLQGVVGVEEAIVPSDVPNLSVLPVGITPADPAALLNSVKMQKLYQELYAEYDRI
IIDTPPVMAVADAQTIASWVDGTILIVRNNYTKQENAKKALQKLEVAGTKVIGTIFNNTNMKMKAYYYGNN
>gnl|bykdb|A0A1S7FYJ0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeria weihenstephanensis] (length=230 residues).
MLRKKKEVQREDRKLIVQNKPLSPLSEQFRMVVENIELMSIDQKLKSILITSADPSSGKSIISSNLAIAFAQKGKKTLLI
DADLRKPTIHKYFRNGVSLGLMGLIKKESTVEGAVFKSDTPNLYILQAGIIPVNPASILASDRLKEVLAELGEKFDHIIM
DTPPILAVADAQVLSGMTDASVLVIRNDYTVTERARKASTRLEQSSKLFLGAIFNNQKQKQDHYYYQENL
>gnl|bykdb|A0A1S7FYW7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeria weihenstephanensis] (length=230 residues).
MRRKIKNAQRDDQKLVVQNKPLSSLAEQFRIIVENIELMSIDKKIKSLLITSADPSSGKSIISSNLAVAFAQKGKKTLLI
DADLRKPTIHKYFRNGVSLGLMGLIKKESTVESAVFESDSPNLFILQAGIIPANPTTILASERLKEVFAELEAQFDHIIV
DTPPILAVADAQILSGMTDASALVIRNDYTVTERAKKASTRLGQSSTLFLGAIFNNQKQKQDHYYYQEKE
>gnl|bykdb|A0A1S7FYY6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Listeria weihenstephanensis] (length=219 residues).
MKRKLITATNPSSPIAEQFKTLRASIHFSSVDKEYRSILVTSPEPESGKSTVSANLAVCYARQGSKTLLIDADMRKPTSH
RTFGIPYNIGLSDMLTNNGADFGDLYHPTEIENLMILTSGTMVPNPNELLASKKMERLIKQFTEQFDQIIIDTPPILASS
DALVLTPYVEGAIVVLRSDKTLKESAKVAVQQLQKTHVSIIGTVLNRVKNNANNYYYYQ
>gnl|bykdb|A0A1S8GAY9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus mycoides] (length=229 residues).
MVLKKKASRARRQLIAYEQPKSSISEQYRNVRTNIEFASVDKKIRSLIVTSANSSEGKTTTAANIAIVFAQQGKKVLLID
ADLRKPALHQMLQIENIFGLTSVLTRSKTLETCVENTKIRNLNFLPCGPIPPNPAELLGSNSMKDLLSGAYGMYDLVIFD
TSPILPVTDAQVMANQCDASVLVVRSGVTEKDTAIKAKQALDGAKGTLLGVILNDKEQTGSEYYYYGSN
>gnl|bykdb|A0A1S8LNB9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium felsineum DSM 794] (length=227 residues).
MLVVKDKPKSPIAEAYRTLRSNIQFSSFDKDMQLILVTSSGPGEGKSTTSSNLALAMAESGNSVLLIDCDLRKPSVHKKF
KISNYDGLSNVLAGHIKFEEANHWYNKNLCVLTAGKIPPNPAEMLASKRMKEFLAEARGNFKYIILDAPPVIAVTDPQVL
STMADGVILVVSSGVADIEAAKRAKELLENVNANIIGSVLNRVKMESRRGYYGNYYYEEDEKIAEEI
>gnl|bykdb|A0A1S8LNH7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium felsineum DSM 794] (length=234 residues).
MLVVKDKPKSPISEAYRTLRSNIQFSSFDKEMQLILITSSGPGEGKSTTSCNLALAMAEAGNSVLLLDCDLRKPSTHKKF
KISNNVGLSNVLAGRAKFEDSSHWYSKNLCILTAGKIPPNPAEMLSSNRMKAFLKEARGVFKYIILDAPPVIAVTDPQIL
STMVDGVILVVSSGVAEIEAAKRAKELLENVNANIIGSVLNRVDTQSRHGYYGGYYYYYGDEGQKVKKHKEEEE
>gnl|bykdb|A0A1S8LSW5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium roseum] (length=227 residues).
MLVVKDKPKSPIAEAYRTLRSNIQFSSFDKEMQLILVTSSGPGEGKSTTSSNLALAMAESGNSVLLIDCDLRKPSVHKKF
KISNYDGLSNVLAGHIKFEEANHWYNKNLCVLTAGKIPPNPAEMLASKRMKEFLAESRGTFKYIILDAPPVIAVTDPQVL
STMADGVILVVSSGVADIEAAKRAKELLENVNANIIGSVLNRVKIESRRGYYGSYYYEEDEKIAEEI
>gnl|bykdb|A0A1S8LWH8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium roseum] (length=234 residues).
MLVVKDKPKSPISEAYRTLRSNIQFSSFDKEMQLILITSSGPGEGKSTTSCNLALAMAEAGNSVLLLDCDLRKPSTHKKF
KISNNVGLSNVLAGRAKFEDSSHWYSKNLCILTAGKIPPNPAEMLSSNRMKAFLKEARGVFKYIILDAPPVIAVTDPQIL
STMVDGVILVVSSGVAEIEAAKRAKELLENVNANIIGSVLNRVDTQSRHGYYGGYYYYYGDEGQKVKKHKEEEE
>gnl|bykdb|A0A1S8MYR1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium saccharobutylicum] (length=220 residues).
MLVFEDKPKSIDAEAYRTLRTNMQYLSIEKEIKTIVVTSACPNEGKSTVLGNLALAFAQNGKNVIIIDCDLRQPSIHKKF
NVSNLLGISQVLIEEETLENAIQHYKSNLDILTSGKIPPNPSEIINSTAMNNLLEELKNKYDILIIDSPPLDVVTDGQIL
STKVDGTILVLKAGQSKIQSAKEAKNLLNKVGANIIGLVINQVKESKKKYSYYYGIDKKK
>gnl|bykdb|A0A1S8NJ95 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium saccharobutylicum] (length=247 residues).
MFSARKLENAVANQQYRGFVVEKKPKSIAAEAYRTLRTNIQYSSFDKEIRSIVVTSAEAAEGKSTVSGNLAISFAQNEKK
VIIVDCDLRKPSVHKNFKISNLVGLSEVLIGKAKLEEVVQSRNEYLDMLPSGKIPPNPSEMLSSKAMVNLIQKLKETYDI
VILDSAPLLAVTDAQILSKEVDGTILVTRAGRTKRESVIEAKNLLTKVGANIIGSVLHAVENTRGKYYYYYGSNEDGDET
KTKKKHK
>gnl|bykdb|A0A1S8NTZ1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium beijerinckii] (length=238 residues).
MFSAKRLHKAVENQEYKGFVVEKKPKSIVSEAYRTLRTNIQYSSFDKTIKTIVITSAEAAEGKSTVSGNLALSFAQNEKR
VIIVDCDLRKPSVHKNFKLSNLSGLSEVLIGKEDLYKVIQNRNENLDILTSGKIPPNPSEMLSSTAMTNLIQKLGEKYDI
VILDSAPLQAVTDAQILSTKADGTILVVRAQRTSRESVIEAKNLLTKVGANILGTVLHAVENTRGKYYYYYGSSEEGK
>gnl|bykdb|A0A1S8P1Z1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium beijerinckii] (length=270 residues).
MSLLEKIKGYTLEIMKRYKLEEARSYKADRMKSYKLEKRVVDNRIHAGFIVEDKPKSIVAEAYRTLRTNIQYSSFDKEIR
TIAVTSAEMAEGKSTVAGNIAASFAQNEKKVILVDCDLRKPSVHKNFKVSNLIGLSEVLLGKAAIEEAVQKRNDNFYFLT
SGKIPPNPSEMLSSSAMSNLIERLKVEFNIVVLDTAPLKAVTDAQILSTKVDGTILVIRAGETKRDIVMDAKNLLDKVGA
NIIGTVLHAVENTRGKYSYYYGNDEDKDNL
>gnl|bykdb|A0A1S8P3Z5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium beijerinckii] (length=238 residues).
MFSAKKLHKAVANQDYRGFVVEKKPKSIVSEAYRTLRTNIQYSSFDKTIKSIVVTSAEAAEGKSTVSGNLALSFAQNEKR
VIIVDCDLRKPSVHKNFKLSNLSGLSEVLIGKEDLDNVIQSRNENLDILTSGKIPPNPSEMLSSTAMTNLIQKLGEKYDM
VILDSAPLQAVTDAQILSTKVDGTILVVRAQRTNRESVIDAKNSLTKVGANILGTVLHAVENTRGKYYYYYGSSEEGK
>gnl|bykdb|A0A1S8PFF9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium beijerinckii] (length=270 residues).
MSLLEKIKGYTLEIMKRYKLEEARSYKADRMKRYKLEKTVVDNRIHAGFIVEDKPKSIVAEAYRTLRTNIQYSSFDKEIR
TIAVTSAEMAEGKSTVAGNIAASFAQNEKKVILVDCDLRKPSVHKNFKVSNLIGLSEVLLGKAAIEEAVQKRNDNFYFLT
SGKIPPNPSEMLSSSAMSNLIERLKVEFNIVVLDTAPLKAVTDAQILSTKVDGTILVIRAGETKRDIVMDAKNLLDKVGA
NIIGTVLHAVENTRGKYSYYYGNDEDKDNL
>gnl|bykdb|A0A1S8Q2P9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium beijerinckii] (length=238 residues).
MFSAKRLNKAVANQEYKGFVVEKKPKSIVSEAYRTLRTNIQYSSFDKTIKTIVITSAEAAEGKSTVSGNLALSFAQNEKK
VIIVDCDLRKPSVHKNFKLSNLSGLSEVLIGKENLDKVIQSRNENLDILTSGKIPPNPSEMLSSTAMTNLIQKLGEKYDI
VILDSAPLQAVTDAQILSTKADGTILVVRAQRTSRESVIDAKNLLTKVGANILGTVLHAVENTRGKYYYYYGSSEEGK
>gnl|bykdb|A0A1S8R9A0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium beijerinckii] (length=270 residues).
MSLLEKIKGYTLEIIKRYKLEEARSYKADRMKSYKLEKTVVDNRIHAGFIVEDKPKSIVAEAYRTLRTNIQYSSFDKEIR
TIAVTSAEMAEGKSTVAGNIAASFAQNEKKVILVDCDLRKPSVHKNFKVSNLIGLSEVLLGKAAIEEAVQKRNDNFYFLT
SGKIPPNPSEMLSSSAMSNLIERLKVEFNIVVLDTAPLKAVTDAQILSTKVDGTILVIRAGETKRDIVMDAKNLLDKVGA
NIIGTVLHAVENTRGKYSYYYGNDEDKDNL
>gnl|bykdb|A0A1S8RJE3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium beijerinckii] (length=238 residues).
MFSAKKLHKAVANQDYRGFVVEKKPKSIVSEAYRTLRTNIQYSSFDKTIKSIVVTSAEAAEGKSTVSGNLALSFAQNEKR
VIIVDCDLRKPSVHKNFKLSNLSGLSEVLIGKEDLDNVIQSRNENLDILTSGKIPPNPSEMLSSTAMTNLIQRLGEKYDM
VILDSAPLQAVTDAQILSTKVDGTILVVRAQRTNRESVIDAKNLLTKVGANILGTVLHAVENTRGKYYYYYGSSEEGK
>gnl|bykdb|A0A1S8SAS0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium beijerinckii] (length=270 residues).
MSLLEKIKGYTLEIMKRYKLEEARSYKADRMKSYKLEKTVVDNRIHAGFIVEDKPKSIVSEAYRTLRTNIQYSSFDKEIR
TIAVTSAEMAEGKSTVAGNIAASFAQNEKKVILVDCDLRKPSVHKNFKVSNLIGLSEVLLGKAEIEEAVQKRNDNFYFLT
SGKIPPNPSEMLSSSAMSNLIERLKVEFNIVVLDTAPLKAVTDAQILSTKVDGTILVIRAGETKRDIVMDAKNLLDKVGA
NIIGTVLHAVENTRGKYSYYYGNDEDKDNL
>gnl|bykdb|A0A1S8SW10 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium beijerinckii] (length=270 residues).
MSLLEKIKGYTLEIMKRYKLEEARSYKADRMKSYKLEKTVVDNRIHAGFIVEDKPKSIVAEAYRTLRTNIQYSSFDKEIR
TIAVTSAEMAEGKSTVAGNIAASFAQNEKKVILVDCDLRKPSVHKNFKVSNLIGLSEVLLGKAAIEEAVQKRNDNFYFLT
SGKIPPNPSEMLSSSAMSNLIERLKVEFNIVVLDTAPLKAVTDAQILSTKVDGTILVIRAGETKRDIVMDAKNLLDKVGA
NIIGTVLHAVENTRGKYSYYYGNDEDKDNL
>gnl|bykdb|A0A1S8TDY0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium puniceum] (length=224 residues).
MLVVEDKPRSMEAESYRTLRTNIQYSSIDKEIKSIVVVSACPKEGKSTISGNLALSFEQNGKKVIIIDCDLRKPTIHRYF
NISNLCGLSEVLIGKKTLDSAIQEYRPNLYILPSGKIPPNPAEMISSTMMSNLLEELKEEYDIVIIDSPPLQVVTDGQIL
STKADGTLLVLKAGESKIESVKEAKNILNRVGANILGVVINRVSNNKNKYYYYYGTEEKDALET
>gnl|bykdb|A0A1S8TPA8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. BL-8] (length=238 residues).
MLLFKKHNKRKKVLKRKRNVMYTVEDNPKSIVAEAYKTLRTNIQYSSFDNEIKTLVVTSAEMSEGKSTVAQNIALTFAQS
EKKVILLDCDLRRPSVHINLNASNLIGISEILLGKVQIEEAVQKHNDNLYFLTSGKIPPNPSEMLASSAMSYLIEKLKQD
YDIVILDTAPLNLVTDAQILSTKADGTVLVVRAAKTKKDVVIEAKGLLNMVGANIIGTVLYAVENTRDKYCNYYEGEK
>gnl|bykdb|A0A1S8TQQ3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. BL-8] (length=246 residues).
MSVLEAIKHYKKGKDNNTIDDRIHAGFIVEEKPRSVIAEAYRTLRTNIQYSSFDKEIRTIAVTSAEMAEGKSTVAGNIAL
TFAQSDKKVILVDCDLRKPSVHKNFKASNLVGISEILIGKVSIEEAVQKRNDNLYFLTSGKIPPNPSEMLASSAMSNLIE
ELKKRYDLVVLDTAPIKAVTDAQILSTKVEGTILVVRAAVTKRDSVIEAKNLLDKVGANIIGAVLHAVENTRGKYSNYYG
NEEDKE
>gnl|bykdb|A0A1S8TRK8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. BL-8] (length=241 residues).
MFKARKLEKAVASQQYRGFVVEKKPKSIVSEAYRTLRTNIQYSSFDRQIKTIVVTSAEAAEGKSTVSGNLALSFAQNEKK
VIIVDCDLRKPSVHKNFKVSNLKGLSEVLIGKEELDNVVLKRNDNLDILTSGKIPPNPSEMLSSSSMTKLIEALRQRYDI
VILDSAPLQAVTDAQILSTKSDGTILVVRAKRTSRESVIDAKRLLDKVGANILGTVLHAVENTRGKYYYYYGTKDDEKKT
K
>gnl|bykdb|A0A1S9ANZ2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus reuteri] (length=250 residues).
MSLFHRTQQQSTDTMDNGAKLITVAHPKSPISEQFRTIRTNINFMAIDKPIKTLAMTSANVSEGKSTVTDNVAVAWAQTG
QKVLLIDSDLRRPTLHATFNKSNQRGLTTILTSGTNSVDLRDIIQPSGVENLDILTAGPIPPNPAELLNSQRMKTLLDTV
KGIYDMVILDVPPMLEVTDTQILSRHLDAVVLVVKQEQTQKLAVKRAVELLNLAHANLLGYVMNDVNADGDAAYGYGYGY
GYGYGEDTNK
>gnl|bykdb|A0A1S9AP18 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus reuteri] (length=249 residues).
MSIFHRRKNKATNDTLVNGAKLITVAHPKSPISEQFRTIRTNINFMAIDKPIKTLAMTSANVSEGKSTITDNIAVVWAQT
GQRVLLIDADLRRPTLHATFNKSNQEGLTTILTSGTNSIDLRQIVQPSGVENLDILTSGPVPPNPAELLNSQRMKTLIES
VKSVYDMVIVDVPPMLEVTDTQVLSHYLDAIVLVVKQGQTQKLAVKRAVELLNLAHANLLGYVMNDVNTDGDAGYGYGYG
YGYGSGSAQ
>gnl|bykdb|A0A1S9N350 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium beijerinckii] (length=238 residues).
MFSAKRLHKAVENQEYKGFVVEKKPKSIVSEAYRTLRTNIQYSSFDKTIKTIVVTSAEAAEGKSTISGNLALSFAQNEKK
VIIVDCDLRKPSVHKNFKLSNLSGLSEVLIGKEDLDNVIQNRNENLDILTSGKIPPNPSEMLSSTAMTNLIQKLGEKYDM
VILDSAPLQAVTDAQILSTKVDGTILVVRAQRTNRESVIDAKNLLTKVGANILGTVLHAVENTRGKYYYYYGSSEEGK
>gnl|bykdb|A0A1S9NDD9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium beijerinckii] (length=240 residues).
MKRYKLEKTVVDNRIHAGFIVEDKPKSIVAEAYRTLRTNIQYSSFDKEIRTIAVTSAEMAEGKSTVAGNIAASFAQNEKK
VILVDCDLRKPSVHKNFKVSNLIGLSEVLLGKAAIEEAVQKRNDNFYFLTSGKIPPNPSEMLSSSAMSNLIERLKVEFNI
VVLDTAPLKAVTDAQILSTKVDGTILVIRAGETKRDIVMDAKNLLDKVGANIIGTVLHAVENTRGKYSYYYGNDEDKDNL
>gnl|bykdb|A0A1S9TLK7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=234 residues).
MVLNSLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFASVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKK
VLLIDADMRKPAMHQMFQVDNIVGLTNVLTHSQRLEKCIQTTNVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSMYD
LVIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREHGLYYYYGAN
>gnl|bykdb|A0A1S9XGB0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus mycoides] (length=229 residues).
MVLKKKILRARRQLIAYEQPKSSVSEQYRNIRTNIEFASIDKKIRSLIVTSANQSEGKTTTAANIAVVFAQQGKKVLLID
ADLRKPALHQMMQVENIFGLTSVLTRSKTLETCVTQTKIGNLTFLPCGPIPPNPAELLGASSMKDLLSEAYGTYDLVIFD
SSPILPVTDAQIMANQCDASVLVIRSGATEKEAALKAKQSLDSAKGKLLGVVLNDKEQNGSEYYYYGSN
>gnl|bykdb|A0A1S9XUS0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus mycoides] (length=234 residues).
MVLNSLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFASVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGRK
VLLIDADMRKPAMHQMFQVDNIVGLTNVLTHSQRLEKCIQTTNVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSMYD
LVIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A1S9ZE35 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus mitis] (length=234 residues).
MPTLEISKKRLDFAKKAEEHYNALRTNIQLSGDNLKVLAISSVRPGEGKSTTSTNIAWAFARAGYKTLLVDADIRNSVMS
GVFKSREKITGLTDFLAGTTDLSNGLCDTNIDNLFVIQAGPISPNPTALLQSENFHTMIDTLRKYFDYVIVDTAPIGMVI
DAAIITQKCDASILVTAAGETKRRDILKAKEQLEQTGTPFLGVVLNKFNTEVEKYGAYGGYGAYGSYGNYGKKK
>gnl|bykdb|A0A1T0C6B1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus mitis] (length=234 residues).
MPTLEISKKRLDFAKKAEEHYNALRTNIQLSGDNLKVLAISSVKPGEGKSTTSTNIAWAFARAGYKTLLVDADIRNSVMS
GVFKSREKITGLTDFLAGTTDLSNGLCDTNIDNLFVIQAGPISPNPTALLQSENFHTMIDTLRKYFDYVIVDTAPIGMVI
DAAIITQKCDASILVTAAGETKRRDVLKAKEQLEQTGTPFLGVVLNKFNTEVEKYGAYGGYGAYGSYGNYGKKK
>gnl|bykdb|A0A1T2PJC6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNVEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQPTAVDNLNFLACGPIPPNPAELLGSKSMQELLAQAYSMYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A1T2X323 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus selenitireducens] (length=229 residues).
MRRLADESKLIMNINRRSPIAEGYRNLRTNIQFSSWNHELRVICVASTLASEGKTTTISNLAVAYAQEGKKVILIDADLR
HPSLQVVFDISNKIGLSNVLANQCPYAESVRSTTIDNLSVIPSGPIPPNPTELLANSTFNELLESLKEEYDLILIDTAPI
MAVSDGLVVAAISDGVILVVMAGKTKREYILKSKEKLAHVQAQILGVVLNNKKFYKSEAEHYSYYGIQE
>gnl|bykdb|A0A1T2XJM9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus selenitireducens] (length=231 residues).
MSRLIPKKLITESNPKSPISEGYRMLRTNIEFSTIDQKIQVIMVTSSKPSEGKSTTSANMAVAFAQANKRVLLIDADLRK
PSQHYIFGTSNRIGLTTALFKQKLLEEVIQSTNTPNLSIIHAGPTPPNPSELLSSKHMSGLLSTIRGLYDVIIIDTPPIL
SVTDAQIVATYSDGVVLVVDSGKVKKDVALKAKASLEHVNAKIIGAVLNNINRNESDSYSYSYYYGERNDQ
>gnl|bykdb|A0A1T2XLN1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus selenitireducens] (length=216 residues).
MSNPKSPVAEAYRSLRTNIDFSSIDEEIRVIMVTSSGPEEGKSTTLANLAVSYAQSDKKVVVIDGDMRRPTCHHTFNLSN
QSGLSSIVTGQIEMQQAIKATEVDNLFVITSGPLPPNPSELLGSKRMNELLEQLKMNFDIIIIDTPPVLAVTDAQIISSK
CDGVVLVIHSGKVKRDMAIKAKASLDHVRARILGVVLNNVKHKKEDMYYYYYGQKD
>gnl|bykdb|A0A1T4K556 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Eubacterium coprostanoligenes] (length=252 residues).
MLKFNKKGGANSIHTTDSTKLLTASSTFAVKEAYNSIRTNLLFTQQGEKCPIFVVTSPTANNGKTINSANLAINFAQMGK
KTLVIDADMRNPSLHKLFSLSSRNGLSEILAGLTDNITVTKTDIENLSVLTSGKIPPNPTELLSSPRMDKLLDFVKEHYD
CVFIDTPPVNIVTDATVFSQKATGYVIIVKTDTTNVPELKTTVSTLQGINANILGFILNDANSEKKKYYSYYRKYSRNYS
YNYKYSYGNDKK
>gnl|bykdb|A0A1T4KVK6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Selenihalanaerobacter shriftii] (length=234 residues).
MSNEVKQECQSRNYELMTEYNPKSPLAESYRTLRTNLRFLSPDNRLQTIAITSSIPGEGKSITVANLAISMVQDGQDVII
IDTDLRRPMQHRLFEVANYSGLSNILTNEIDLNDGLQETSISGLNIISSGMIPPNPAELLGSNKMEEVIKEAKGIADVVV
IDCPPVIAVSDSRILTDKVDGVILVVASHETNGDAVVKSKEMLEQVQANIIGTILTKYPVQESSGYYSGYYQYY
>gnl|bykdb|A0A1T4L6Y2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Carboxydocella sporoproducens DSM 16521] (length=226 residues).
MERLIVDKEPKSPVAEAYRRLRTNIQYANVAHELKTILFTSAGPGEGKSSVAANYAALVAQQKKEVILVDCDLRRPSLHR
IFDLKNSRGLTNVMTHDFELKDVLQTTSVPGLRVLTSGPIPPNPVELLSAEEMESILRKLKEMADLVVIDTPPIQAVTDA
LVLAPKVDGVVLVLMAAAVSRQQARLAKEGIQRVGGRLLGAVLNGVEMKKGSYYYYNYHYSYGVSE
>gnl|bykdb|A0A1T4LR09 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Eubacterium ruminantium] (length=230 residues).
MNIEFENLNQLEFKTNEAYKTLRTNISFMGDDVKVISITSARPNEGKSEVAFRLSQSMGEDDKKVLFIDADIRKSVTVTR
YMVDKETVGLSHYLAGKKKLEEVIYSTNIRGLDIVFTGQVAPNPAELLGNNRFEELLKYAREKYDYVIVDCPPLGSVIDA
AIVSQKCDGAIIVIETDGVSYKAVQDVKKQLENSGVRILGAVLNKIEVSGKGYGKGYYGYGYGYGYGYGE
>gnl|bykdb|A0A1T4N3E3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Eubacterium coprostanoligenes] (length=309 residues).
MAKKSNKKSAKTNSTSRQLLKDIEMDPSLKFRVEEAYKSIRTNIMFSVMKKGCKTIVISSSTPNEGKTTTTINIAIALAQ
ANQKVLLIDGDLRKPKIHHYFSVPNSPGLTNYLGSKVGSSNRTDLLSVIHATEYENLSVLCSGSIPPNPAEILGSEPMAE
FLEEIGNDFDYIIIDTPPINVVSDALPVIRESDGVVLVVRSNQSTHPEVQRAISALEFIDAKILGFVVNFAESGRSKYGY
GKYGRYRYGRYKNSYGYGSYGSYGTYGGYGYGSYGYSGYGYGAKGGYDSYGYGGYGYNTPPYDPRQNKR
>gnl|bykdb|A0A1T4PA71 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Garciella nitratireducens DSM 15102] (length=247 residues).
MKLNNLFTIFNPKSPQSEGYRMLRTNLQFASAGKDLRSIVVTSSTPGEGKSTTSINLAVTLAQADNEVLLVDCDLRRSSL
HKYLRLSNSKGLSGFLAGMDSLEDVIQKTQVDRLNIITAGPLPPNPAELLGSVTMERFLKTIRNQYDFVILDCPPVVALT
DGAVLSASSDGTVLVVASGETPIEVAQTAKENLQKVGANLLGVVLNKTKIDQENYYYYDYNSSKENEEKNPTAEGKRKPR
KKKRSMA
>gnl|bykdb|A0A1T4VHA1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Eubacterium uniforme] (length=234 residues).
MNKKIVFGKKYELPYALEESINRLRVNVGFLGNDIKKIMIISSEPNEGKSFVATNLWKQMSMAGEKSLLIDCDMRNSVLL
RNYGIKEASNGKLRGTSHYLSDSSKIEDVIYSTEYENGDILPNVDNVINPSMLLENKKFDEMLKYAEENYRYVFVDAPPL
ELVSDGESIASKCDGVILCIRGGVTSKQIVRNSISRLERAGCPILGVVLNRVNSTKKRYGKYYGKKYYYGKEGK
>gnl|bykdb|A0A1T4X4E1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Gemmiger formicilis] (length=248 residues).
MSKASKNTSHRKLYTVGGDAPFQFVEAYKSLRTNLEFLSSAGNCKTILITSSVPEEGKSNVALNLAMTLTASGNRVVLVD
CDLRKATISRYLRIPRNHAGLTNVITSKDEGALAAALVRVKDSGITVLTAGTIPPNPTELLSTPMTEKIFASLQKAFDYV
IIDTPPVSVVTDAAVLCGIADGVLLVVRPGVTTIQSAQLSKKNLEAVNAHILGVVMNGYNGTQSGRRDGYSYAYSYSYYD
EDKKGNDA
>gnl|bykdb|A0A1T4XGG8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Caloramator quimbayensis] (length=248 residues).
MQTFNLTALAHPKSPVSEAFRTLRTNIQFSSFDKNIKTIVLTSSGPGEGKSTVSTNLACVFSQGGNKTILIDCDMRKPTV
HKKLEISNQTGLTNVLIAEVSLKDAVKEISENFYVLTTGTRPPNPAEIIASSKMQNFIESLKEQFDYIIIDTPPILMVTD
AQILSKYADGTLLVVSSGEADKNAAVKAKELLLKVDANILGVVLNKLDTSRKGYYGYYYHYYYGNDGHKKKVKEKKGLFF
KKRREIGS
>gnl|bykdb|A0A1T4XGH9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Caloramator quimbayensis] (length=231 residues).
MLDIILKKHPKSPISEAYRTLRTNIQFASFDKEVKVILVTSSGPSEGKTTTASNLAYTLSETSKKVLLVDCDLRKPKIHK
IFKISNQTGLSNILIEDYDLSTAIKKADNNLYVLTAGTLPPNPVEMISSKKMSDFIEKVKDEYDYIILDTPPVVSVTDAQ
ILSTMADGVILVVSSGEANKEAAIRAKELLLNVNAKILGVVLNKLDIASKGGYGYRYYYYYSEDEGKRKRK
>gnl|bykdb|A0A1T5BYY6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lysinibacillus sp. AC-3] (length=237 residues).
MFKMKNKKKKALAMMQRKLLTNVHTTSIISEQFRTIRTNLKFALPNLSCKTILVTSSIPGEGKTTNAANIAIVFAQEGKK
VLVVDADMRRPAIHYTFELHNISGLSSVLIQNDTLSEAIQETFIEGLFVLTSGPIPPNPVELLASEMMDTLIEKMIDFYD
VIIFDTPPVNSVTDAQILANKTDGALLIVNTGVVEKSSVVKAKNSLLVAQAKILGVVMNNYALPKEQYKNQYYHTRK
>gnl|bykdb|A0A1U7NG29 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ileibacterium valens] (length=238 residues).
MAKNVIRKNDDMNLDEVYRQLRTNIEFSQMDETLRSINVLSTNPNEGKSSVSLNLAKIFADKYQKVLLIDCDLRNPSLNK
FLRVSNSKGLTNLLTHYQKGDLIQEQDELKIIDFGNNTQLYFLSTGSKVPNPTEVISSRRFSTFINEAKKQFDAVIVDCP
PVFAVADGIPISHVVDGTLFVLSAKDTDKYDAREAVQDLQRNGANLIGVVMTKVPGFRSKHYYGYGYGKYGGYGDSND
>gnl|bykdb|A0A1U7NJW0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Dubosiella newyorkensis] (length=231 residues).
MARKIDQFNLDEVFRHLRTNIEFSQVDETVKVINVLSTFPNEGKSTVSTNLARIFADKYQNVLLIDCDLRNPTDHKMYKV
SNAEGLTNLLTEYVAGQSVFSYPQVVSLQFKNGSRLFFLPAGSRVPNPTEILSSKKFGQFLQQARKEFDYVIIDCAPISR
VSDGVPISNMCDGTIYVISAKETDKRAARSAIEDLNRNGAHVIGTVLTKVENTGSHKYGYGYGYGYGYGEE
>gnl|bykdb|A0A1U7PIG3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Edaphobacillus lindanitolerans] (length=237 residues).
MMLKRKKRKNQLEQRARKLVVSASPRSVVSEQFRTLRSNIIFSTVDDELNTLLVTSATPGDGKSTVSANIATLFAQDGKR
VLLIDADMRKPTVHYTFNLVNSAGLSSVLTQQQTANEAIRQTEISPNLHIMTSGPIPPNPAELLGSRAMTRLVDSLKQQY
EMIVFDAPPTLSVTDAQILANQSDGTIFVVNSGATEKENLEKAISLLEKARARVLGTVLNNYQIDKDGYYQYYGTQE
>gnl|bykdb|A0A1U9YTB8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus larvae subsp. pulvifaciens] (length=221 residues).
MRARKPVRHLFCLDHSKSIAAEVFRTLRTNIRYTGLSRPIHSLVITSSLPGEGKSTVAANLAVAMAQEKKRILLVDADLR
KPTQHEWFHIPHFPGLSNVLLGQATLENAIHYVEDALVHVLPAGPLPPNPSELLSSLDMQQFMVILQKDYDMVLIDSPPI
LPVSDGLVLSRLADGVLLVIRSGKTSQEKARKAKSQLDHVKAHLIGSVFNAHNLKREYQYD
>gnl|bykdb|A0A1V0GCT0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. FDAARGOS_192] (length=246 residues).
MPKLNLVKSKANFAKQTEEYYNAIRTNIQFSGAQMKVITISSVEAGEGKSTTSVNLAISFASVGLRTLLIDADTRNSVLS
GTFKSNEPYKGLSNFLSGNADLNETICQTDISGLDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPIGLVI
DAVIIAHQADASLLVTAAGRIKSRFVTKAVEQLEQSGSQFLGVVLNKVDMTVDKYGSYGSYGSYGDYGKKVGHKETHSRA
HRRRKG
>gnl|bykdb|A0A1V0GKU3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus equinus] (length=246 residues).
MPLLKLVKSKVNFAKQTEEYYNAIRTNIQFSGTQMKVIAVSSVEAGEGKSTTSVNLAISFASVGLRTLLIDADTRNSVLS
GTFKSNEPYKGLSNFLSGNADLNETICQTDISGLDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPIGLVI
DAVIIAHQADASLLVTAAGKIKRRFVTKAVEQLEQSGSQFLGVVLNKVDMTVDKYGSYGSYGSYGEYGKKSDQKEGHSRA
HRRRKG
>gnl|bykdb|A0A1V0HAW3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus salivarius] (length=246 residues).
MPLLKLVKSKVNFAKQTEEYYNAIRTNIQFSGAQMKVIAVSSVEAGEGKSTTSVNLAISFASVGLRTLLIDADTRNSVLS
GTFKSNEPYKGLSNFLSGNADLNETICQTDISGLDVIASGPVPPNPTSLLQNDNFRHLMEVARSRYDYVIIDTPPIGLVI
DAVIIAHQADASLLVTAAGKIKRRFVTKAVEQLEQSGSQFLGVVLNKVDMTVDKYGSYGSYGSYGEYGKKSDQKEGHSRA
HRRRKG
>gnl|bykdb|A0A1V0JEA3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus amylolyticus] (length=258 residues).
MALFRKKRGTNETMKKGAQLITVADPKSPVSEQFRIVRTNINFMAVDHDIKTMAFTSANISEGKSTVTANVAVTYAQAGR
KTLLIDGDLRRPTLHSTFNMSNQRGLTSVLTSDAKEIDLDDVIQDSGVDNLSILTSGPIPPNPAELIGSKRMQTFIELVR
DHYDVVIIDLAPVLAVSDTQELASHLDGVVLVVRQGVTKKAAIKRSVEMLKFAKVRILGYVMNDISSSNAGYGYGYGYGY
GYGYGEEKKKSFWDRFRS
>gnl|bykdb|A0A1V0NC45 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactococcus lactis subsp. lactis] (length=231 residues).
MAKNKRSIDNNRYIITSVNPQSPISEQYRTIRTTIDFKMADQGIKSFLVTSSEAAAGKSTSSANIAVAFAQQGKKVLLID
SDLRKPTVNITFKVQNRVGLTNILMHQSSIEDAIQGTRLSENLTIITSGPIPPNPSELLASSAMKNLIDSVSDFFDVVLI
DTPPLSAVTDAQILSSYVGGVVIVVRAYETKKESLAKTKKMLEQVNANILGVVLHGVDSSDSPSYYYYGVE
>gnl|bykdb|A0A1V0NK33 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactococcus lactis subsp. lactis] (length=231 residues).
MAKNKRSIDNNRYIITSVNPQSPISEQYRTIRTTIDFKMADQGIKSFLVTSSEAAAGKSTASANIAVAFAQQGKKVLLID
GDLRKPTVNITFKVQNRVGLTNILMHQSSIEDAIQGTRLSENLTIITSGPIPPNPSELLASSAMKNLIDSVSDFFDVVLI
DTPPLSAVTDAQILSSYVGGAVIVVRAYETKKESLAKTKKMLEQVNANILGVVLHGVDSSESPSYYYYGVE
>gnl|bykdb|A0A1V0P5Z8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactococcus lactis subsp. cremoris] (length=231 residues).
MAKNKRSIDNNRYIITSVNPQSPISEQYRTIRTTIDFKMADQGIKSFLVTSSEAAAGKSTASANIAVTFAQQGKKVLLID
GDLRKPTVNIPFKVQNRVGLTNILMHQSSIEDAIQGTRLSENLTIITSGPIPPNPSELLASSAMKNLIDSVSDFFDVVLI
DTPPLSAVTDAQILSSYVGGVVIVVRAYETKKESLAKTKKMLEQVNANILGVVLHGVDSSDSPSYYYYGVE
>gnl|bykdb|A0A1V0UXX7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus larvae subsp. pulvifaciens] (length=222 residues).
MRARKPVRHLFCLDHSKSIAAEVFRTLRTNIRYTGLSRPIHSLVITSSLPGEGKSTVAANLAVAMAQEKKRILLVDADLR
KPTQHEWFHIPHFPGLSNVLLGQAPLENAIHYVEDALVHVLPAGPLPPNPSELLGSLDMQQFMVILQKDYDMVLIDSPPI
LPVSDGLVLSRLADGVLLVIRSGKTSQEKARKAKSQLDHVKAHLIGSVFNAHNLKQREYQYD
>gnl|bykdb|A0A1V1Z893 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. I-2] (length=227 residues).
MIFKRKKREKRDLSCISALNPHSVIAEQFRTIRTNIEFTSIQTRLKSILVTSSLPKEGKSFTAANLAAVFAQQNKRVLLM
DADLRKPAVHEYFDLSHHTGLTNVLLNNCSLEEAILPTPIEHLELLPSGTIPPNPAELLSSSVMKQLFYEIEQQYDMVIV
DSTPLLPVADAKILANRTDGSILVVLSGKTKIAAVKKSKEVLEGTTSKLLGAMLNGKKEKKGRLYMY
>gnl|bykdb|A0A1V2A5I9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Domibacillus epiphyticus] (length=235 residues).
MALKRKKQRKSPGLAGHNLIARNNAQSPISEQYRTIRSNILFSSVDQSFRSLLVTSASPEEGKSTTVSNLAVIFANKGKK
VLLVDADLRKPTIHYTFGLPNTSGLTNVLTKQSPLQETVNRTEVDSLYVLTSGPIPPNPAELLGSFAMKEFLKKTLSEYD
FVMFDTPPVLAVTDAQVLANQCDGTIFVVNSGKTDIDSAQKAKELLQNAKAKLLGAVLNNRKRNDLNYYYYYGSI
>gnl|bykdb|A0A1V2HNE0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLYFLACGPIPPNPAELLGSKSMQELLAQAYSMYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKESAAKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A1V2SPA3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus azizii] (length=227 residues).
MPFLTISRKKLEGFKKAEEYYNALRINIQLSGADMKTIVITSVEPNEGKSMTSSYLALSFAKAGYRTLLLDADIRNSVMT
GTFKARGKITGLTEYLVGAADLSQGLCDTDMEQLSVIVAGTTSPNPAALLQSDRFTQLMGILRQHYDYIIVDTAPVGVVV
DAIVVTQQCDASILVTSAGNVRQKTLAKAKEQLEQTHKPFLGVVLNKYQPQSAQYGMYGVYGKYGKI
>gnl|bykdb|A0A1V3FFE5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anoxybacillus sp. 103] (length=220 residues).
MRSLITKTNPKSPISEQYRTIRTNIQFSVADRPLRSIMVTSSAPAEGKSTTVANLAVVFAQQGKKVLLIDADLRKPTVHY
TFRKDNYVGVTNVLTKQATLQTAMKETDVENLFVLTSGPIPPNPAELLGSAAMEELLAEAYDQFDVVLFDTPPVLAVTDA
QILANQCDGTILVVQSGKTEIEAAQKAKELLLAAKGKLLGVVLNQKKQKESSYYYYYGNK
>gnl|bykdb|A0A1V3NFK8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus casseliflavus] (length=234 residues).
MAKKQERTGTQTHAVSLITLIDPSSPISEQYRTIRTNIQFASSADKQIKTLVVTSSGPAEGKSTTSANLAVVFAKSGQRV
LLVDADMRKPTVYKTFNLNNASGLSTVLSTSTSVLEVAQKTVIDNLSVLTSGPKPPNPSELLGSARMNQVIEEAKNLYDV
VIFDMPPVVAVTDAQIMASKADGTILVVRENVARKESLTKARDLLNMVQARIIGVVYNGAEHSKDSGYNYYYGN
>gnl|bykdb|A0A1V3NL24 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus casseliflavus] (length=213 residues).
MRSMKENYSIISEQVKLIRENVDYLCQQQDAQTILITSGESGTGKSTVSANLAVAYAQKGNRTLLIDADLRKPTQHHLFS
QEMHVGLSNYIRRAVSIESCVQQVILEDCEFSIITSGAIMSNPNDLLASSKMTAALQEVKQLYDVVIIDTPPVNVVSDAL
ILAKKVDGVLLVVHADKTNKQSAKNAVKKLRLVNANILGAVVNGTDTAENYYY
>gnl|bykdb|A0A1V4DJ08 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Vagococcus martis] (length=237 residues).
MSKRNQHGRNKKNKLEASKPATLFTVIEPNSPISEQFRTIRTNIMHAQYGVQTHSIAITSAGPSEGKSTTAANLAVMFAK
LGLKTLLVDADMRRPTAHMTFELDNSMGLSNILSIKKLSVGEVVKESNIPYLDVMTSGFKAPNPSELLASTRMQKLIKVL
ENLYDFVIFDMPPASTVTDVQLVASHLDGVAVVVRSNVTDKKQLQRTIELLEKVDSTIMGCIYFAESNLSYTDYYYS
>gnl|bykdb|A0A1V4G2G2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. VT-16-81] (length=227 residues).
MPRLTNDKGSLVTMANPKSTSSEAYRKLRTNIQFSSIDSQIQTIMIASALSGEGKTTTIGNLAVTYAQEGKKVLLMDTDL
RKPAVHRMFNVPNHVGLTSVLSSQYKVTEVLRETGVEGLHVLSSGPIPPNPSEMIGSRKMTALLEDLKEVYDVILFDTPP
VLAVTDALIISSLCDGVILVVSAGKVKKDLVKKAKAHLEHVNARILGAVLNNVQVPKRRNAYYGENA
>gnl|bykdb|A0A1V4I5Z9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Clostridium] thermoalcaliphilum] (length=237 residues).
MKSLIVHNNPKSPIAEAYRNVRTNILFSNIDENLQTILITSAGQGEGKSTTISNIALSLSDLGKKVLLIDCDFRRPSIHK
KFGITNSKGITDILLENIEYQAYTQRTNKENLDIITAGQIPPNPSEMISSNKMKRLLEEMKKDYEYILVDTAPIGVVTDA
AILSTFIDGVILLCASGEAQIEHAKKAKENLVKVGANILGVILNKLEIEKNRSYGYYAYSYEDDSDKNTRKKKRSKK
>gnl|bykdb|A0A1V4IGP8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium chromiireducens] (length=243 residues).
MSLLERIKSSTKHKRVVDRRIYAGFVVEDKPKSVDAEAFRTLRTNIQYSSFDKEIRTIAVTSSEMAEGKSTVAGNIAISF
AQGEKKVILVDCDLRKPSVHKNFRTSNLVGVSEVLLGKVSLDEAVQKHNNNFNYLTSGKIPPNPSEMLGSAAMTNLIERL
KDEYDLIVLDTAPLRAVTDAQILSTKVDGTILVVRAGKTKKDVVIEAKNLLDKVGANVIGSVLNAVENTRGKYYAYYGNE
DEK
>gnl|bykdb|A0A1V4IP90 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium chromiireducens] (length=225 residues).
MLRNSMSLEEKKGFIVEQKPKSHSSEAYKILRTNIQYSSYNKELKTILITSSVASEGKSTISGNLALSFAQDNKKVLLMD
CDLRRPSIHKKFNVSNLLGLSEILIGEIDLKEAIICHNDTLDILTSGKLPPNPAEMLSSNSMSNLITTLREIYDLIILDC
CPLLGITDAQILSTNVDGTILVVQSEKTKKDEVTESKKLLLKVGANIVGVILNRIPRCRHKYYYY
>gnl|bykdb|A0A1V4IQA1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium oryzae] (length=222 residues).
MLKDIISIKDPKSTAAEAFRTLRTNIQFSSFDEELDTIVITSTQPGEGKSTVATNLAVVMAHSGKKVLLMDCDLRKPTVH
KKLGLSNKEGLSNLLSKEKKLDEVIKASDVENFYVLTTGPIPPNPSELLESNKFRNFLKEISSVFDIVLLDAPPVLAVTD
AQILASFCNGVVFVAGYGQAEKKAIVRAKELIEKVSGKILGVVINKVPNTKDSYYYYNYEYK
>gnl|bykdb|A0A1V4IZU9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium chromiireducens] (length=241 residues).
MFTAKKLHKAVANQDYKGFVVEKKPKSIVSEAYRTLRTNVQYSSFDKAIKTIVITSAEAAEGKSTVSGNLALSFAQNDKK
VIIVDCDLRKPSVHKNFKISNLSGLSEVLIGKENLEDVIQNRNGNLDILTSGKIPPNPSEMLSSVSMTNLIEKLREQYDI
VILDSAPLQAVTDAQILSTKADGTILVIRAQRTSRDSVIEAKNLLTKVGANILGTVLHAVENTRGKYYYYYGSSDESKEA
K
>gnl|bykdb|A0A1V4SUC4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium thermobutyricum DSM 4928] (length=215 residues).
MLIIEKSPKSIAAESYRTLRTNIKYSSFDKDMKRILFTSSIPGEGKSTTASNIALAFAQEEKKVIIIDCDLRRSNVHKEF
NISNRTGLTNVLISKEDINKHIQNYNKYLDILTAGVVPPNPSEMLSSKAMSDLLDKLDKEYDVIIIDSPPIKAVTDAQIL
SRIVDGVVLVVRSGFSKKEAVLETKSEIEKVGGKIIGTVLNRAEGTREKYYYYYG
>gnl|bykdb|A0A1V4VZY2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pelotomaculum sp. PtaB.Bin104] (length=755 residues).
MQELDKYAYQPVQGEVFDYVDTQQSVHPQDDGIVELVHAILRRWYIVVFCAILVGGGGAVAVWRFMPEKFNTKGSVMVSL
VVAPIMYDTKTGVGNYDTFKNTQAGVMTSDLILNRVADEVKDKELVFFNQQESLLQVMRNMVVNGAIQVIPERGTEFLHI
QMSTEVPSDAEKLINAFLRSYEAVVKTDEIDSINDRLSRLEVQRRTLEEQMRRQKAKIRERVDEYGTEQLTPRQEIALKQ
VATLKQEQVSIGVRRMLMEARVMTMEDQLKDELTLSDITDQVQLRVESDPVIQSLRQDIRRYEQLIRDGQATMIDTNPEM
QRRKQILSELQRDLEKQRQEATTRHEQSALADARKKRQGELDSLKAELNQIIAYEEKIREQLKEHDDSTIQIGRTQLDID
DLREQYESSRQIFNEITRRIDELNIERDRKPRISIHSWARSVSAESKKKKLMVAAPFGGLGMGLALAFLLAKLDRRVHAP
DDVARRIGVRIIGTTTGPEHVSPKLLGQQLMDDYQTIRANLGLLDGNGNTKLLVVTSPGMGDGKSTLSLNLATSFARSGR
KTLLIDGDLRKPDIAIMLNLPGTLRGIQDYLFGMDLEKTIYRMEGLDLSVMASDARNSQDALELLSIPETPERIRRLRDS
FDYIIIDTPPVLAFSDAMVWAKMADGVILTSYIGHTSKVEMKEALKRLHEIKANIIGTVINNVKVAHSYRRYGYGYGYGY
SEKEKARRKPHATKRGNKALLIGAGSEENGVNQQT
>gnl|bykdb|A0A1V4W0T8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pelotomaculum sp. PtaB.Bin104] (length=241 residues).
MPGKAKEKKVERKLYTQIHPMSAIAESFRTLRTNIAYSSTDQPCRVILITSPGPGEGKTTIASNLGVVMAQAGSRVMILD
CDFRRPVMHHVFGLDQQTGLTNLLAQDLEVGEVVQSTEVEGLSVITCGPIPPNPSEMLGSQKMKDLLEKLSGQYDVVLLD
SPPVVAVTDASVLASQVDGVILVFKTGKSRIDIASDAIAQLEKANARILGVILNKVKTHGGRYYRYNYHYYSSSAETNAG
Q
>gnl|bykdb|A0A1V4W6Y6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pelotomaculum sp. PtaB.Bin117] (length=238 residues).
MPVSRNGDSALYAYFKPKSAIAEAFRTLRTNISFSSLNRPFKTIMTTSAGPLDGKSTVTSNMGVVMAQAGSRVLIVDCDL
RKPVMHKNFETDNHRGLTNLLVQDLDIAEVIKPTRVEGLSLLTSGPIPPNPSELLGSLKMKNFLEKAAGMYDIVFIDSLP
VIAVTDASVLAPLVDGVMLVVKSGATKIDMVKEAKNQLKKAKARIIGVVLNEVKMKSEDYHYYYYYKSRNKPSKEVVL
>gnl|bykdb|A0A1V5IV39 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Firmicutes bacterium ADurb.BinA052] (length=206 residues).
MVTSTFPEEGKSLTACNLAITFAQAGEDVILVDADMRRSTLHEDFEVPKSPGLSEAIISGNVGASLADGPVEGLRLMAAG
TAPPNPSELLHSRRMDNLLDDLKSRSNLVIIDAPPVLAVTDASVLASRADGVILIVDLTLSDRNAAKRAIGALRAVNARI
LGTVITGLEPARKRYGYHHYYNQYYYYDSEHGPEKKDRAHRGRAVQ
>gnl|bykdb|A0A1V5IWX0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Firmicutes bacterium ADurb.BinA052] (length=261 residues).
MFKFFSKREVADDHRDSKQALVTLYSPKSAASEAYRMLRTNIHFSSGGDSLKVIVVTSAFPGEGKSLTAANLAITFAQAG
DSVFLLDADMRRSTQHENFELPESPGLSEAIVSGNIEASLRTGPVEGLKLMTAGITPPNPSELLHSKRMDNLLDDLKARS
DLIIMDAPPVLAVADASVLASKADGVILAVDLTLSDRNAAKRAIGALRAVNARILGTVITGLESTRKRYGYHHYYDRYYY
YYDSEHSAEKKDRAHRGRTVQ
>gnl|bykdb|A0A1V5KZD5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Firmicutes bacterium ADurb.Bin456] (length=247 residues).
MARRSETERRLYSHVRPKSAIAESFRTLRTNINFSAVDWPYKVILATSPGPEDGKSTVITNLGVVMAQAKSRVLIMDCDL
RKPVIHKYFNQASIRGLTNLLVQDLRLEDVVYATEVEGLFIIPSGPIPPNPSELLGSAKMVELLEEAAAAFDVVLLDAPP
VIAVTDAMVLTPMVDSVLLVLKAGSSRIDMAREARDRLVRAGARSVGVVLNQADIRGGGYYPYHIYYYYGHREKPPGRNP
GAREAAH
>gnl|bykdb|A0A1V5PJG2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Firmicutes bacterium ADurb.Bin354] (length=287 residues).
MLNWLLAVFLGVMIPTIYIILKNFFNEKVTSIHDVENLLNRKILSVIYTNYQKTESVVKDNPGTSIAESFRNLRSSLFLK
FREEPLKVILVTSSQPQDGKSFICANLAASIASVGNKTVVMDCDLRRPTLHEKFHIDNSVGLSQYMINHTPKEQIIFKSD
IENLHIIPSGPILPNSSELIEAGALDGLMDYLKNKYEYVIIDTTPAGIVADAALMTKYASLVLLVCRNNFTRKDVFAETL
NLFSITKIENFDVVLNDLNIKKSRYGKYDRYYQKDDKPGISVGKFRV
>gnl|bykdb|A0A1V5TB58 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Firmicutes bacterium ADurb.Bin262] (length=445 residues).
MFAFAKYTYTETYEAKATLAFTISTKQYTYNSDGKIIKTEEVIKPYSGIDVARYQYYLNSDEMVDTVYRRLNRVYTADQI
RKSLMIRGTDIAGIFTVSVISQNRQLCQDAIRIILAEYPEYLKKFDTGLGIQKIIDQSTPFITNSDQAFQKALIGFLAGA
FIVIAVLFLIEVLSNTVRSTDDIRENTNLRLLGSVPLEEETRTKGGKKKPLPEALLISDPKSVSFSFIESFKAIRTKVEN
IAAEKGHKSFVITSTFENEGKTTVAINLSCALAQKGKSVLLIDADLRKPSVLKMIGLKEDDKSGLIQIIKDKAAYADSIK
FIKPLGIFVMPSGGISPASSQFLDTDKVKEILEKAKSEFDYVIIDTPPAHVVSDCLVVSRISDALIFTIKMDYAKVEDIN
ETLEEIDVTDIDVIGSVFTMSALGSGSYIAPRRGGAYRYRYKRGY
>gnl|bykdb|A0A1V5X8V9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Firmicutes bacterium ADurb.Bin193] (length=263 residues).
MNKRKHKINFFKKADKSVLTSTDEKTSFIIEKNTSFHIIEAYKAARTNIMFSLMDNKGCKVIIFTSAIPAEGKSTTCVNT
AITFAQTGAKVLLVDADLRCPRVHKYLHIENVNGLSNVLGGFASLAEVINTDADHGFDYITAGHIPPNPAELLLSDQMKQ
MLNILAQRYEYIFLDMPPVTVVTDAATVASFATGVAMVVRENYTPHPVLKNALVALKMANAKILGFILTDADEVGYSYKD
KYGKYKYKYKYGYRYGNRYGDYA
>gnl|bykdb|A0A1V5XFS5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Firmicutes bacterium ADurb.Bin193] (length=251 residues).
MRKAARNNIFNRQTKKIIRNEQNYLKSTRENIINKTSSFDTLEAYRSARTNIIFSLFDEEGCKKLIITSAMPGDGKTTTC
INLALTFAHMGSNILVIDADLRCPRVHSYFDIDNEIGLSNLLVGLAQIDSVIQSKEGIDVITAGHIPQNPAELLSSKKMG
EILDTLSKRYDYIFIDTPPVGLVADAVNMAKNVSGVIIVARQNYTIHKAINEAIASLKFANSRILGFIVNDSAHAKHSYR
KNKYGYYKYIT
>gnl|bykdb|A0A1V6AJ14 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Firmicutes bacterium ADurb.Bin146] (length=255 residues).
MADLEKREYLLFDNSSFPVTEAIKAARTNLMFTTAKEKCPVISFTSAHMGEGKSTVCANMALAFAEAGFKTLIIDADMRK
PTINKYFKVKSSPGLSDILGGLVKENFIYPTKYKNLHILPSGTIPPNPSELLTSERMTLLLSELRETLDYIFIDTPPVLI
VTDAVAISNKVTGTVLAVRQNFSRTNLIKDTVDALNNVSGKLLGFIFNDYDIETMSYNKSYRYGKNGYKYAKYERYGGYD
KKPIKPASPVNLDND
>gnl|bykdb|A0A1V6APB3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Firmicutes bacterium ADurb.Bin146] (length=255 residues).
MTDLQKREYLLFDNSSFPVAEAIKAARTNLMFTTAKDKCPVISFTSSHMGEGKSTVCANMALAFAEAGFKTLIIDADMRK
PTINKYFKIKSSPGLSDILGGLVKENFIYPTKYKNLHVLPSGTIPPNPSELLTSERMTLLLNELRETLDYIFIDTPPVLI
VTDAIAISNKVTGTVLAVRQNFSRTNLIKDAVDALNNVNGKLLGFIFNDYDIETMSYNKPYRYGKNGYKYAKYERYGGYD
KKPVKQTSPVNLDND
>gnl|bykdb|A0A1V6EJL9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Firmicutes bacterium ADurb.Bin099] (length=253 residues).
MADIEKSEFLLFDNKSFPVAEAIKATRTNLMFITAKEKCPVISFTSSHMGEGKSTVCANMALAFAEAGFKTLIIDADMRK
PTINKYFKIKSSPGLSDILGGLVKENFIYPTKFKNLHVLPSGTIPPNPSELLTSERMTLLLNELRNTLDYIFIDTPPALI
VTDALAISDKVTGTVIAVRQNFSRTNLIKDAVEAINKVNGKFLGFIFNDYNVDTMPYNKQYRYGKNGYKYAKYGGYGGYD
NKPVTPPVNLDND
>gnl|bykdb|A0A1V8VF14 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus hirae] (length=222 residues).
MKKKGVPLISASKQSSMISEQYRTVRSNIQFSSFDQDIKTIVVTSAGPEEGKSTVSANLAIVFANSGKKTLLIDADLRKP
SVESTFRSTSNSDGLTNLLKKRNESAFVFIHETNIAHLWTMTSGPKPPNPSELLESSRMNEIIDELSVNFDLIIFDLPPV
VPVTDAQILASKTDGTIIVVRERKTLKQELFKAKELLTIAQANILGIVYNGVKKSKDINYYY
>gnl|bykdb|A0A1V8WCJ7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus hirae] (length=231 residues).
MRRVIKQKETLLQPIRLITLTNPSSAAAEHYRTIRTNIQFVSINDQQVKTIVVTSSGPGEGKSTTAANLAVVFAKAGQKV
LLVDADMRKPVIYKAFQINNHYGLSNLLSSTETISKGIQKTAIKELSVLPSGPIPPNPSELLSSKRMDQLMVEASQLYDI
VMFDLPPIVTVTDAQILSSKADGTLLVVREKTSRKEAVVKAKKLLEMAQAKVLGIVYNGVEQSKDTSYYYE
>gnl|bykdb|A0A1V8WTI8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus hirae] (length=232 residues).
MARTQKQKAAQTHAVSLITLTNPSSPIAEQYRTIRTNIQFASAAGQQIKTIVVTSSGPGEGKSTTAANIAVVFAKSGQRV
LLVDADLRKPVVYKTFQLNNASGLSTALSSSGSVADVIQRTPVENLSILPSGPKPPNPSELLSSPRMDQILSEARQLFDV
VIFDMPPVVAVTDAQIMSSKTDGTLLVVRENMSRKESLTKAKELLEMVQARVLGVVYNGAEHSKDAGYYYGN
>gnl|bykdb|A0A1V8YKU0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus villorum] (length=232 residues).
MRRIKKQMESQIETVDLITLTNPSSAISEQYRTICTNIQFVATERKTVKTLVVTSSGPAEGKSTTAANLAVVFAQAGKEV
LLVDADMRKPVLAKTFQINNSYGLSNILSFSGNMEDGIQKTTMEYLSILPSGPTPPNPSELLSSSRMDELMKELNQLYEI
VIFDMPPVVAVTDAQILSAKADGTLLVVREGISKKESLLKAKGLLEMSQAKVLGVVYNGMQQNKETNYYYSS
>gnl|bykdb|A0A1V8YX01 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus villorum] (length=232 residues).
MRKTRRARNASIRKNLITISDKTSPITERYRTIRTNIQYSFPYGEKLHTLVVTSPGVGEGKSTTTANLAVVYANFGQKVL
IIDADMRKPTLDKIFSLEKQVGLSTLLGTNIHAEECIQESLEKNLFVMTSGPKPPNPAELLGSKRLEEVINELKSSYDII
LFDTPPLTAVTDAQILASKVDATVMVVSEKLTKKTNFQTAKHLLELVNANVLGVVYNASKEDENQGYYYYGS
>gnl|bykdb|A0A1V8ZEB9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus casseliflavus] (length=234 residues).
MAKIKENKGTQTHAVSLITLVDPSSPISEQYRTIRTNIQFASSVDRQIKTIVVTSSGPGEGKSTSSANLAVVFAKSGQRV
LLVDSDMRKPTVFKTFNLSNATGLSTVLSTTTSILEAAQKTVIDNLSVLTSGPKPPNPSELLGSARMNQVIEEAKNLYDI
VIFDMPPVVAVTDAQIMASKADGTLLVVRENVSKKESLLKAKDLLNMVQARMIGVIYNGAEHSKDSGYYYYYGN
>gnl|bykdb|A0A1V8ZJ60 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus casseliflavus] (length=213 residues).
MRSMKENYSIISEQVKLIRENVDYLCQQQDAQTILITSGESGTGKSTVSANLAVAYAQKGNRTLLIDADLRKPTQHHLFS
QEMHVGLSNYIRRAVSIESCVQQVILEDCEFSIITSGAIMSNPNDLLASSKMTAALQEVKQLYDVVIIDTPPVNVVSDAL
ILAKKVDGVLLVVHADKTNKQSAKNAVKKLRLVNANILGVVVNGTDTAENYYY
>gnl|bykdb|A0A1V9AW18 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Geobacillus sp. 44B] (length=231 residues).
MARSNQKQTKKLERSLITIEDPKSPISEQYRTIRTNVQFSFVDAPMRSLMVTSTGAGEGKSTTAANLAVVFAQQGKKVLL
IDADLRKPTVHYTFRLNNYTGLTNVLTNSAPLLPSCQETRVENLYVLTSGPIPPNPAELLSSKAMEQCIQQLYNEFDLLI
FDTPPVLAVTDAQILAHQCDGTVLVIESGGTEIEAAVKAKELLEAANAKLLGVVLNKRKYRQGQYYYYQYK
>gnl|bykdb|A0A1V9BB52 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Geobacillus sp. 46C-IIa] (length=229 residues).
MARKKQIRKAERRLIAADNPKSPISEQYRTIRTNIQFSLIDTTLRSLIVTSTGPSEGKSTTVANLAVVFAQQGKKTLLID
ADLRKPTVHYTFRLNNYVGLTNVLTGSAPLLPTCQATEIDHLSILTSGPIPPNPAELLSSKAMAQCLEQLYETFDLVIFD
TPPVLAVTDAQILANQCDGTVLVIESGGTEIEAAVKAKELLEAANAKLLGVVLNKRKHREGGYYYYQYK
>gnl|bykdb|A0A1V9C2D5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Geobacillus zalihae] (length=235 residues).
MKPLARSNRQQLKRLGRNLITAEDPKSPIAEQYRTIRTNIQFSFIDAPLRSLIVTSTGPGEGKSTTVANLAVVFAQQGKK
TLLVDADLRKPTVHYTFRLNNYMGLTNVLTGSAPLLPTCQATEIDHLSVLTSGPIPPNPAELLSSKAMAQCLEQLYETFD
LVVFDTPPVLAVTDAQILANQCDGTVLVIESGGTEIEAAVKAKELLEAANAKLLGVVLNKRKHRDGGHYYYYQYK
>gnl|bykdb|A0A1V9CHB7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus stratosphericus] (length=227 residues).
MIFKRKKREKRDLSCISVLNPHSVIAEQFRTIRTNIEFTSIQTRLKSILVTSSLPKEGKSFTAANLAAVFAQQKKRVLLM
DADLRKPAIHEYFDLSPHTGLTNVLLNNCSLEEAILPTPIEHLELLPSGTIPPNPAELLSSSVMKQLFYEIEQQYDMVIV
DSTPLLPVADAKILANRTDGSILVVLSGKTKIAAVKKSKEVLEGTTGKLLGAMLNGKKVKKGRHYMY
>gnl|bykdb|A0A1V9CTR3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Geobacillus zalihae] (length=235 residues).
MKPLARSNRQQLKRLGRNLITAEDPKSPIAEQYRTIRTNIQFSFIDAPLRSLIVTSTGPGEGKSTTAANLAVVFAQQGKK
TLLVDADLRKPTVHYTFRLNNYMGLTNVLTGSAPLLPTCQATEIDHLSVLTSGPIPPNPAELLSSKAMAQCLEQLYETFD
LVVFDTPPVLAVTDAQILANQCDGTVLVIESGGTEIEAAVKAKELLEAANAKLLGVVLNKRKHRDGGYYYYYQYK
>gnl|bykdb|A0A1V9IL38 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sporogenes] (length=236 residues).
MNRKLELITIKDPKSPISEAYRTLRTNIQFSSFDEKISVIFVTSSTPGEGKSTTSANLAITMAQNGAKTILVDCDLRKPN
VHKLFKLSNTRGLSNLLIEDNSIDGVIQQSSVENLHILTSGVKPPNPSELLSSQKMKKFIEMSKEHYDYIILDTPPVGVV
TDAQLVSQYSDGGILVTASGQVERELAIRAKQLLQKVNAKILGVVLNKVDTESGSGYRYYNYYYEENGEKKKRSKK
>gnl|bykdb|A0A1V9IND4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sporogenes] (length=236 residues).
MDRNLSLITIKEPKSPISEAYKTLRTNIQFSSFDEKISVIFVTSSTLGEGKSTTSANLAITIAQNGSETILVDCDLRKPN
VHKLFKLSNTRGLSNLLIEDNGIDKVIQQSGIENLHILTSGIKPPNPSELLSSKKMKKFIEMSKEHYDYIILDTPPVGVV
TDAQLVSQYSDGGILVAASGQVERELAIRAKELLEKVNAKILGVVLNKVDIDSGNGYRYYNYYYEEDGKKKKRKKK
>gnl|bykdb|A0A1V9SX69 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus salivarius] (length=220 residues).
MQKFELRLDDIDFQSQESFKTLRFNVEFSGEKNQVFYITSTYPNEGKSTVSLELALAFSDNGKKALLIDADLRKSVSRQL
IRTGSIEIGLSDYLVGRAQFDDVIAQSNIENFSMIFSGPVPPNPSEILDGERFKHLIETVKEKFDIVIIDTPPMGSVIDA
AVIAKNCDGGIIVINSGQASYRQIRKTKEQLERADSKIIGCVLNKVDASNNDYYYGYYHK
>gnl|bykdb|A0A1V9U612 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus salivarius] (length=220 residues).
MQKFELRLDDIDFQSQESFKTLRFNVEFSGEKNQVFYITSTYPNEGKSTVSLELALAFSDNGKKALLIDADLRKSVSRQL
IRTGSIEMGLSDYLVGRAQFDDVIAQSNIENFSMIFSGPVPPNPSEILDGERFKHLIETVKEKFDIVIIDTPPMGSVIDA
AVIAKNCDGGIIVINSGQASYRQIRKTKEQLERADSKIIGCVLNKVDASNNDYYYGYYHK
>gnl|bykdb|A0A1V9VYC8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. CDB3] (length=234 residues).
MALNSLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNVEFASVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKK
VLLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTTVDNLHFLACGPIPPNPAELIGSKSMQELLAQAYSMYD
LVIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDRESEQGSYYYYGAN
>gnl|bykdb|A0A1W1V6B0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Desulfonispora thiosulfatigenes DSM 11270] (length=243 residues).
MSLLDIISLKNPKSPIAEAYRTLRTNIQFSDLDKALKTIIITSSVPGEGKTTSICNLAVTMAQANSKVLLIDCDLRKSQL
HKRFELSNSKGLTNVLAQKIPHQDIIQKTAIEGLDVLTAGPKPPNPSELLGSNAMKDFIAEMSKEYDRVLIDAPPIGVVT
DAGILASFADGVILVVAARQVPIEGAQRSKELLERVQANILGVLLNKIPNDSRGYYSYYYYHEYYENDDTEDKPTHSKKR
RKK
>gnl|bykdb|A0A1W1XHI8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium acidisoli DSM 12555] (length=227 residues).
MLIVQDNPKSPISEAYRTLRTNIQFSNFDDDMSTVLVTSSGPGEGKSTTAANLALSMAETGKRILLIDCDLRKPSLHKKF
NISNNKGLSNLLIGQHKFADVAQRYNESLYILTSGTIPPNPSEMLASKKMQSFLDEAKKTFDFIILDTPPVIAVTDAQLL
STMVGGVLLVIAAGQAEIGAAQKAKELLEHVKANIIGVILNKAEAGGGKNYGYYHYYYGEGPKGKKK
>gnl|bykdb|A0A1W1YU47 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Sporomusa malonica] (length=229 residues).
MVQKRQLIVHEDAKSPIAEAYRTMRTNIQFAKVDSDLRVIMFTSAGPGEGKSTTTANTAVAMAQSGKKVIIVDCDLRKPV
QHKIFGKKNRGVTNILVEERPVTELIQDTGIDNLQVLTSGPIPPNPSELLGSAKMRELIGCLKELADVVIIDAPPTVAVT
DACVLASSVDGILLVLSAGVIRPEMAQKAKELLLKANGHILGVILNKVEIEEEHAYYYYYYGNEGKNAK
>gnl|bykdb|A0A1W2DLT2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Sporomusa malonica] (length=231 residues).
MMDVRTLVVNHSPKSIWAEAFRAFRTKILHSKKDSIVKSILFTSASAGEGKSVTVANTAVVLAQTGKKVIILDCDLRKPV
QHEIFKKRKTNRGLTNFLNGECSISDIVQDTGIPNLRLITSGPILFNPSELLDSDKVEEAIFSLKSQADYIIVDSPPVLP
VTDACILGSKVDGIILVVGVGKVQPEMALRAKEHLETVNGNILGVIINRSDTFVEQSAYYHYCENVEKAAN
>gnl|bykdb|A0A1W2GB57 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. JKS001846] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTQSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A1W5ZSL9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Halobacillus mangrovi] (length=231 residues).
MARKKNKTIQTRARSLIANEDPKSPVAEQFRTIRTNLQFASIDKELETMMVTSASPAEGKSITTANTAAVFAQQGKKVLL
VDADLRKPTMHYTFRVDNTYGLSNYLVSSRSVLDLVRESNVENLDLLPCGPIPPNPSELLGSKKMERFIKEAKQTYDLII
FDTPPVLAVTDAPVLSRLVEGVLLVVRSKQTDQEAAVKAKEQLLQSKANILGAVLNDQDVSASNYYYYYGR
>gnl|bykdb|A0A1W6AG83 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus mycoides] (length=234 residues).
MALNSLFKKKQNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFASVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKK
VLLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYD
LVIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A1W6HMB4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus vallismortis] (length=226 residues).
MGFRKKKSRRGLAQISVLHHKSLVAEQYRTIRTNIEFSSVQTHLRSILVTSSVPGEGKSFSAANLAAVFAQQEKKVLLVD
ADLRKPTIHETYQLENVQGLTNVLVGNASLGETVQKTLIDNLYVLTSGPTPPNPAELLSSKAMGELIQEMYSRYSLVIFD
SPPLLAVADGQILANQTDGSVLVVLSGKTKMDTVQKARDALQQSKAKLLGALLNKKKIKKTEHYSY
>gnl|bykdb|A0A1W6HN78 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus vallismortis] (length=229 residues).
MLTRKKDKLGKRSVIAMSEPKSINSEQYRTIRTNIEFSSVDTEVKSLLITSAGPEEGKSTTAANLAVVFAQQGKKVLLID
ADLRKPTVHFTFKLDNGTGLTSLLLKQMPFQKAVLPADEANLDILTSGPIPPNPAELLSTGAMKDLLSEAGAVYDKVILD
TPPVLAVADTKILGSYTDGAIMVISSGKTDKEKAAKAKEALDYCPCKLLGAVMNGKKQTKHSDYAYYGQ
>gnl|bykdb|A0A1W6N894 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus brevis] (length=256 residues).
MTTMAWFKRNKKKLDDTSLKYGVGLVSYTEPNGMIAEQFKTIRTNIQFSSVDKQLQSILFTSSEPSEGKSTISNNMAVTW
ADQGTKVVLVDADLRRPAVHRSFDVSNRMGLTNYLSGNADLSAVVRETMVKDLSVITSGPVPPNPAELLGSKRIENLLSE
LTAEFDLVIVDAPPVNTVTDAQLLASRIDGTVLVVPQGIADKNGVRRAKQLLETVHANILGTVMNRVTAQKSVGYYGGNY
YGGSYYGGYYGTDDKK
>gnl|bykdb|A0A1W6NPQ2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus plantarum] (length=242 residues).
MFKRKEQNITTTAPINLTTINEPTSVITEQIKTIRTNINFAATDKNLRTLMVTSAMIGEGKSTVSGNLAVEYAKEGMQVL
LVDADLRRPTIHKTFGLENHKGLSSWLSNQMDNVNDAIHPVIGNLFVMTSGPKSPNPAELLGSNKMTEFLTSATRKLDLV
IVDASPILPVTDSQLLANKVDGTVLVVRQGVAQKAAVRDAVNSLKKSQANILGTVLNDVRDGSHHGYYGYNGGYGYYSDE
DK
>gnl|bykdb|A0A1W6VWA8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Geobacillus thermodenitrificans] (length=232 residues).
MARKPAASIRKAERKLITFDNPKSPIAEQYRTIRTNIQFSFIDAPLRSLIVTSTGPGEGKTTTAANLAVVFAQQGKKTLL
VDADLRKPTVHYTFRLNNYMGLTNVLTGSAPLLPTCQATEIDHLSVLTSGPIPPNPAELLSSKAMAQSLEQLYETFDLVI
FDTPPVLAVTDAQILANQCDGTVLVIESGGTEIEAAIKAKELLEAANAKLLGVVLNKRKHRDGGYYYYYQYK
>gnl|bykdb|A0A1W6WWN9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTNSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A1W7AA65 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Macrococcus canis] (length=234 residues).
MLKKNRLKNSNKERKLITHLLPKSTISEQYRMIRSNIMFSSIDIQIKKIVITSAAPSAGKSTTAANIAVTYAQAGKKVLL
IDGDLRKPTVQYTFETKNVFGLSNVITEQIRLEEAIQNTNIENLSILTSGPIPPNPSELLSSKKFSEKLRQLEEYFDMII
IDTPPILAVTDAVILSTLVEGTIMVINVENNNREQLVKAKDLLIKSDANLLGVVLNNIEKSSKENYYYYEYYGN
>gnl|bykdb|A0A1W7QG07 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus acidipiscis] (length=251 residues).
MALFKKKKQLDSNSMKHGVGLITVTKPTSSIAEQFRTIRTNIQFSSADRQLKTLVFTSADPSEGKSTITSNVAVTWADQG
NKVLLIDADLRRPTVARSFGVSNSHGLTTILTAKQANLGESIHETEVPNLYVLPSGPVPPNPSELLNSSKTDQLLKVLKE
QFDIIILDVPPVNTVTDAQILASKVDGVILVVPQGIALKGAVLRARDLLKKVNANLIGAVLNRVTDAASGGYYGGYYGGY
YGGYYGTDDKK
>gnl|bykdb|A0A1X0V2Q8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Leuconostoc lactis] (length=250 residues).
MALFRKKYKVGRDGLSRDTMINGARLITAAEPKNPVSEQFRTIRTNIEFASVAKGNVKTLLVSSPLPSEGKSTITANLAV
AYAQQGKKILLVDTDLRRPTVGVTFGIADNHGLTNYLADVNSDPQSIIRHTRLETLDVVTSGPVPPNPAELLASSRMTNL
IAELRQRYDLVIFDVPPFLMVTDAQVLMSKMDGVAVVVSGRQTTKGALQRTADMLKLADAPMLGFIYNDRSRKKQTGAGY
GYGYGYGYAK
>gnl|bykdb|A0A1X0V8F9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Leuconostoc mesenteroides subsp. mesenteroides] (length=256 residues).
MSFFNKGRAVSKDGLSVETMTKGARLITAAEPKNPVSEQFRTLRTNIEFASVAKGEIKTLLISSALPSEGKSTVTGNLAV
AYAQQGKKVLLVDSDLRRPTVAVTFGLNKNASGLTNYLGDSEKEVGSIIHRTAMDNLNVMPSGPIPPNPAELLGSGRMTN
LITQLKTHYDMIIFDVPPFLMVTDAQVLMSKMDGVAIVVNGGKTTKGALQRTHEILKIAEAPVLGFIYNDQSRKKKGSAG
YGYGYGYGYGYGETKA
>gnl|bykdb|A0A1X0WQC0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis subsp. tigurinus] (length=227 residues).
MPTLEITHKKLDPAIKAEEYYNALRTNIQLSGNNLKVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLVDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSQGLCDTNVENLFVIQAGSVSPNPTALLQSENFATMLDTLRKYFDYIIVDTAPIGVVI
DAAIITQKCDASILVTAAGETNRRDIQKAKEQLEQTSKPFLGIVLNKLNTSVEKYGSYGAYGSYGKK
>gnl|bykdb|A0A1X0WWW2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis subsp. tigurinus] (length=227 residues).
MPTLEIAHKKLNQARKAEEYYNALRTNIQLSGDNLKVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GIFKSRERITGLTEFLSGTTDLSQGLCDSNIENLFVIQAGSVSPNPTALLQSENFKTMLDTLRKYFDYIIVDTAPIGVVI
DAAIITQKCDASILVTAAGETNQRDIQKAKEQLEQTSKPFLGIVLNKLNTSVEKYGSYGAYGSYGKK
>gnl|bykdb|A0A1X1FJ53 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis subsp. tigurinus] (length=229 residues).
MPTLEIAQKKLDLARKAEEYYNALRTNIQLSGNNLKVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSQGLCDTNVENLFVIQAGSISPNPTALLQSENFKTMLDTLRKYFDYIIVDTTPIGVVI
DVAIITQKCDASILVTAAGETNRRDIQKAKEQLEQTSKPFLGIVLNKLNTSVEKYGSYGAYGSYGKNKR
>gnl|bykdb|A0A1X1FUI1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis subsp. tigurinus] (length=230 residues).
MPTLEIAQKKLDLARKAEEYYNALRTNIQLSGNNLKVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSQGLCETNVENLFVIQAGSVSPNPTALLQSENFATMIDTLRKYFDYIVVDTAPIGVVI
DAAIITQQCDASVLVTAAGETNRRDVQKAKEQLEQTSKPFLGVVLNKLNTSVEKYGSYGAYGSYGNYGKK
>gnl|bykdb|A0A1X1G4L0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis subsp. tigurinus] (length=227 residues).
MPTLEIAHKKLDKARKAEEYYNALRTNIQLSGNDLKVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSQGLCDTNVENLFVIQAGSVSPNPTALLQSENFATMIDTLRKYFDYIIVDTAPIGVVI
DAAIITQQCDGSILITAAGETNRRDVQKAKEQLEQTGKPFLGIVLNKLNTSVEKYGSYGAYGSYGKK
>gnl|bykdb|A0A1X1G7L7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis subsp. tigurinus] (length=227 residues).
MPTLEIVQKKLDLARKAEEYYNALRTNIQLSGNNLKVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSQGLCDTNVENLFVIQAGSVSPNPTALLQSENFATMLDALRKYFDYIIVDTAPIGVVI
DAAIITQKCDASILVTAVGETNRRDVQKAKGQLEQTSKPFLGIVLNKLNTSVEKYGSYGAYGNYGKK
>gnl|bykdb|A0A1X1GH56 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis subsp. tigurinus] (length=227 residues).
MPTLEIAHKKLNQARKAEEYYNALRTNIQLSGNNLKVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSQGLCDTNVENLFVIQAGSVSPNPTALLQSENFKTMLDTLQKYFDYIIVDTAPIGVVI
DAAIITQKCDASILVTAAGETNRRDIQKAKEQLEQTSKPFLGIVLNKLNTSVEKYGSYGAYGSYGKK
>gnl|bykdb|A0A1X1GK10 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis subsp. oralis] (length=230 residues).
MPTLEIAHKKLEQARKAEEYYNALRTNIQLSGNNLKVIAITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEYLSGTTDLSQGLCETNVENLFVIQAGSVSPNPTALLQSENFATMIDTLHKYFDYIIVDTAPIGVVI
DAAIITQKCDASVLVTAAGETNRRDVQKAKEQLEQTSKPFLGVVLNKFNTSVEKYGSYGAYGNYGNYGKK
>gnl|bykdb|A0A1X1GYN8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis subsp. oralis] (length=227 residues).
MPTLEIAHKKLDQARKAEEYYNALRTNIQLSGNNLQVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSQGLCETNVENLFVIQAGSVSPNPTALLQSENFATMIDTLRKYFDYIVVDTAPIGVVI
DAAIITQQCDASVLVTAAGETNRRDVQKAKEQLEQTSKPFLGVVLNKFNTSVEKYGSYGAYGNYGKK
>gnl|bykdb|A0A1X1H169 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis subsp. oralis] (length=230 residues).
MPTLEIAQKKLDLARKAEEYYNALRTNIQLSGNNLKVISVTSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSQGLCETNVENLFVIQAGSVSPNPTALLQSENFATMIDTLRKYFDYIVVDTAPIGVVI
DAAIITQQCDASVLVTAAGETNRRDVQKAKEQLEQTGKPFLGIVLNKLNTSVEKYGSYGAYGNYGNYGKK
>gnl|bykdb|A0A1X1H3R3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis subsp. oralis] (length=230 residues).
MPTLEIVQKKLDLARKAEEYYNALRTNIQLSGNNLKVIAITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSQGLCDTNVENLFVIQAGSISPNPTALLQSENFATMLDTLRKYFDYIIVDTAPIGVVI
DAAIVTQKCDASVLVTAVGETNRRDVQKAKEQLEQTGKPFLGIVLNKLNTSVEKYGSYGAYGNYGNYGKK
>gnl|bykdb|A0A1X1HGI5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis subsp. oralis] (length=230 residues).
MPTLEIAQKKLDLARKAEEYYNALRTNIQLSGNNLKVISVTSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSQGLCETNVENLFVIQAGSVSPNPTALLQSENFATMIDTLRKYFDYIVVDTAPIGVVI
DAAIITQKCDASVLVTAAGETNRRDVQKAKEQLEQTGKPFLGIVLNKLNTSVEKYGSYGAYGNYGNYGKK
>gnl|bykdb|A0A1X1HKE3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis subsp. oralis] (length=230 residues).
MPTLEIVQKKLDLARKAEEYYNALRTNIQLSGNNLKVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSQGLCDTNVENLFVIQAGSISPNPTALLQSENFATMLDTLRKYFDYIIVDTAPIGVVI
DAAIVTQKCDASVLVTAAGETNRRDVQKAKEQLEQTGKPFLGIVLNKLNTSVEKYGSYGAYGNYGNYGKK
>gnl|bykdb|A0A1X1HXW4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis subsp. oralis] (length=230 residues).
MPTLEIAHKKLDQARKAEEYYNALRTNIQLSGNNLQVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSQGLCETNVENLFVIQAGSVSPNPTALLQSENFATMIDTLRKYFDYIVVDTAPIGVVI
DAAIITQQCDASVLVTAAGETNRRDVQKAKEQLEQTSKPFLGVVLNKFNTSVEKYGSYGAYGNYGNYGKK
>gnl|bykdb|A0A1X1IIT3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis subsp. oralis] (length=230 residues).
MPTLEIAHKKLDQARKAEEYYNALRTNIQLSGNNLKVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEYLSGTTDLSQGLCETNVENLFVIQAGSVSPNPTALLQSENFATMIDTLHKYFDYIIVDTAPIGVVI
DAAIITQKCDASVLVTAAGETNRRDVQKAKEQLEQTSKPFLGVVLNKFNTSVEKYGSYGAYGNYGNYGKK
>gnl|bykdb|A0A1X1IYZ6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis subsp. dentisani] (length=227 residues).
MPTLEISQAKLDLVKKAEEYYNALCTNLQLSGDDLKVFSITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDGDIRNSVMS
GVFKARDKITGLTEFLSGTTDLSRGLCDTNIENLFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGVVI
DAAIITRKCDASILVAAADETNRRDIQKAKEQLEHTGKPFLGVVLNKFDTSVDKYNSYGSYGNYGKE
>gnl|bykdb|A0A1X1IZF1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis subsp. dentisani] (length=227 residues).
MPTLEITQKKLELVKKAEEYYNALRTNIQLSGDNLKVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFRSSEKITGLTEFLSGTTDLSQGLCDTNVENLFVIQAGSISPNPTALLQSENFRTMLDTLRKYFDYIIVDTAPVGIVI
DAVIVTQKCDASVLITAVGEAHRKDVQKAKEQLEQTGKPFLGVVLNKLNTSIEKYSSYGVYGNYGKK
>gnl|bykdb|A0A1X1J021 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis subsp. dentisani] (length=227 residues).
MPTLEISQAKLDLVKKAEEYYNALCTNLQLSGDDLKVFSITSVKPGEGKSTTSTNIAGAFARAGYKTLLIDGDIRNSVMS
GVFKARDKITGLTEFLSGTTDLSQGLCDTNIENLFVIQAGSASPNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGVVI
DAAIITRKCDASILVTAAGETNRRDIQKAKEQLEHTEKPFLGVVLNKFDTSVDKYGSYGNYGDYGKK
>gnl|bykdb|A0A1X1JCL8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis subsp. dentisani] (length=227 residues).
MPTLEISQAKLDLVKKAEEYYNALCTNLQLSGDDLKVFSITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDGDIRNSVMS
GVFKARDKITGLTEFLSGTTDLSQGLCDTNIENLFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGVVI
DAAIITRKCDASILVTAAGETNRRDIQKAKEQLEQTGKPFLGVVLNKFDTSVDKYGSYGNYGDYGKK
>gnl|bykdb|A0A1X1JDK8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis subsp. dentisani] (length=227 residues).
MPTLEISQAKLDLVKKAEEYYNALCTNLQLSGDDLKVFSITSVKPGEGKSTTSTNIAYAFARAGYKTLLIDGDIRNSVMS
GVFKARDKITGLTEFLSGTTDLSQGLCDTNIENLFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIVVDTAPVGAVI
DAAIITRKCDASILVTAAGETNRRDIQKAKEQLEQTGKPFLGVVLNKFDTSVDKYGSYGSYGNYGKE
>gnl|bykdb|A0A1X1JHK4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus mitis] (length=234 residues).
MPTLEISKKRLDFAKKAEEHYNALRTNIQLSGDNLKVLAISSVKPGEGKSTTSTNIAWAFARAGYKTLLVDADIRNSVMS
GVFKSREKITGLTDFLAGTTDLSNGLCDTNIDNLFVIQAGPISPNPTALLQSENFHTMIDTLRKYFDYVIVDTAPIGMVI
DAAIITQKCDASILVTAAGETKRRDILKAKEQLEQTGTPFLGVVLNKFNTEVEKYGAYGGYGAYGSYGNYGKKK
>gnl|bykdb|A0A1X1JYW4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus mitis] (length=234 residues).
MPTLEIALKRINFIKKAEEYYNALRTNIQLSGDNLKVLAISSVKPGEGKSTTSTNIAWSFARAGYKTLLVDADVRNSVMS
GIFKSREKITGLTDYLSGSTDLSQGLCDTNVENLFVIQAGPVSPNPTALLQSDNFNNMIDTLRKYFDYIIVDTAPIGIVI
DAAIITQKCDASILVTAAGETKRRDVLKAKEQLEQTGTPFLGVVLNKFNTEVEKYGAYGGYGAYGSYGNYGKKK
>gnl|bykdb|A0A1X1K064 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus mitis] (length=217 residues).
MHIEVIHNSKSIVAESFRTLRSNLQFSEFGKNIKIIVVTSANPNEGKSEVSINLAASLAQQGKSVIIIDADMRKPTQHKL
TELNNTEGLSTFLLKKSGVDSINHLTINDVNLDVLTSGPVPPNPSEMLASSSMDETLKAFEDFYDYVIIDTPPLLAATDA
QVLASISDATLLVVDIKKSKRRQIIEAKRRLDHVGARLLGVIMNKMDSHKDTYYYYY
>gnl|bykdb|A0A1X1K7E9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus mitis] (length=234 residues).
MPTLEIAQKKLDLAKKAEEYYNALRTNIQLSGNNLQVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLVDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSHGLCDTNVENLFVVQAGSISPNPTALLQSENFSTMIDTLRKYFDYIIVDTAPIGIVI
DAAIITQKCDASVLVTAVGEVNRKDVQKAKGQLEQTNKPFLGVVLNKFNTSAEKYGSYGEYGSYGKKIRDRLRK
>gnl|bykdb|A0A1X1KFJ5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus mitis] (length=227 residues).
MPTLEIAQKKLDLAKKAEEYYNALRTNIQLSGNNLQVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLVDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSHGLCDTNVENLFVVQAGSISPNPTALLQSENFSTMIDTLSKYFDYIIVDTAPIGIVI
DAAIITQKCDASVLVTAAGEANRKDVLKAKGQLEQTNKPFLGVVLNKFNTSAEKYGSYGEYGSYGKK
>gnl|bykdb|A0A1X1KJ82 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus mitis] (length=233 residues).
MPTLEIAQKHLVFAKKAEEHYNALRTNIQLSGDDLKVLAISSVKPGEGKSTTSTNIAWALARAGYKTLLVDADIRNSVMS
GVFKSREKITGLTDFLAGTADLSHGLCDTNVENLFVIQAGSVSPNPTALLQSENFHTMIDTLRKYFDYVIVDTAPIGMVI
DATIITQKCDASILVTAAGETKRRDVLKAKEQLEQTGIPCLGVVLNKFNTEVEKYGAYGAYGVYGSYGAYGKK
>gnl|bykdb|A0A1X1KNJ7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus mitis] (length=227 residues).
MPTLEIAQKKLDLAKKAEEYYNALRTNIQLSGNNLQVISITSVKPGEGKSTTATNIAWAFARAGYKTLLVDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSHGLCDTNVENLFVVQAGSISPNPTALLQSENFSTMIDTLRKYFDYIIVDTAPIGIVI
DAAIITQKCDASVLVTAAGEANRKDVLKAKDQLEQTNKPFLGVVLNKFNTSAEKYGSYGEYGSYGKK
>gnl|bykdb|A0A1X1KRX4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus mitis] (length=234 residues).
MPILEIGQKRLDFAKKAEEHYNALRTNIQLSGDNLKVLAISSVKPGEGKSTTSTNIAWAFARAGYKTLLVDADIRNSVMS
GVFKSREKITGLTDFLAGTTDLSHGLCDTNVENLFVIQAGPVSPNPTALLQGENFHNMIDTLRKYFDYVIVDTAPIGMVI
DAAIITQKCDASILVTAAGETKRRDIIKAKEQLEQTGVPFLGVVLNKFNIEVEKYGVYGGYGAYGSYGNYGKKK
>gnl|bykdb|A0A1X1L400 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus mitis] (length=227 residues).
MPTLEIAQKKLDLAKKAEEYYNALRTNIQLSGNNLQVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLVDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSHGLCDTNVENLFVVQAGSISPNPTALLQSENFSTMIDTLRKYFDYIIVDTAPIGIVI
DAAIITQKCDASVLVTAVGEVNRKDVQKAKGQLEQTNKPFLGVVLNKFNTSAEKYGSYGEYGSYGKK
>gnl|bykdb|A0A1X1L8Y3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus mitis] (length=217 residues).
MHIEVIHNSKSIVAESFRTLRSNLQFSEFGKNIKIIVVTSANPNEGKSEVSINLAASLAQQGKSVIIIDADMRKPTQHKL
TELNNTEGLSTFLLKQSGVDSINHLTINDVNLDVLTSGPVPPNPSEMLASSSMDETLKAFEDFYDYVIIDTPPLLAATDA
QILASIADATLLVVDIKKSKRRQITEAKRRLDHVGARLLGVIMNKIDSHKDTYYYYY
>gnl|bykdb|A0A1X2JJD3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paraclostridium bifermentans] (length=237 residues).
MINITAFNDPKSPIAEAYRSIRTNIQFSRVDNEMKTIVVTSSKQDEGKTTVTSNLAVSFASLEGKRVLLIDADLRNPSVH
KMFSKPNALGLTDVLAGKKELKQCVQNTELENLQILTAGTIPPNPGEMLESKKMREFIDVLRDYYDYIFIDTPPIGIIMD
AGVLANYADGTILVVGAKDVETERAKISKERLEKVKANVIGAVLNKYIEKNGSYGYYSYYYEQSDGSRVSKKKKKKR
>gnl|bykdb|A0A1X3MLQ9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus toyonensis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLSFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSEATEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A1X4JDT5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus faecium] (length=232 residues).
MARTQKQKAAQTHAVSLITLTNPSSPIAEQYRTIRTNIQFASAAGQQIKTIVVTSSGPGEGKSTTSANIAVVFAKSGQRV
LLVDADLRKPVVYKAFQLNNTSGLSTALSSSGSVADVIQRTPVENLSILPSGPKPPNPSELLSSPRMDQILAEARQLFDV
VIFDMPPVVAVTDAQIMSSKTDGTLLVVRENTSRKESLSKAKELLEMVQARVLGVVYNGAEHSKDAGYYYGN
>gnl|bykdb|A0A1X6MC95 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anoxybacillus ayderensis] (length=220 residues).
MRSLITKTNPKSPISEQYRTIRTNIQFSVVDRPLRSIMVTSSAPAEGKSTTVANLAVVFAQQGKKVLLLDADLRKPTVHY
TFRKNNYIGLTNILTKQSSLQIAVRETDVENLFVLTSGPIPPNPAELLGSAAMEDLLAEAYEQFDIVLFDTPPVLAVTDA
QILANQCDGVVLVVHSGKTEIEAAQKAKELLLAAKGKLLGVVLNQKKQKESNYYYYYGNK
>gnl|bykdb|A0A1X6QE35 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus mycoides] (length=229 residues).
MVLKKKILRARRQLIAYEQPKSSVSEQYRNIRTNIEFASVDKKIRSLIVTSANQSEGKTTTAANIAIVFAQQGKKVLLID
ADLRRPALHQMMQVDNIFGLTNVLTRSKTLETCVTQTKIGNLTFLPCGPIPPNPAELLGASSMKDLLSEAYGTYDLVIFD
TSPILPVTDAQIMANQCDASVLVIRSGATEKEAALKAKQSLDSAKGTLLGVVLNDKEQNGSEYYYYGSN
>gnl|bykdb|A0A1X6WLN1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Vagococcus fluvialis bH819] (length=233 residues).
MAKTNDKRKTLINPEAVTLFTVVDPLSTVAEQYRTIRTNLLYSNAESRTQSIIVTSSGPSEGKSTTAANLAVIFAQSGIK
TLLVDADLRKPTVHRTFDIDNTKGLASLLSVRRMSLGEVIQNSDIRNLDLLPCGPVSPNPSELLSSARMRKVVHILKSQY
DFIIFDVPPISTVTDGQLIASQVDGSLLVVREGLTDKAGLDRAVKLLERVDSKILGAVYTGDTGHQDYSYYYS
>gnl|bykdb|A0A1X7D940 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus filamentosus] (length=232 residues).
MARRDKDKVLQLENRDLISLTNPKSPIAEQFRTIRTNIEFSNIDADLRTIVVTSSSPAEGKSTITANLAVVFAQQGKRVL
VIDSDLRKPTTHYTFQIENHIGLSNVLTKQTTLEGTVQTTNQENLWALTSGPIPPNPSELLGSRSMISLLEKAKREYDII
ILDSPPVLAVTDAQILSNLTDGVVLVVSSGKTQINSAKKTKELLESAKAKILGVVLNNKKVQKNQYYYYGGE
>gnl|bykdb|A0A1X7EYG0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus filamentosus] (length=232 residues).
MLKRKKANLQQTTKRSLVAHTKPKAPIAEQYRTIRTNIEFSSVDQNIRSLMITSASPSEGKSTTTANLATVFAQQGKRVL
LIDADLRKPTAHYTFRAENFKGLTTVLSRKSTLADAIQTTEVANLDFLSSGPIPPNPSELISSQMMKNMLEEAYENYDFI
IFDTPPILSVTDAQILANQCDATILVVKSGSTVIDTALKAKDLLQNAKGKLLGVVLNEKKVNIGEYYYYGQS
>gnl|bykdb|A0A1X7N9W6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Carnobacterium iners] (length=232 residues).
MFKKTTKKTTVERPSLITLTRPSSVIAEQFRTIRTNIQFSMVDNELRTLVVTSAAPGAGKSTVSANLAVTMAMQGKRVLL
VDADMRKPTVHKTFELPNQNGLTTLLTEKNIEIKEIAHRMPTEGLYVITSGAIPPNPSELLASNRMTALIKELEEVFDLI
IFDTPPVIAVTDAQVMAARVDGTLFVIDKGVANKEMVKKSKELLDIVKANVIGVIFNRVELSSDNYYHYYGE
>gnl|bykdb|A0A1X7QKE2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus curvatus] (length=247 residues).
MGLFKKEKSLDQASMKEGVGLITLTEPTSVIAEQFRTVRTNIQFSSIDQKLRSVVFTSAGPSQGKSTVSANVAVTWADQG
VDVLLVDADMRRPTVHQTFQVPNKRGLTSLLTDETFDLTNTIQKTPVDHLFVLPCGVVPPNPSELLNTKKMDKLIQELTK
HFDLVIFDVSPVISVTDAQILASKVDGTILVVPQGIVEKGSVAKAKELLEVVNARILGTIMNRVKAENTGGYYGGYYGGY
YGAEETK
>gnl|bykdb|A0A1X8V8Z2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus reuteri] (length=248 residues).
MSLFHRTQQQSTDTMDNGAKLITVAHPKSPISEQFRTIRTNINFMAIDKPIKTLAMTSANVSEGKSTVTDNIAVVWAQTG
QRVLLIDSDLRRPTLHATFNKSNQHGLTTILTSGTNSVDLREIIQPSGVDNLDILTAGPIPPNPAELLNSQRMKTLLDTV
KGIYDMVIVDVPPMLEVTDTQILSRHLDAVVLVVKQGQTQKLAVKRAVELLNLAHANLLGYVMNDVNADGDAAYGYGYGY
GYSEDTNK
>gnl|bykdb|A0A1X9MG76 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus krulwichiae] (length=233 residues).
MARKDKKLTLKNQRNLITDISKSSPISEQYRTIRSNIAFSAVDREIKTILVTSAGPGEGKSTTAANLAVVMAQTGQSVLM
IDADMRKPTAHYTFSTPNLTGLTNVLTKQSSLEQAIQETKIENLSLLTCGPIPPNPAELLNSRMMGLILERAQEMFDVII
LDSPPVMAVTDAQILSSKCDGTVLVVSSGKTEREGVKKAKELLQKANAHILGAVLNNKEIEAGNYYYYYSNQK
>gnl|bykdb|A0A1X9VSG8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Leuconostoc mesenteroides subsp. mesenteroides] (length=259 residues).
MSFFNKRRAVGKDGLSVETMTKSARLITAAEPKNPVSEQFRTLRTNIEFASVAKGEIKTLLISSALPSEGKSTVTANLAI
AYAQQGKNVLLIDADLRRPTVAVTFGLNKNASGLTNYLVDSEKEVGSIIHRTAMDNLNVMPSGPIPPNPAELLGSGRMTN
LITQLKTHYDMIIFDVPPFLMVTDAQVLMSKMDGVAIVVNGGKTNRGAIQRTHEILKMSEAPVLGFIYNDQSRKKKGSTG
YGYGYGYGYGYDYGETKSK
>gnl|bykdb|A0A1Y0CSK4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus horikoshii] (length=235 residues).
MGLRKKQKSTAKATASRHLISDKLPKSPISEQYRTIRTNIQFSSVDQQLRSIMITSSGPSEGKSTTASNLAVVNAQQGKK
VLFVDSDLRKPTAHYTFQQENFRGLTTVLTRQSALLDTIQPTRIEYLDILTSGPIPPNPAELLSSRAMEELLAEAYRIYD
LVVFDTPPVLAVTDAQILANQCDGTILVVASGSTDKDSAIKAKDLLNSAKAKLLGVVLNMKKQNESSYYYYYGGK
>gnl|bykdb|A0A1Y0DZG1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus rhamnosus] (length=251 residues).
MQLSFSKLFHRHQEDQETQKNGVMLVAFAEPKHVVSEQFRTVRTNIEFAGAALDRCQVVMFTSSAMSEGKSTVSANVAVT
WAQAGKKVLLIDADLRRPTIHATFRTLNIDGVTTILIGKDEAGAVVEETFVDNLSVITSGPIPPNPSELLNSKRMANLLN
WARENYDIIVLDTPPVLAVSDVQVLVPKTDGVVVVANMGKTLKGDLRRTVEVLKLANAKILGSVERVKAKHGDRGYGYGY
GYGYGTNTGKK
>gnl|bykdb|A0A1Y0TUW7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTNSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A1Y0VPQ2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pediococcus pentosaceus] (length=243 residues).
MFKKKQKLDNESLKNGVGLVTFTDPTSTIAEQFRTVRTNIQFSSVDKALKSIVFTSSAPSEGKSTVSNNVAVTWADQGKR
VLIVDADMRRPTVHRTFSVSNAVGLSNLLAETGSLENAIHETIINNLSVMPSGPIPPNPSELLGSTKMAALLEQLTDHYD
LVIIDAPPVNTVTDAQVLAARADGTILVVPQGIADKAGVRHAKQLLEAVQANILGAILNRATAEKSTGYYGGYYGGYYGT
DDK
>gnl|bykdb|A0A1Y0XCU3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus amyloliquefaciens] (length=226 residues).
MGFRKKKSRRGLAQISVLHHKSLVAEQYRTIRTNIEFSSVQTHLRSILVTSSVPGEGKSFSAANLAAVFAQQEKKVLLVD
ADLRKPTIHETYQLENVQGLTNVLVGNASLGETVQKTLIDNLYVLTSGPTPPNPAELLSSKAMGELIQEMYSRYSLVIFD
SPPLLAVADGQVLANQTDGSVLVVLSGKTKMDTVQKAKDALQQSKAKLLGALLNKKKIKKTEHYSY
>gnl|bykdb|A0A1Y0XKH7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus amyloliquefaciens] (length=229 residues).
MLTRKKDKFAKRSVITMSEPKSINSEQYRTIRTNIEFSSVDTEVKSLLITSAGPEEGKSTTAANLAVVFAQQGKKVLLID
ADLRKPTVHFTFKLDNGTGLTSLLLKQIPFQKAVLPADEANLDILTSGPIPPNPAELLSTDAMKDLLSEATDVYDKVILD
TPPVLAVADTKILGSYTDGAIMVISSGKTDKEKAAKAKEALDYCPCKLLGAVMNGKRQTKHSDYAYYGQ
>gnl|bykdb|A0A1Y2UPZ3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus reuteri] (length=245 residues).
MSLFKRKQQHSTDTMDNGAKLITVAHPKSPISEQFRTIRTNINFMAIDKPIRTLAMTSANMGEGKSTVTDNVAVVWAQTG
QKVLLIDSDLRRPTLHATFNKSNQHGLTTILTSGTNSVDLREIIQSSGVENLDILTSGPIPPNPAELLNSQRMKTLLETV
KGIYDMVILDVPPMLEVTDTQILSRHLDAVVLVVKQGQTQKLAVKRAVELLNLAHANLLGYVMNDVNAESGAGYGYGYGY
GYGYK
>gnl|bykdb|A0A1Y2V9Q8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus reuteri] (length=248 residues).
MSLFHRTQQQSTDTMDNGDKLITVAHPKSPISEQFRTIRTNINFMAIDKPIKSLALTSANVSEGKSTVTDNVAVVWAQTG
QKVLLIDSDLRRPTLHTTFNKSNQHGLTTILTSGTNSVDLREIIQPSGVDNLDILTAGPIPPNPAELLNSQRMKTLLDTV
KGIYDMVIVDVPPMLEVTDTQILSRHLDAVVLVVKQGQTQKLAVKRAVELLNLAHANLLGYVMNDVNANGDAAYGYGYGY
GYGEDTSK
>gnl|bykdb|A0A1Y3HMV7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus faecium] (length=235 residues).
MARTQKQKAAQTHAVSLITLTNPSSPIAEQYRTIRTNIQFASAAGQQIKTIVVTSSGPGEGKSTTAANIAVVFAKSGQRV
LLVDADLRKPVVYKTFQLNNASGLSTALSSSGNVADEIQRTPVENLSILPSGPKPPNPSELLSSPRMDQILAEARQLFDV
VIFDMPPVVAVTDAQIMSSKTDGTLLVVRENTSRKESLTKAKELLEMVQARVLGVVYNGAEHSKDAGYYYTEIKE
>gnl|bykdb|A0A1Y3ID30 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus faecium] (length=232 residues).
MARTQKQKAAQTHAVSLITLTNPSSPIAEQYRTIRTNIQFASAAGQQIKTIVVTSSGPGEGKSTTAANIAVVFAKSGQRV
LLVDADLRKPVVYKTFQLNNASGLSTALSSSGSVADVIQRTPVENLSILPSGPKPPNPSELLSSPRMDQILSEARQLFDV
VIFDMPPVVAVTDAQIMSLKTDGTLLVVRENMSRKESLTKAKELLEMVQARVLGVVYNGAEHSKDAGYYYGN
>gnl|bykdb|A0A1Y3MHT0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus pseudomycoides] (length=229 residues).
MVLKKKASRARRQLIAYEQPKSSISEQYRNVRTNIEFASVDKKIRSLIVTSANSSEGKTTTAANIAIVFAQQGKKVLLID
ADLRKPALHQMLQVENVFGLTSVLTRSKTLETCVENTNIRNLNFLPCGPIPPNPAELLGSNSMKDLLSGAYGMYDLVIFD
TSPILPVTDAQVMANQCDASVLVVRSGVTEKDTAIKAKQALDGAKGILLGVILNDKEQTGSEYYYYSSN
>gnl|bykdb|A0A1Y3QB58 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Thermobacillus sp. ZCTH02-B1] (length=225 residues).
MPRSNKEAPTLPIDDVSPFMEAYRTLKANIEFASRRKPIRSVAIASATPGEGKSTTALYLASAYARAGQTVVLIDGDIRK
PTLHQVIDRRRSPGLSDYLLDPGMMPSYVLKDTFIGAAFISAGRSVPNPSDLLASERMTELIALLKQAYDMVIVDTPPIL
AAIDAKILAAKCDGVLLVLESGKAREKAVLKAKEELLLANANLLGAVLNKTSRKSNPYYYEGYGK
>gnl|bykdb|A0A1Y3RNS2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Flavonifractor sp. An91] (length=288 residues).
MMISVKKKKGGAHVSKRTKKRSTESISILEERKHLLTQKDDFFTQEAYKTLRSNIIFSLTGEEGNKIIQVTSAMMSEGKS
ITSVNLAISFAQTDRKVLLIDCDLRRPKLASLLSLGANVGLSNVLVDHTLLEQAILPTKVPNLSVMTSGEIPPNPSELLG
SKRMTALLEELRQVYHYVILDTPPVNMVTDAVVLASRSDGVLIVVRAGHSEKGSVQDAVEQLEYAKVKILGYVLNGVDSE
RGGYGSGKYRRYKKYKGYGYGYGYGYGYGYSSPPSSREPEPEERGKTE
>gnl|bykdb|A0A1Y3S3Y3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Gemmiger sp. An87] (length=247 residues).
MAFKLPAFGKKKRKDQPSNRKLQIISKDAPFQYVEAYKTLRTNINFMAASNNYRRLVITSSIPGEGKSNVAINLAISLAE
NGKKVLIIDCDLRKPVMHKYLRITRRASGLTNVLSGEATPADVIVHFSDLNIDVITAGVIPPNPAELLGSARMAKMLDGL
SEQYDYIIMDTPPASVVTDAAVLSALADGVIFVVSHANATIESAQLAKKNLEAANANVIGAVLNGFDLKSTTRDTGYYYS
YEYGYYK
>gnl|bykdb|A0A1Y3SD34 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Flavonifractor sp. An82] (length=284 residues).
MMISIKKKKGGAHVSKRTQRRNTESLSILEERKHLLTQKDDFFTQEAYKTLRSNVIFSLTGEEGNKIIQVTSAMMCEGKS
ITSVNLAISFAQTDRKVLLIDCDLRRPKLASLLSMGANVGLSNVLVDHTLLEQAILPTKVPNLSVMTSGEIPPNPSELLG
SKRMTALLEELRQVYHYIILDTPPVNMVTDAVVLAPMSDGVLFVVRARHSDKGSVREATEQLEYAKVKILGYVLNGVDPE
RGGYGSGKYRKYKKYKGYGYGYGYGYGYSSPPSNPDPKEKGKTE
>gnl|bykdb|A0A1Y3SH70 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pseudoflavonifractor sp. An85] (length=237 residues).
MKTLTLNNLNTLPYATEEALNRLRINFNFCGDRFKKILITSSVPGEGKSFISTNLWRMLGESGRNVVLVDADIRKSMMRT
RYRMSSNGGDFVGLSHYLAGSASLDDVVYATNLPGAYLLPTAHTVFNPSILLQNGRVEEMLDALAQRFDHVLVDTPPLTN
VADGELIASFCDGALLVVHGGGTPRSLVSNSLKLLDRAGCELMGVVLNRVKEDGNPYYQKYTKYGYYYEDNDGSRKK
>gnl|bykdb|A0A1Y3TD21 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lachnoclostridium sp. An76] (length=228 residues).
MTERRVIMTDPKQNDYFYEEAIKTLRTNIQFTGTEVKSIVITSCYPNEGKSDVVFQLALEIGKMGKKVLVLDADIRKSSY
ISRFQVKQKTAGLSQYLSGQSGLQDIVYSTNFRDVDIIFAGPSAPNPSELLAQESFASLVHTMRGKYDYVLVDTPPVGSL
TDAAVVARQCDGAILVVESDLVSRRVALKVKQQLEMSGCHILGAVLNKVDIKKNKYYSKYSYYYGEEK
>gnl|bykdb|A0A1Y3TMW0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Faecalibacterium sp. An77] (length=259 residues).
MRELEIKKVPELPFDVTEALNQLRINLGFCGKQIKTIMVTSSVPNEGKSFITLQLWKMMAEVGAPVLLLDCDFRNSEMRR
KYSISSTNNEKLIGAAHYLAGQAEIQDVIYKTNIPNGYMIPVTSAIANPTILLESPNFAKMLEYCEQHFSYILVDTPPLG
SVADALNITRHCDGSVLVVRSGDTSRKIVENSVQMLKRTETPLLGVVLNRVDVNNRSSAYYHRYYHSSYYYKNGYQYGSH
GHGYGRGHSRDKKDDNGGK
>gnl|bykdb|A0A1Y3TR22 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Faecalibacterium sp. An77] (length=254 residues).
MVPTKGSDMKELKIHSMPELPFAAAEALNQLRINLGFCGDGIRTVMMTSSVPNEGKSFLTIQLWRQMALVGTPVLLIDCD
FRNSEMRRKYGIRSASQEKLLSAAHYLAGKAEIQDVIYKTNIPNAYMIPVASTIANPTILLESPQFARMVEYCAQRFAYI
LIDTPPLCSVADGLNIARHCDGSVLVVRSGSTPRKLVEHSAQLLKRTETPLLGMVLNRADTGSRASAYYQRYYGSSDYGY
GRGHSHNKSPNGGT
>gnl|bykdb|A0A1Y3W583 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Faecalibacterium sp. An58] (length=255 residues).
MKELEINKLPQLPFDVTEALNQLRINLSFCGDQIKVIMVTSSVPNEGKSFITMQLWKMMAEVGTPALLIDCDFRNSEMRR
KYSIRSVRNEKLLGAPHYLAGKAELDEVIYKTNIPNGFMIPVTSAIANPTILLESPNFTKMLDYCSERFPYVLVDTPPLG
SVADALNIARHCDGSVLVVRSGDTPRKVVENSVQLLRRAESPLLGIVLNRADVNNRSSAYYHRYYHSNYYYKGYRGGYGY
GHGSAHDKSNSNGGK
>gnl|bykdb|A0A1Y3WEB6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Drancourtella sp. An57] (length=230 residues).
MKEISLNLKSMQDYRINESYKQLRTNIEFSGEENKIIAITSCAPSEGKSTVSLSTAYSLAEAGKKVLFIDADLRKSVLAG
RYKVTGEMKGLTHFLSGQGDLSEILCKTNEKGLFVIFAGPVPPNPAELLGSKKFAALLKEARNIYDYIIIDTPPLGSVID
SAIVSAACDAAILVISANTVSYKFARSVKDQLIKTGCNILGVVLNKVSMKQNKYYGKYYGKYYGHYGSDN
>gnl|bykdb|A0A1Y3WN00 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Faecalibacterium sp. An58] (length=248 residues).
MEERPVMKTLVIDQMPQLPFQVSEAINQLRINLGFCGSQIKTIMITSSVPNEGKSFLTIQLWKRMAEVGTPVLLLDCDFR
NSEMRRKYGIRSTDGGKLLGAAHCLAGQAQLEDVIYSTNIPQGYMIPVASTIANPTILLESPRFARMLEDCAGRFGCVLV
DTPPLGSVADGLNIARYCDGSVLVVRCGSTPRRLVHNSVQLLGRTGKPLLGVALNRANAGGGAGGYYYRYYGGSYDHTHD
TNGKEGGK
>gnl|bykdb|A0A1Y3X4Z2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Flavonifractor sp. An52] (length=288 residues).
MMISVKKKKGGAHVSKRTQKRNTENISILEERKHLLTQKDDFFTQEAYKTLRSNIIFSLTGEEGNKIIQVTSAMMSEGKS
ITSVNLAISFAQTDRKVLIIDCDLRRPKLASLLSLGANVGLSNVLVDHTLLEQAILPTKVPNLSVMTSGEIPPNPSELLG
SKRMTALLEELRQVYHYVILDTPPVNMVTDAVVLASRSDGVLIVVRAGHSEKGSVQDAVEQLEYAKVKILGYVLNGVDSE
RGGYGSGKYRRYKKYKGYGYGYGYGYGYGYSSPPSSREPEPEERGKTE
>gnl|bykdb|A0A1Y3XU65 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Gemmiger sp. An50] (length=248 residues).
MAFKLPAFGKKKRKDQPINRKLQIISKNAPFQYVEAYKTLRTNINFMAASNNYRRLVITSSIPGEGKSNVAINLAISLAE
NGKKVLIIDCDLRKPVMHKYLRITRRASGLTNVLSGEATPADVIVHFSDLNIDVITAGVIPPNPAELLGSARMAKMLDGL
SEQYDYIIMDTPPASVVTDAAVLSALADGVIFVVSHANATIESAQLAKKNLEAANANVIGAVLNGFDLKSTTRDTGYYYS
YEYGYYKQ
>gnl|bykdb|A0A1Y3Y4F4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia sp. An46] (length=230 residues).
MELKVTLKDPKKSDYFYEESIKTLRTNIQFSSKQVKVVLLTSCYPNEGKSDIAFSLSLEMGKAGKRVLLVDADIRKSNFI
KRYSVNQTIHGLSQYLSGQVERQWITYQTNFPNVDMIFAGPLAPNPSELLGDPAFGELLEEKRKEYDYIFIDTPPIGNMI
DAAIVAEKSDGAVLVIESEAVSYSVAQKSLAQLERSGCKILGAVLNKVDMKKDKYYSSYYGRYGGYYKHK
>gnl|bykdb|A0A1Y3Y813 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pseudoflavonifractor sp. An44] (length=479 residues).
MKRTENWLEEVSMRGLCVDLLRNLWMIVLAAITMWCASTGLHNLTYQPTYTSSATLVIGVKGDSSIYSSLSLASQMAEVF
GQVFQSDALRERIATDVGADVQGEISCSLVTQTNLLVVKATSARPRQAYVYLNSALEHYEGVSDQIFSNAELQIVQEPDV
PLAPSNTSWFLKYQGILMVVGAVGMAFLIALCYIARFTVKTAEAARIQLDGPIQGTIPFERRNMALGKKRNKKAFLLNSP
EVSMNFAEAMRNIGTRLERHLRHHGYQVLLVTSVAENEGKSTTAANLALALAEKQKRVLLVDADLRKPSQYKVFEVRRDD
TVSFSRVLEGEKDWKDIVGYSRKSGLWMLFQFLQAKDPGGALREGRMRELLTEWKKQMDYIIVDCAPISAAADAEIWMAA
VDSVLLVVREDWADVRYINDGVDVVRQNHTDFSGFILNAFHKEWSSKHYGYQYEKYGTYSNEDGAEDGGEGLKYGRNKT
>gnl|bykdb|A0A1Y3Y8X3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pseudoflavonifractor sp. An44] (length=486 residues).
MEEIKREIQGRYNDEEIDLLQLLLDMGKHFRHLWWLCVLLVLGSAALVTGALFVLRSPMYQSSASFTVATGEESGSYSFY
YDSGTADQLSMTFPYILESGYFRSVLLEHLGTNNLNGTITAETISGSNVVTMKVQSSSPQDAYAILTTAIEIYPEAAHFV
LGDISFSMLTQPQIPSEPYNRPSIGKSCLLGAGLGMLLSMAILLLLAIFRKNVCAKEEMRKITSMRCLAMLPRVHVKART
KKRTMQLSFLNPSLPHGYTESIRVLKNRVVKAMESKNQKVLLVTSTVSGEGKSVTAVNLAGQLAIDGARVLLVDGDLRKQ
QDGQLLNLTAEYGLMEACKESDMAAVWKGIERNSATLQESGLLFLGGGKVLNQPASLLNSSELKRCMQSLRAEVDYIIID
SPPCGMFQDTAILAEYVDSVLYLVGYDRLPASAIREGIHALGGQLATFLGYAFNSCPENRGGDGYGYGKYGYGRYGMYGY
SGRKER
>gnl|bykdb|A0A1Y3YCE1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pseudoflavonifractor sp. An44] (length=233 residues).
MKQLTINQLPQLPFDVAESVNQLRVNLGFCGKEIKAIMITSSTPDEGKSFVSVNLWQQMAHVGNRTLLIDCDLRNSEMRT
RYGIGGDDKVLGLVHYLAGQVELDDIIYQTDVSGGFIIPVATHIANPSLLLEGERFEKLMAYCRDYFDYVIVDTPPLMNV
ADGLNIATHCDGTVLVVRSGVTSRRLVENSIQMLQKTSTPLLGTVLNRVNTSRKAYRYYYKRYYNKYGYYGGK
>gnl|bykdb|A0A1Y3YJ29 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pseudoflavonifractor sp. An44] (length=480 residues).
MMEERELFRWDELSWYSVLRDLVINLWVVVLAGFTVWMGVDSVVQLRYVPAYTSYATMAVTAKGSDISIYSNLTATTQMA
EVIGEVFASNVLREKVVEELAVTEFDGEIKAEVIPETNMLTIQVTAPTAKQAHQGLWSAINHYDEVSNYLFTNADLMMLQ
PPSVPQTPSNTPNIRHIQKIASVGAAILVAAGCVLFTALRPTVQTMQGAQRNLNGSVLGDVPFERKWKSTKDIIRRRKKS
ILLNDPGVSMGFSASIRKIATRLELRMKHSGHKILLVTSVGENEGKSSVATNIALALKEKGRRVLLLDGDLRKPAIHKVL
QLPKEDAVCINDYLNDRCEGTNTVYYDEDSGLHVVQSGDQRVNDGVRGNATKICQLIQALSETMDYIIVDSAPMAVTSDT
EYLLQAVESVLFVVRQDWCGVDAINDKLEILRQNNVRIQGIVLNAVHPFGFGSRSRDRYYGYGRRTRGKKKLEAEHEREN
>gnl|bykdb|A0A1Y3ZXL8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Flavonifractor sp. An4] (length=288 residues).
MMISVKKKKGGAHVSKRTKKRSTESISILEERKHLLTQKDDFFTQEAYKTLRSNIIFSLTGEEGNKIIQVTSAMMSEGKS
ITSVNLAISFAQTDRKVLLIDCDLRRPKLASLLSLGANVGLSNVLVDHTLLEQAILPTKVPNLSVMTSGEIPPNPSELLG
SKRMTALLEELRQVYHYVILDTPPVNMVTDAVVLASRSDGVLIVVRAGHSEKGSVQDAVEQLEYAKVKILGYVLNGVDSE
RGGYGSGKYRRYKKYKGYGYGYGYGYGYGYSSPPSSREPEPEERGKTE
>gnl|bykdb|A0A1Y4B5T0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lachnoclostridium sp. An298] (length=481 residues).
MIMEKTTGQTLENYKIEPFTLIHDILVNWWVILLGALAAAMLTNVVMSVRYVPQYTTSTTFVVSARNTSASYSSLGTANS
MATSFQKVVESSAMQDILCEKLGADEISADIRVDIAGETNLLELKVTDDSPQDSFDIMEGILDNYSSVTLYTVGDIVLNI
LEQPNIPFAPDNSLDAGGMMKRAFLAAAAVLVLFLGGFSVMKDTLKTEEDISGKLDARSLGAIAWESKYKSVKEIFDRSK
KAVLINKPLAGFGFVESYRKFSSKVEYCMEKEGWRTLAVTSVSENEGKSTVAANLAISLAEKDYRVVLIDGDLRRPSQFL
IFGLHPQEENELGEFLKREKNKFELLMKTSVPKLYVIGGRNCYSSSTDILQSELTGKFLQRCRESADFIIVDTPPTAVLA
DAELWGQCTDAVLFVERQNYISAEGINTMIDKFRAQDTKVMGVVMNGVQSFSAIVGSTVGRYSGRYGEYGNYGKVHKESE
K
>gnl|bykdb|A0A1Y4B5T7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Eubacterium sp. An3] (length=240 residues).
MKQIDMNIRALPYAVEEAMNRLRVNIKFCGKNTKKILVISSVPNEGKSTVSVHLWKMLAEAGFPTVLVDLDLRKSVLKDR
LEFRSEGEIQGLDYYLSGLSEYQNVVYETNISNGYIVPVSNLLENPSALLEDPRMGELLDRLAEDYRYVIIDSPPLDSVA
DGALIASLCDGAILVVRSGMTSRRLVKQSVQQLERVRCRLLGMVLNRVETKSRAYQKYYGKYGNYYSDYYGGHTSEKGDS
>gnl|bykdb|A0A1Y4F2X3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia sp. An249] (length=485 residues).
MEEQREMEIDLGTLIWNFLRGLKKTWYLIPLLALLGGAFGYGKAAGFYVPMYQASASFTVLTGGTSEDTGSESYNFYYDS
STAGQMAKTFPYILGSNLLQEAILGALGVDALNGSISAKAVSDSNLITMTVTSSSPQDAKDILESAIKVYPDVARFVIGN
TRFNMIDMPSVSSVPYNQPNYTRTVQKWALVGAAGAVLLIALFALLRKTIQKPEEIKTIMSLPCLGNIPEVRFKARGKQN
HQEVSFFNSRIPQGFKESVMSLQVRLEREMGDRKAKVLLITSTVSSEGKSATALNLAYAFASHGKKVLLIDGDLRKQKLR
SMMTEKQGKGLESVIKGNVPLEEALEQEERSSIWMLCGDKPASRIPKILNHKKMKELIDSCRETMDLILIDAPPCDLFED
AGILSEYADCILYLIRHDFVTKRRVLEGVSALEEGNAQLLGYAFNRVPVHRGGYGYYGYGRYGYGYYGYGKYGYGKYGYG
EKKTQ
>gnl|bykdb|A0A1Y4FAY0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia sp. An249] (length=235 residues).
MNKVKVVRTALDYAADEAYKSLRTNLQFCGDDKKVIALTSCTQNEGKSNVAFHLGVSLAEAGKRILLVDADLRKSVLLGR
VQVQEEVKGMTHYLSKQAKLSEVVCVTDIPNFHIVFAGPVPPNPAELLGGRYFKEFVQTMRDIYDYILIDTPPLGSVIDC
AVVSECCDGVVLVIEAEAISYRFVQEVKRQLEKGNCPILGAVLNKVDISKEGYGKYGRYRKYGKYKRYGKYIRYE
>gnl|bykdb|A0A1Y4H2G0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerofilum sp. An201] (length=247 residues).
MNLWTSSAARTQPSVERIFRPADATAPFPYQEAYKTLRTNLKFMALGGDYRRILVTGAIQGEGKSSVSANLALVLAETEN
RVLLIDCDLRKPILHRYLRLQRRQGRGLLGALAGMPLENCIQHAARYNIDVMTVDFTPPNPTELLGSPKMKQLLEQLAAQ
YDYLILDAPPAAVVTDAAVLSQYSDGVLLVIRQRYATFQQVRRAVENLRQVNANILGAVLNSYRPEGPRAERELYTYYYS
EHPHRPE
>gnl|bykdb|A0A1Y4H8S9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerofilum sp. An201] (length=509 residues).
MSERYEREDSRPSSQPEKIDLLHIVADFLYGLKKLWVLLLVVVVACTLRSYFATSSSYTPSYVASATMSVTTVSGGGGYM
DSKSAEQMATVFPYVLTSGVLADVVADYMGLDALPGSVSVTAEEGTNLLTVSATSSDPQAAYDLLHAMIECYPQVGEFVF
GQTTLEILDETGVPTDTQKEVVIRGSYKRGAVQGLVLALVILCVYVLSHRTVQSTDQLKKQVNLSRLASITYVRGKKRKK
KNGAPLCILNSHVPETYLESIRKLRMRVAREMEEKGYKTLMVTSSVPGEGKTTIAANLAVALARQGKKVILVDCDARNPS
LAHVLGSTDEHPGLGQVLRGEAELDTALCDVSVDSSNVLRVLYGGKPSKADALLLGRTQMEELIGKLREQADIVILDTAP
AQLLADASLMARYVDAALYVVRYDYTKMKRIRAGIQALDVSGIHMLGYVFNSDQSAKGKRHSRGYDYGYGYGYGYGRYWR
YSHYSHYAQQDKLRETGKQQDGSGRVIKN
>gnl|bykdb|A0A1Y4H936 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Drancourtella sp. An210] (length=223 residues).
MREISLNLKSMQNFRVNESYKQLRTNIEFSGEENKAIAITSCVPSEGKSSVSLSIASSLAEAGKKVLFIDADLRKSVLAG
RNKIQGELKGLTHFLSGQGDLSEVLCKTTERGLFTIFAGPVPPNPAELLGGKKFSALLREARNVYDYIIIDTPPLGSVID
GAIVAAECDAAIMVVAANTVSYKFARSVKEQLAKTGCNLLGVVLNKVSAKKNKYYGNYYGEED
>gnl|bykdb|A0A1Y4HA63 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Drancourtella sp. An210] (length=501 residues).
MSDQILEKRAIEDGEMEIDLALLLKDFWRSFRRFWWAFFLLCAVTAGGFYLFWSWRYVPMYEAKATFTVATGDEDSGSYS
FYYDRNTADQLSKTFPYVLDSSFFKSTLMEALGTESLNGTITAETVSESNMVTMKVQSSSASDAKAILDTAIEIYPDTAR
FVLGDMEFHMIDNSVLPQEPYNYMAWWKRLGIGGLIGAVIGVVILGIIALLKKTARTPEEMKKITNLKCLAAVPLVKFKA
RNKTKENVLSATDTRVDYGFRESLRALQIRTERIMDRQDGQVIMVTSTVGGEGKSTLAVNLAKMFATKGKKVLLIDGDLR
RPTDHKILNIKSGANLVDIAEGKSKRECVRKMKNESLWFLGGNETASRPATVLSSEKVASFIQKMRNEMDYIIIDTPPCG
MFPDAGNIAELSDNILYVVKYDNVPIRKIGEGISFLTEHKARFLGYVFNAYPSSTRDYGYGRYGYGKYGYGKYGNKAYGY
KSKRTYGEETDKTEQEQMMDD
>gnl|bykdb|A0A1Y4J3S1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Faecalibacterium sp. An192] (length=254 residues).
MVPTKGSDMKELKIHSMPELPFAAAEALNQLRINLGFCGDGIRTVMMTSSVPNEGKSFLTIQLWRQMALVGTPVLLIDCD
FRNSEMRRKYGIRSANQEKLLSAAHYLAGKAEIQEVIYKTNIPNGYMIPVASTIANPTILLESPQFARMVEYCAQRFAYI
LIDTPPLCSVADGLNIARHCDGSVLVVRSGSTPRKLVEHSAQLLKRTETPLLGMVLNRADTGSRASAYYQRYYGSSDYGY
GRGHSHNKSPNGGT
>gnl|bykdb|A0A1Y4J5E7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Gemmiger sp. An194] (length=247 residues).
MAFKLPALGKKKRKDQPLNRKLQIISKSAPFQYVEAYKTLRTNINFMAASNNYRRLVITSSIPGEGKSNVAINLSISLAE
NGKKVLVIDCDLRKPVMHKYLRITRRASGLTNVLSGEATPADVIVHFSDLNIDVITAGVIPPNPAELLGSARMAKMLDSL
SEQYDYIIMDTPPASVVTDAAVLSALADGVIFVVSHANATIESAQLAKKNLEAANANIIGAVLNGFDLKSTTRDTGYYYS
YEYGYYK
>gnl|bykdb|A0A1Y4J5P1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Faecalibacterium sp. An192] (length=259 residues).
MKELEIKKLPELPFDVTEALNQLRINLGFCGEQIKTIMVTSSVPNEGKSFITMQLWKMMAEVGAPVLLIDCDFRKSEMRR
KYSISSVNNEKLIGAAHYLAGQAEIEDVIYKTNISNGYMIPVTSAIANPTILLESPNFTKMLEYCEQRFAYVLVDTPPLG
SVADALNITRHCDGSVLVIHSGSTPRKVVLDSVQMLKRAESPLLGVVLNRADVNGRSSAYYHRYYHSNYYYKNGYRYGSY
GYGSGHGHSRNKKENNGGK
>gnl|bykdb|A0A1Y4J8M8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Faecalibacterium sp. An192] (length=259 residues).
MRELEIKKVPELPFDVTEALNQLRINLGFCGKQIKTIMVTSSVPNEGKSFITLQLWKMMAEVGAPVLLLDCDFRNSEMRR
KYSISSTNNEKLIGAAHYLAGQAEIQDVIYKTNIPNGYMIPVTSAIANPTILLESPNFAKMLEYCEQHFSYILVDTPPLG
SVADALNITRHCDGSVLVVRSGDTSRKIVENSVQMLKRTETPLLGVVLNRVDVNNRSSAYYHRYYHSSYYYKNGYQYGSH
GHGYGRGHSRDKKDDNGGK
>gnl|bykdb|A0A1Y4KN75 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pseudoflavonifractor sp. An187] (length=486 residues).
MEEIKDEIQGRYDDEEIDLLQLLLDMGKHFRHLWWLCVLLVLGSAALVTGALFVLRSPMYQSSASFTVATGEESGSYSFY
YDSGTADQLSMTFPYILESGYFRSVLLEHLGTNNLNGTITAETISGSNVVTMKVQSSSPQDAYAILTTAIEIYPEAAHFV
LGDISFSMLTQPQIPSEPYNRPSIGKSCLLGAGLGMLLSMAILLLLAIFRKNVCAKEEMRKITSMRCLAMLPRVHVKART
KKRTMQLSFLNPSLPHGYTESIRVLKNRVVKAMESKNQKVLLVTSTVPGEGKSVTAVNLAGQLAIDGARVLLVDGDLRKQ
QDGQLLNLTAEYGLMEACKESDMAAVWKGIERNSATLQESGLLFLGGGKVLNQPASLLNSSELKRCMQSLRAEVDYIIID
SPPCGMFQDTAILAEYVDSVLYLVGYDRLPASAIREGIHALGGQLATFLGYAFNSCPENRGGDGYGYGKYGYGRYGMYGY
SGRNER
>gnl|bykdb|A0A1Y4KN82 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pseudoflavonifractor sp. An187] (length=233 residues).
MKQLTINQLPQLPFDVAESVNQLRVNLGFCGKEIKAIMITSSTPDEGKSFVSVNLWQQMAHVGNRTLLIDCDLRNSEMRT
RYGIGGDDKVLGLVHYLAGQVELEDVIYQTDVSGGFIIPVATHIANPSLLLEGERFEKLMAYCWDNFDYIVVDTPPIMNV
ADSLNIATHCDGTVLVVRSGVTSRRLVENSIQMLQKTSTPLLGTVLNRVNTNRKAYRYYYKRYYNKYGYYGGK
>gnl|bykdb|A0A1Y4KWZ2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pseudoflavonifractor sp. An187] (length=479 residues).
MRQTENWMSKVSMRGLCVDLLRNLWMIVLAAITMWCASTGLHNLTYQPTYTSSATLVIGVKGDSSIYSSLSLASQMAEVF
GQVFQSDALRERIATDVGADVQGEISCSLVTQTNLLVVKATSARPRQAYVYLNSALEHYEGVSDQIFSNAELQIVQEPDV
PLAPSNTSWFLKYQGILMVVGAVGMAFLIALCYIARFTVKTAEAARIQLDGPIQGTIPFERRNMALGKKRNKKAFLLNSP
EVSMNFAEAMRNIGTRLERHLRHHGYQVLLVTSVAENEGKSTTAANLALALAEKQKRVLLVDADLRKPSQYKVFEVRRDD
TVSFSRVLEGEKDWKDIVGYSRKSGLWMLFQFLQAKDPGGALREGRMRELLTEWKKQMDYIIVDCAPISAAADAEIWMAA
VDSVLLVVREDWADVRYINDGVDVVRQNHTDFSGFILNAFHKEWSSKHYGYQYEKYGTYSNGDMAEDGGEGLKYGRNKR
>gnl|bykdb|A0A1Y4KX26 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pseudoflavonifractor sp. An187] (length=480 residues).
MMEERELFHWDELSWYSVLRDLVINLWVVVLAGLTVWMGVDSVVQLRYVPAYTSYAIMAVTAKGSDISIYSNLTATTQMA
EVIGEVFASNVLREKVVEELAVTEFDGEIKAEVIPETNMLTVQVTAPTAKQAHQGLWSAINHYDEVSNYLFTNADLMMLQ
PPSVPKTPSNTPNIRHIQKIASVGAAILVAAGCVLFTALRPTVQTMQGAQRNLNGSVLGDVPFERKWKSTKDIIRRRKKS
ILLNDPGVSMGFSASIRKIATRLELRMKHSGHKILLVTSVGENEGKSSVATNIALALKEKGRRVLLLDGDLRKPAIHKVL
QLPKEDAVCINDYLNDRCEGTNTVYYDEDSGLHVVQSGDQRVNDGVRGNATKICQLIQALSETMDYIIVDSAPMAVTSDT
EYLLQAVESVLFVVRQDWCGVDAINDKLEILRQNNVRIQGIVLNAVHPFGFGSRSRDRYYGYGRRTRGKKKLEAEHEREN
>gnl|bykdb|A0A1Y4L6B2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lachnoclostridium sp. An181] (length=241 residues).
MKKIQIAYERPSYRTREELNELRTNIQFCGDDKKVIVITSCTPGEGKTKTAINLSVSFAELQKNVLLIDADMRKSVMPKR
LGIDGIDEGLSHFLSGQCALADTVMATNIPRLHILFGGVVVPNPTELLSSERFSSMLESFREVYDYIIIDSAPLGLVVDS
SIIAKDTDGALLVIESGKVKYRLVQEVKRKLETADCSVLGVVLNKVDHKKNRGYYSKYYGKEYGSKKYGSYYGDLADKEK
E
>gnl|bykdb|A0A1Y4LQH7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Faecalitalea cylindroides] (length=226 residues).
MKKVENTPNKSQQFDEMEVYRHLRTNIEYSSVDNKIQVINITSTQPGEGKTTTSTNLAIVSASQYGRVLLVDCDMRKPQV
HKRFNISNRFGLSNILAGDNVNISDSYFSKFKDKDTEGVLYVLPAGVKVPNPTELLSSEKFKDFIEFMRMRFEFIILDCP
PVLSVSDCIPVSHVSDGTLFVVSSKDTDKNDARTALQQLQRNGANVLGTVLNKVDKTNESGYYSYY
>gnl|bykdb|A0A1Y4M7K5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Drancourtella sp. An177] (length=223 residues).
MREISLNLKSMQNFRVNESYKQLRTNIEFSGEENKAIAITSCVPSEGKSSVSLSIASSLAEAGKKVLFIDADLRKSVLAG
RNKIQGELKGLTHFLSGQGDLSEVLCKTTERGLFTIFAGPVPPNPAELLGGKKFSALLREARNVYDYIIIDTPPLGSVID
GAIVAAECDAAIMVVAANTVSYKFARSVKEQLAKTGCNLLGVVLNKVSAKKNKYYGNYYGEED
>gnl|bykdb|A0A1Y4MB51 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pseudoflavonifractor sp. An176] (length=486 residues).
MEEIKREIQGRYNDEEIDLLQLLLDMGKHFRHLWWLCVLLVLGSAALVTGALFVLRSPMYQSSASFTVATGEESGSYSFY
YDSGTADQLSMTFPYILESGYFRSVLLEHLGTNNLNGTITAETISGSNVVTMKVQSSSPQDAYAILTTAIEIYPEAAHFV
LGDISFSMLTQPQIPSEPYNRPSIGKSCLLGAGLGMLLSMAILLLLAIFRKNVCAKEEMRKITSMRCLAMLPRVHVKART
KKRTMQLSFLNPSLPHGYTESIRVLKNRVVKAMESKNQKVLLVTSTVPGEGKSVTAVNLAGQLAIDGARVLLVDGDLRKQ
QDGQLLNLTAEYGLMEACKESDMAAVWKGIERNSATLQERGLLFLGGRKVLNQPASLLNSSELKRCMQSLRAEVDYIIID
SPPCGMFQDTAILAEYVDSVLYLVGYDRLPASAIREGIHALGGQLATFLGYAFNSCPENRGGDGYGYGKYGYGRYGMYGY
SGRKER
>gnl|bykdb|A0A1Y4MB84 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pseudoflavonifractor sp. An176] (length=479 residues).
MNRTEHWMSEVSVRGLCVDLMRNLWMIVLAVITMWCATVGLHNLTYQPMYTSSATLVIGVKGDSNIYSSLSLASQMAEVF
GQVFQSDALRERIAADVGTDVQGEISCSLVTQTNLLVVKATSARPRPAYVYLNSALEHYEGVSEQIFSNAELQIVQEPDV
PLAPSNTSWFLKYQGILMVVGAVGMAFLIALCYIARFTVKTAEAARIQLDGPIQGTIPFERRNVALGKKRNKKAFLLNSP
EVSMNFAEAMRNIGTRLERHLRHHGYQVLLVTSVAENEGKSTTAANLALALAEKQKRVLLVDADLRKPSQYKVFEVRRDD
TVSFSRVLEGEKDWKDIVGYSRKSGLWMLFQFLQAKDPGGALREGRMRELLTEWKKQMDYIIVDCAPISAAADAEIWMAA
VDSVLLVVREDWADVRYINDGVDVVRQNHTDFSGFILNAFHKEWSSKHYGYQYEKYGTYSNEDGAEDGGEGLKYGRNKT
>gnl|bykdb|A0A1Y4MC97 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Drancourtella sp. An177] (length=501 residues).
MSDQILEKRAIEDGEMEIDLALLLKDFWRSFRRFWWAFFLLCAVTAGGFYLFWSWRYVPMYEAKATFTVATGDEDSGSYS
FYYDRNTADQLSKTFPYVLDSSFFKSTLMEALGTESLNGTITAETVSESNMVTMKVQSSSASDAKAILDTAIEIYPDTAR
FVLGDMEFHMIDNSVLPQEPYNYMAWWKRLGIGGLIGAVIGVVILGIIALLKKTARTPEEMKKITNLKCLAAVPLVKFKA
RNKTKENVLSATDTRVDYGFRESLRALQIRTERIMDRQDGQVIMVTSTVGGEGKSTLAVNLAKMFATKGKKVLLIDGDLR
RPTDHKILNIKSGANLVDIAEGKSKRECVRKMKNESLWFLGGNETASRPATVLSSEKVASFIQKMRNEMDYIIIDTPPCG
MFPDAGNIAELSDDILYVVKYDNVPIRKIGEGISFLTEHKARFLGYVFNAYPSSTRDYGYGRYGYGKYGYGKYGNKAYGY
KSKRTYGEETDKTEQEQMMDD
>gnl|bykdb|A0A1Y4MH00 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pseudoflavonifractor sp. An176] (length=233 residues).
MKQLTINQLPQLPFDVAESINQLRVNLGFCGKEIKSIMITSSTPDEGKSFVSVNLWQQMAHVGNRTLLIDCDLRNSEMRT
RYGIGGDDKVLGLVHYLAGQVELEDVIYQTDVSGGFIIPVATHIANPSLLLEGERFEKLMAYCRDNFDYIVVDTPPIMNV
ADSLNIATHCDGTVLVVRSGVTSRRLVENSIQMLQKTSTPLLGTVLNRVNTNRKAYRYYYKRYYHKYGYYGGK
>gnl|bykdb|A0A1Y4NH58 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaeromassilibacillus sp. An172] (length=232 residues).
MSKNKQGKAYGSIGIENGKFAIVEGYKLARTNIVFTLSAGRSNCFAVTSWSKGEGKSTATTNLAISFSKMDKKVILIDAD
LRRPNVANLLNIEKRQGLTDYLSGLASYEDIIAEDVLPNLDVITCGTIPPNPSELLGSEEMTRFVEKVKDSYDYVIFDTP
PVGVVADALLLNQHILGFVAVVRENSTTHRDIENLVQNINLAHSKVIGFIKVGCSLQDEKYTKSGKYYRYGY
>gnl|bykdb|A0A1Y4NJM1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium saccharolyticum] (length=233 residues).
MGKMMKVVNIHTDENRDFRFEEAIKTLRTNIQFSGPDIKTVMFTSAVPGEGKSQITVSEAMSLAGLGKKVLVVDADIRKS
VLLTRYQVEQEVHGLTEYLSGQRQMEEVICTTDIQGMDIIFAGPYSPNPSELLAEPLFKELILKKREEYDYILIDTPPMA
GITDGAIISTVCDGAVLVIAAGTVSRRIERRIKEQLEKSGCRILGAVLNKVTSEHGGYYGKRYRKYYGYGAEK
>gnl|bykdb|A0A1Y4NNM6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lachnoclostridium sp. An169] (length=232 residues).
MAEQKVIMNDPKKSDYFYEESIKTLRTNIQFTGMEVKTIAFTSCYPNEGKSDVTFQLAMEIGKMGKRVLVIDADIRKSTF
ITRYGVKQKVEGLSQFLSGQTGGSDIIYQTNFENVDIIFAGPVAPNPSELLEQEAFALLVKSARDGYDYVLIDTPPIGSL
IDAAIVAKQCDGAVLVIESELVSYRIAVKAKEQLEMSGCRILGAVLNKVDTKKDKYYSKYNHYYHYTGSDKR
>gnl|bykdb|A0A1Y4P6J9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus reuteri] (length=250 residues).
MSLFHHIQKQSTDTMNNGAKLITVAHPKSQISEQFRTIRTNINFMAIDKPIKAVALTSANISEGKSTVTDNVAVVWAQTG
QKVLLIDSDLRRPTLHATFNKSNQQGLTTILTGGNHSVDLREIIQSSGVENLDILTSGPIPPNPAELLNSQRMQTLLDTV
KGIYDMVIVDVPPMLEVTDTQILSRHLDAVVLVVKQGKTQKLAVKRAVELLNLAHANLLGYVMNDVNADGDAAYGYGYGY
GYGYSEDTGK
>gnl|bykdb|A0A1Y4Q4U3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus gallinarum] (length=262 residues).
MPLFKKKRGTDDTIKNGAKLITVAKPKSPIAEQFRTVRTNINFMAVDHDIKSLAFTSANISEGKSTVAANVAVTYAQAGR
KVLLIDADLRRPTVHSTFNLSNHVGLSTVISSTAKEVDLDSIVQESGVDNLYVLTAGPMPPNPAELIGSKRMRDFVKLTE
ERYDLVIIDLAPVLEVSDTQELASHLDGVVLVVRQGKTQKMAIKRAVEMLEFAKARILGYIMNDVSSDNAGYGYGYGYGY
GYGYGYGEEDTKKKGLFSKFRK
>gnl|bykdb|A0A1Y4QKT8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Clostridium] spiroforme] (length=461 residues).
MDKEYTTSDEEIEIDLENVFINFIVGIKKFGLILIILILVYTGVRYAHAHFNFKPQYSSETTFAVSSNGDDVTELVKTYS
HLLTGSMMKEIVIEDLGLKTLPAVIEVNEVENTNFLLLKATASDYDMAYDVVSSILKNYRSTLDLVVSNIELEVIVPPEK
NTQPINVSNEWHVAKISLFQSGIVALAILFIYALFRRTIQSEKDFKQCLRIDYLGSIPQFNFKRRSHEIDKSLLITNPKI
GQVFIDSYKLIRRRIENYQAKTGANVFLITSCAPQEGKTTTSLNLAISLANKGKKTLLIDGDLRTCQVNEILKVNYEHDL
VEVIEQKRLNLDDLQNTLIDNLKVIGSNHRVANSSEILSSKFLPTLIDYYKQYFDYVIVDSAPIGLLGDGKIFARYCQGA
IVVVRQDKVRNSIILNDMIKLADEGIEIVGGVLNGVKRHFNYYAGYNYYYYHYGKRKSRRD
>gnl|bykdb|A0A1Y4QNW3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Erysipelatoclostridium sp. An15] (length=486 residues).
MEEKNIEQDEITIDLWILLRDFIRGCIKFWWLILALMVAGGAIMFVTNIQTYTPMYQASATFTVTTNTTTDQNNQSDYNY
YYDSSTAEQLSLTFPYILSSQILNDAIEADLGVEAINGSISASIIPNSNMITMTVISSDPDDAKEILESTIRVYPSVARF
VIGMTKFNMIENPSVSNVPYNQPNYFNTVAKGALIGLAVGLVIIAIYAFFRKTVHKTQELEEVTNIKCLATVPYLKQKKR
SRGKTIMPSILNLQTNPLFLENIESLHIRLAKELADINGKTLIFTSTVAKEGKSTIATNVAYALAKNNKKVLLIDADLRK
QDLSKQMNLTTNGVGLSSIKYGSDVVEDAIVYLEKQNLYFLGGNSTIDDLTAVLTNPNMEQFMKDMKQKMDYIIFDAPPC
EAFEDVFLLEKYGDAFVYVIKQDFVQRHRIVDCIATLADSELPLLGYVFNGDSFTFNDYGRYGYRYYNKYGYRHYSYYNN
EKKAIK
>gnl|bykdb|A0A1Y4QQT5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Erysipelatoclostridium sp. An15] (length=456 residues).
MNNQKQNNDLLQKIECTAASLIKKSGILFIWILICAIGVDVFKTLTYAPEYMSTMQAALVLEENTYSQLEQAQSYITTLD
YIFNGQVVKDYIKEKMNVDDVEYTCNVSSQNQTNIVNISVTAPTKREAYYSLEYLTEWYVNNAAQYHLSYELDVLQRSQL
NESPVVANGHFRNLRLGVIISFVFILIYAFIIYLRPTVKTANDIEKQADCRLFARIPKEHKKHGRHRKDAILITSLKTSF
AYKEAVKKLRSRIESSAEKHGYRTFMITSSVENEGKSSIAANLALSLSQNRHKVLIIDGDIRKPSLHKIFQIRTDRSINQ
YLEGKQSWESQIDYLEKQNLSVLCAKQDLENSEKLIQDRLKGLIEEAKKEFDLVIIDTSPAYGINEPLIINEWVDASLLV
VKQNEATLTLINETITRIVQAKNNLIGCIYNSSVADLSRNRKIYGYRYGYNRYSRR
>gnl|bykdb|A0A1Y4QR11 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Erysipelatoclostridium sp. An15] (length=467 residues).
MTMQDNNAEKIDLTKYVDYFFRTVLKLKKLFILIIVIMIAIMEIRTVFFFETTYSSEAVFVVHTQDQDNIFATNDENDDM
FTTFNGLMTGPMMQQIIQEGLGVSLQDISISLAKIPDTNLVQLHVTAKDGETAFHVASCILNNYHQVTDLVMSDVEISLL
DTPAVAKAPDAYPDYLRNGIMGLAIGIIICLVISFAVIIFRHTIIDSEDVKNVLHLNNITKIPYLNVRRKRKSKQLELLL
SNPRIQYSFRQSFHDLRLRFEQENKKNQSRVFMVGSVLPNEGKSMVASNIAISLADKGHKTVLVDLDLRNPSVLRILEED
ELSGNIGGYLKGEYVLEEVINQYQDYPLDVIYGVDSYENAPELLSRPSLEKLIRALKEHYEYVILDVPPLYILEDALIIS
RYCDTGLIVIKQDHASEADILDSLEELNEHLPYIMGTVINQARASVFGSEHHRYGYGYGYGYGYGHK
>gnl|bykdb|A0A1Y4QZ64 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus cecorum] (length=235 residues).
MAKKYDKKNSTATKPVNLITLLNPNSPISEQYRTVRTNLQFAVAGDQPLRSMTVVSSGPGEGKSTSSANLAIVFAQTGRR
VLLVDADMRKATVHKTFGLSNEVGLSNLVSGQQSASSVIQPSGVDNLSVMTAGPTPPNPAELLNSHRMNVVIEELYQMFD
LIVFDLPPVMTVADGLIMASKTDGTVVVIREGVTRKDSIIEAKNRLIQAKARILGVIYNGAEQVNESSYYHYSDK
>gnl|bykdb|A0A1Y4SNE6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Massiliomicrobiota sp. An134] (length=224 residues).
MEKDTRDVIEIKNINKKFGLMESFKTLRTNLMYTENLQVISVTSTVPDEGKTVVAFQLANSFAQMDKKVLLIDCDLRRSS
LNDYLVISRKSIGLTEGLTKQSRQYIKPTNIDNLFVILAGKRPPNPSELLSSPSFEKLIEQLKESFDYIIIDTPPTTVAM
DAVIVGRVCDGTLMVIRNEFIKKKLLKRAKQELERNGVRIVGAVLNRVKKNQIEYSGYGYEKYY
>gnl|bykdb|A0A1Y4T5A2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Faecalibacterium sp. An121] (length=265 residues).
MVQKERCQMKELEISRIPQLSFEVTEALNQLRINLGFCGDQIKTIMVTSSVPNEGKSFIAMQLWRMMAEVGTPSLLIDCD
FRNSEMRRKYGLHSADKEKLLGAAHYLAGKTDVQNIIYKTNIPNGYMIPVTTAIVNPTILLESANFARMLDYCKEHFAYI
LVDTPPLASVADALNIARYCDGSVLVVRSGDTPRKVVDNSVQMLRRTDTPLLGLVLNRADVSGRSSVYYHRYYRSGYYYK
GSRYGYGYGGSHTRDTGKTTDNGGK
>gnl|bykdb|A0A1Y4T8E0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Faecalibacterium sp. An122] (length=254 residues).
MVPTKGSDMKELKIHSMPELPFAAAEALNQLRINLGFCGDGIRTVMMTSSVPNEGKSFLTIQLWRQMALVGTPVLLIDCD
FRNSEMRRKYGIRSASQEKLLSAAHYLAGKAEIQDVIYKTNIPNGYMIPVASTIANPTILLESPQFARMVEYCAQRFAYI
LIDTPPLCSVADGLNIARHCDGSVLVVRSGSTPRKLVEHSAQLLKRTETPLLGMVLNRADTGSRASAYYQRYYGSSDYGY
GRGHSHNKSPNGGT
>gnl|bykdb|A0A1Y4TBY3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Faecalibacterium sp. An121] (length=248 residues).
MEERPVMKTLVIDQMPQLPFQVSEAINQLRINLGFCGSQIKTIMITSSVPNEGKSFLTIQLWKRMAEVGTPVLLLDCDFR
NSEMRRKYGIRSTDGGKLLGAAHCLAGQAQLEDVIYSTNIPQGYMIPVASTIANPTILLESPRFARMLEDCAGRFGCVLV
DTPPLGSVADGLNIARYCDGSVLVVRCGSTPRRLVHNSVQLLGRTGKPLLGVALNRANAGGGAGGYYYRYYGGSYDHTHD
TNGKEGGK
>gnl|bykdb|A0A1Y4TP20 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus gallinarum] (length=262 residues).
MSLFKKKRGTDETIKNGANLITVADPKGPVTEQFRTIRTNINFMAVDHDIKSVAFTSANISEGKSTVAANVAVTYAQAGR
KVLLIDADLRRPTVHRTFNLSNHVGLSTVISSTAKEVDLDDVVQDSGIADLAILPAGPTPPNPSELIGSKRMQDFISLVE
DHYDMVIIDLAPVLEVSDTQELARRLDGVILLVRQGKTQKAAIKRAVEMLNFSKAKVLGFIMNDISSDNAGYGYGYGYGY
GYGYGYGEEDKKKKGFFSGNKK
>gnl|bykdb|A0A1Y4TST8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lachnoclostridium sp. An118] (length=235 residues).
MKRINIELPEFAYGTREEVKTLRTNVQFCGDDKQVILFTSSLPGEGKTRNAIALAASFAELNKNVLLIDADMRKSVMVSR
LQVSGADKGLSHFLSGQCTIADAVVATNVPKLHLLLAGPLVPNPTELLSSARFSGMLESFRKVYDYIIIDTPPLGLVIDS
AIVARQCDGAILVVESAKTKYRLAQEVKAKLEGTGCSILGVILTKVDRKKQSGYYTKYYGKNYGKKGYGEYYSAE
>gnl|bykdb|A0A1Y4UF09 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Tyzzerella sp. An114] (length=241 residues).
MGFFKFKKNKKSNPIEERKYIINDDTPFAITEAYKGLRTNVTFSRTSEGCRVIGLTSSFSSEGKSINCLNLAITFAKADS
KVLIIDCDLRRPNISRLLDIKSSPGLSNFLVNLNKLSEVVRKTEYEGLDVITSGDIPPNPSELLSSARMEDLIGEMSTRY
DYIFIDTPPVNMVTDAAILSKLLEGMIFVVREKRVDKDEVINAISQLEFAGMKVLGFVFNDVSVDEKKYYRRHHYGYSRR
K
>gnl|bykdb|A0A1Y4VFJ9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Eubacterium sp. An11] (length=240 residues).
MKQIDMNIQALPYAVEEAMNRLRVNIKFCGKNTKKILVISSVPNEGKSTVSVHLWKMLAEAGFPSVLVDLDLRKSVLKDR
LEFKSEGEIQGLDYYLSGLSEYQNVVYETNISNGYIVPVSNLLENPSALLEDPRMEELLDRLAEDYRYVIIDSPPLDSVA
DGALIASFCDGAILVVRSGMTSRRLVKQSIQQLERVGCRLLGTVLNRVETKSRAYQKYYGKYGNYYSDYYGGHGAEKKEG
>gnl|bykdb|A0A1Y4VZ15 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus gallinarum] (length=260 residues).
MPLFKKKRGTDDTIKNGAKLITVAKPKSPIAEQFRTVRTNINFMAVDHDIKSVAFTSANISEGKSTVAANAAVTYAQAGR
KVLLIDADLRRPTVHRTFNLSNHVGLSTVISSTAKEVDLDEVVQDSGITDLAILPAGPTPPNPSELIGSKRMQDFISLVE
DHYDMVIIDLAPVLEVSDTQELARRLDGIILVVRQGKTQKAAIKRAVEMLNFSKAKVLGFIMNDISSDNAGYGYGYGYGY
GYGYGEEDKKKKGFFSGRKK
>gnl|bykdb|A0A1Y4WDQ3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Flavonifractor sp. An100] (length=280 residues).
MSLLPSKKKRAVKNRSKEFAMLQEERQNLLSSSKDFFMREAYKTLRTNVNFSLTEDITGGKLIAVTSALQGEGKSFTAVN
LAISYAQTDCRVLLVDCDLRRPKLSRLLRVSAATGLSNVLVSPALLSESIKPSGVEKLDVILSGDIPPNPSELLGSARME
RFLAAVKENYDYIILDTPPVCMVTDAAVLASRVDGVLFVVMAGKSERPAVIQAVDQLNYAQAKLLGFVLNGVDLEKSGYG
YKKYRYKKYKKYSYRSGYGYGYGYGHSAPQSLEDERGLND
>gnl|bykdb|A0A1Y4X3T8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Brevibacillus brevis] (length=231 residues).
MSMRRQKPDDRYQKLIAHWEPLSPLVEGYRTLRLNIQFSMGDKPMQTILVTSPGASEGKTITAANLSLMMAKDHKKTVLL
DFDLRNPRVHFTFDMPNLYGISSYFSDMCQIPDIIQPSGVSELSIITAGPIPHNPAEMLGTPRLLELMDYLRHNYDFVIV
DSPPLIVSDAMVLAREMDGCVMVVDASKTKRDSAVKAVEQLKAAGANLLGVVLNNKKVGKREGYYGYGYNA
>gnl|bykdb|A0A1Y5JVM1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. MY03] (length=229 residues).
MSRSKNKRQLITLTNSRSPISESYRALRTNIDFSSIDEKLQVIMVSSAGPGEGKSTTIANLAVAYAQSERNTLLIDADLR
KPTAHHTFSVSNRWGLSSVISKQCTIEEVVQMTDIPNLNVMTSGTIPPNPAEMLGSNRMSAIIEHLKSQYDVILIDTPPL
LAVTDAQIVASKCDGAILVVDQGKVKRDIAKKAIQNLQAVNARILGVVLNNVKRKANEEAYYYYYGTQE
>gnl|bykdb|A0A1Y5KAN4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. MY03] (length=229 residues).
MLRLTPKWNLITHLNPKSPISESYRTLRTNIDHSTINQKLQIIMVTSSKPGEGKSTTCANMAVAFAQANKRVLLIDADLR
KPTQHYLFGTSNRNGLTTALFNQKPLKDIVQHTAVDNLFIVHAGPTPPNPSELLSSPQMAELLDEARKSYDVIVLDTPPI
VTVTDAQVVAVMSDGVVLIVQSGQVSKEHVLKAKSLLDHVKAKLLGVVLNNVNSSHADSYSYYYGDSEG
>gnl|bykdb|A0A1Y5YZ05 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNVEFASVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERFEKCVQKTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSMYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSEATEKETAVKAKGLLDSAKGKLLGVVLNDREREHGLYYYYGAN
>gnl|bykdb|A0A1Y5YZL3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVENLNFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANICDASILVVRSESTEKETAVKAKGLLQSAKGKLLGVVLNDREREEGLHYYYGVN
>gnl|bykdb|A0A1Y5Z0T0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSLYDL
VIFDLPPILAVTDAQIIANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A1Y5ZEX1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNVEFASVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTYSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSTYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A1Y6G4B4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. OV166] (length=233 residues).
MALKMKKLTSKDACRKLVTAIDPMSPISEQYRTIRTNIQYSSIDQEIRTIMVTSSGPAEGKSTTAANLAVTFAQLGKKVL
LVDADLRKPTIHHTFGVNNLFGFTTVLTKQRGLEKTVLETGEQDLYILTSGPIPPNPAELLSSKSMEQFIEDAKAEFEYI
IFDTPPLLAVADPQILANQCDGSILVVYSEKTEIEPAKKAKELLANAKSKLLGVVLNHKEAKSGDYYYYYGAK
>gnl|bykdb|A0A1Z2VAI2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anoxybacillus flavithermus] (length=226 residues).
MRSLITKTNPKSPISEQYRTIRTNIQFSVVDRPLRSIMVTSSAPAEGKTTTVANLAVVFAQQGKKVLLIDADLRKPTIHY
TFRKDNYIGLTNVLTKQATLQTAVKETDVENLFVLTSGPIPPNPAELLGSSAMEELLAEAYDQFNVVLFDTPPVLAVTDA
QILANQCDGTILVVHSGKTDIEAAQKAKELLLAAKGKLLGVVLNQKKQKESNYYYYYYYYYYYGNK
>gnl|bykdb|A0A1Z5ICH9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus mixtipabuli] (length=243 residues).
MSLFHHKKRPSTDSIENGVKLVTAVEPKNVVAEQFRTVRTNIEFSSIDKEIKTVLFTSSDVSEGKSTVSANVAVTWAQQG
KKVLFIDADLRRPTLHATFVLPNTQGLSTILANNVDFHSIANADVIDNLTVITSGPIPPNPAELLNSQRMKHFVEAAKSE
YDVVVFDVPPLLEVTDTQVLSAHVDGVILVVRQGLAQRADVTRSKELLTMVHANLLGYVLNDVAPKNGYGYGYGYGYGYG
YEQ
>gnl|bykdb|A0A1Z5IFQ7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus silagei JCM 19001] (length=254 residues).
MSLFHRKPKQSDDTSMHGVRLITATEPKNVIAEQFRTVRTNIEFSAVDKTLKTILFTSSEQSEGKSTVATNTAVTWAQQG
KKVLLIDADMRRPTLHATFSFPNTQGLSSILAGNADLQDTVHPTVIKNLAALTSGPIPPNPADLLNSKRMHTLLETVQAQ
YDVVVLDVPPLLSVTDSQLLSASVDGVILVVRQGVAQRVDVQRSVELLKMSKATLLGYVLNDVEPKHGHGYGYGYGYGYG
YGYGYGYESKAKSK
>gnl|bykdb|A0A1Z5IPY8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus pentosiphilus] (length=242 residues).
MLFRHKKRLSTDTMENGVKLVAAIEPKNVVAEQFRTVRTNIEFSSIDKEIKTLLFTSSDVSEGKSTVSANVAVTLAQQGK
KVLFIDADLRRPTLHTTFGLSNTQGLSTILANNEDYHSIAVNSSIDNLTIITSGPVPPNPAELLNSNRMKRLLQLASSEF
DLVILDVPPLLSVTDTQILSAEVDGVVFVVRQGVAQRTAVKRAKELLSMVHANLLGYVLNDVAPKNGYGYGYGYGYGYGD
NH
>gnl|bykdb|A0A1Z5IYL1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus pentosiphilus] (length=247 residues).
MNIFRRKQEKISTDTLRNGVKLITDVDPKDIVSEQFRTVRTNINFSAVNQKLKTIIFTSSAVSEGKSTVSANLAVIWAQQ
GQKVLFIDSDLRHPTLHTTFGLLNTNGLSTALSTDIDFNSVVQKTEIDNLSVITSGPIPPNPSDLLASNRMKELISYFKK
IYDVIILDVPPLLSVTDTQIIAAQADGVVLVVRQGLAQKLAIKRSIELLKMVKANLLGYVLNDVAPKNGYGYGYGYGYGY
GYDNKGK
>gnl|bykdb|A0A1Z7LU80 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Drancourtella sp. An12] (length=249 residues).
MKGRNIKKKEVVYMEAKKIEVKKYISISARLKENYKSLRANIDFCKNVPKVILITSSIPGEGKSTVSLRLANEIAKSRKK
VLMMDCDMRKSRWSELFGISRQDKKGVSDFLAGKVSISDALWQTDEPNLYIMLSGTTPPNPAELLGSEAFTKLLNACRQE
FDYVLIDAPPMASVIDPAVICSKCDGVLFVIASDMVSCRIVRRALQQIERAGGMILGAVLNKIKFSNRALYGTYGTSKYY
YSNYSKYYD
>gnl|bykdb|A0A1Z7M628 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Drancourtella sp. An12] (length=230 residues).
MKEISLNLKSMQDYRINESYKQLRTNIEFSGEENKIIAITSCTPSEGKSTVSLSTAYSLAEAGKKVLFIDADLRKSVLAG
RYKVTGEMKGLTHFLSGQGDLSEILCKTNEKGLFVIFAGPVPPNPAELLGSKKFAALLKEARNIYDYIIIDTPPLGSVID
SAIVSAACDAAILVISANTISYKFARSVKDQLTKTGCNILGVVLNKVSMKQNKYYGKYYGKYYGHYGSDN
>gnl|bykdb|A0A200HRJ7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus cecorum] (length=235 residues).
MAKKYDKKNSTATKPVNLITLLNPNSSISEQYRTVRTNLQFAVAGDQPLRSMTVVSSGPGEGKSTSSANLAVVFAQAGRR
VLLVDADMRKATVHKTFGLSNEVGLSNLVSGQQSASSVIQPSGVDNLSVMTAGPTPPNPAELLNSHRMNVVIEELYQMFD
LIVFDLPPVMTVADGLIMASKTDGTVVVIREGVTRKDFIIEAKNRLIQAKARILGVIYNGAEQMNESSYYYYSDK
>gnl|bykdb|A0A200HXB9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus sp. 12F9_DIV0723] (length=234 residues).
MAKRKKQSETTHAVSLITLVDKSSPVSERYRTIRTNIQFASSADRQIKTMVITSSGPGEGKSTTAANLAVVFANSGQSVL
LIDADMRKATVHKTFLLNNGVGLSNVLSTDMKVSDAVQRTVVPNLYVMTSGPKSPNPSELLGSTRMDQLIKELRSDYDFV
IFDMPPIVAVTDAQIIASKADGTMLVVRENYTRKDSLQKARELLSMVNANVLGAVFNGSTDVTDQGYYYYGTEK
>gnl|bykdb|A0A200IF57 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus sp. 6D12_DIV0197] (length=234 residues).
MAKIKEHKGTQTHAVSLITLVDPSSPISEQYRTIRTNIQFASSADQQIKTLVITSSGPGEGKSTTSANLAVVFAKSGQRV
LLVDADMRKPTVYKTFNLNNASGLSTVLSTTTSVLEASQKTVIDNLSVLTSGPKPPNPSELLGSSRMNQVIEEVKNLYDV
VIFDMPPVVAVTDAQIMASKADGTLLVVRENVSRKESLAKAKDLLTMVQARILGVVYNGAENSKDSGYYYYYGN
>gnl|bykdb|A0A200IU45 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus sp. 9D6_DIV0238] (length=233 residues).
MSNKIRNQKKQKTKAVSLITLADKSSPISEQYRTIRTNIQYAMIDRDLKTLVVTSSGPSEGKSTTSANLAIVFANSGKRV
LLVDADMRKPTVAKTFSLDNVRGLSTLLGSREVVLHQVVQSSGIDNLFLMTSGPKPPNPSELLDSRRMEELIQDLKQQYD
LVIFDMPPVVAVTDAQIVSSKSDGTILVVRENVSKRDSLLKAKSLLELVDANILGVVYNGSKSITDQGYYYGS
>gnl|bykdb|A0A218PFX0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactococcus garvieae] (length=233 residues).
MAKNKRSIDNNRYIITSVNPQSPISEQYRTIRTTIDFKMADQGIKSFLVTSSEAAAGKSTASANLAVAFAFAQQGKKVLL
IDGDLRKPTVNITFKVQNRVGLTNILMHQSSIEDAIQGTRLSENLTIITSGPIPPNPSELLASSAMKNLIDSVSDFFDVV
LIDTPPLSAVTDAQILSSYVGGAVIVVRAYETKKESLAKTKKMLEQVNANILGVVLHGVDSSESPSYYYYGVE
>gnl|bykdb|A0A219D7D9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus delbrueckii subsp. bulgaricus] (length=256 residues).
MAFGRKKHLNNDTMKNGVKLITLANPQSVISEQFRNIRTNINFMNVDKELKTIVFTSAMASAGKSTVSANVAITMAQAGK
KTILVDADLRRSTMHSTFNVSNSNGLTTLLTSRSMEMDANSVIRESGVENLSILTAGPIPPNPSELLSSKHMLDLIEDLK
QEYDMVVLDLAPILDAGETQQLTSSLDGTILVVRQAHSQKSAVKRAVELLKLTKSPILGYVMNDVDADGYGYGYGYGYGY
GYGEEEEKKGLFGRKK
>gnl|bykdb|A0A220MJ97 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Brevibacillus formosus] (length=231 residues).
MSMRRQKPDDRYQKLIAHWEPLSPLVEGYRTLRLNIQFSMGDKLMQTILVTSPGASEGKTITAANLSLMMAKDHKKTVLL
DFDLRNPRVHFTFDMPNLYGISSYFSDMCEIGDIIQPSGVSELSIITAGPIPHNPAEMLGTPRLLELMAYLRHNFDFVIV
DSPPLIVSDAMVLAREMDGCVMVVDASKTKRDSAVKAVEQLKAAGANLLGVVLNNKKVGKREGYYGYGYNA
>gnl|bykdb|A0A220U2X5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Virgibacillus phasianinus] (length=234 residues).
MARRKKQSKTTSKIRHLITNLNPRSPISEQYRAIRTNLQFSSVDQELKTIVVTSSGPSEGKSMTAANLAVVYAQQGKRVL
LVDTDLRKPTIHYTFRLDNLAGLSNILVGEKALENVIVSSEIDNLDLIPCGPIPPNPSELLASKKMQSTIQAASEVYDII
IFDTPPVLAVTDAQILANICDGSVLVIKSKDTEVEAAKKAIETLEQANARILGTILNDREKKASNYYYYYGTSK
>gnl|bykdb|A0A221C504 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTQSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDRERENSLYYYYGAN
>gnl|bykdb|A0A221M9B9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Virgibacillus necropolis] (length=232 residues).
MARKKDQSKTSKIRHLITKLNPRSPISEQYRTIRTNLQFASVDDELKTMLVTSPGPGAGKSITTANLAVVYAQQGKKVLL
IDADMRKPTVHYTFRLDNLHGLSNILVGEGSLEDSTSTTDVDNLDIIPCGPIPPNPSELLGSRKMRTLIHEASLLYDLII
FDTPPVLAVTDAQILANIVDGSLLVIRSNNTENEAAIKAKEALEPAKAKLLGAILNDREKKASNYYYYYGVN
>gnl|bykdb|A0A222W4I2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus agilis] (length=245 residues).
MGLFRKDKNQDANTMETGVKMITVTDPTSVDTEQFNTIRTNIKFSNVDKDYKTLMVTSSNMSEGKSTVSANIATAFAKQG
LHTLLVDSDLRRPTINATFGIDSPQGLSNYLSERNFDINSIIYKTSVKNLYVMPSGPIPPNPSELIGSKRMAELIKKLSE
QLDLVIFDAPPVLSVTDAQIVSTNVDGTILVVRANKTEKNAVKEAVRLIKQVGGHIIGTILNDVEVKGGGYYGYYGYSKD
SKKKK
>gnl|bykdb|A0A223DWD8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Geobacillus lituanicus] (length=232 residues).
MARKPAASIRKAERRLIAADNPKSPIAEQYRTIRTNIQFSFIDAPLRSLIVTSTGPGEGKSTTAANLAVVFAQQGKKTLL
VDADLRKPTVHYTFRLNNYMGLTNVLTGSAPLLPTCQATEIDHLSVLTSGPIPPNPAELLSSKAMAQCLEQLYETFDLVV
FDTPPVLAVTDAQILANQCDGTVLVIESGGTEIEAAVKAKELLEAANAKLLGVVLNKRKHRDGGYYYYYQYK
>gnl|bykdb|A0A223E2H8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Aeribacillus pallidus] (length=232 residues).
MAPRTKGMKQKQRTLITALNPKSPISEQYRTIRTNIQFSSVDHEIRSIMITSTGPGEGKSTTAENLAVVFAQQGKQVLLI
DADLRKPTVHYTFRLQNIHGLTSVLLRNATLQEAVSVSEVDHLDVLTSGPIPPNPAELLSSRSMVELLKEAYDQYDIVII
DSPPLLAVADAQILANQVDASIMVVASGKTEREAALKGKESLLSAKSKLLGVVLNGKPQKDSHYYYYYGGKN
>gnl|bykdb|A0A223EPW9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus simplex NBRC 15720 = DSM 1321] (length=224 residues).
MTEIKKRSSISMWKSKSPVVEQYRTIRTNLQFSAVEKDIRSMIFTSANAGEGKSTTSINVAAVFAQQGKRILIIDADLRK
PSVHTNFNMENYMGLTNIISKQNQLLDAVQPTIYPNLDVLTSGPIPPNPSELLGSNGMVAVLDEAKLNYDLVILDTPPVN
AVTDAQVLANMTDGVVLVVSSGSTEIQQAKRAKELLEKANAKLLGAILNKKKQKHPDEYYYYGK
>gnl|bykdb|A0A223EQL7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus simplex NBRC 15720 = DSM 1321] (length=234 residues).
MALRKEVGFLRSKDEKQVNLIAQNNPKSPITEQYRLIRTNIQFSSVDKEIKTIVVTSSEPNDGKSTTAANLAIVLAQEEK
KVLLVDADLRKPSVHYAFNLSNIHGLTSVLTKKMDLRKTILNSNVSNLDILTSGPIPPNPSELLNSKAIETAIDELKEIY
DYIIFDTPPVLVVPDSQIVANKCDGVIMVVASGKTNKQSAVKAKDLLMKANTSLLGVVLNGVGTDNSNYYYYKS
>gnl|bykdb|A0A223FKD4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anoxybacillus flavithermus] (length=220 residues).
MRSLITKTNPKSPISEQYRTIRTNIQFSVVDRPLRSIMVTSSAPAEGKSTTVANLAVVFAQQGKKVLLIDADLRKPTVHY
TFRKDNHVGLTNVLTKQAALHIAVKETEVENLFVLTSGPIPPNPAELLGSAAMEELLAEAYDQFDVVLFDTPPVLAVTDA
QILANQCDGTILVVQSGKTEIEAAQKAKELLLAAKGKLLGVVLNQKKQKESSYYYYYGNK
>gnl|bykdb|A0A223I1V5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Thermoanaerobacterium thermosaccharolyticum] (length=240 residues).
MIEADNNVYKNNIVKSKTSVSEAFRSLRTNLQFTSVDKKVKSILITSSLPNEGKSTIIKNLAYALAMTGVKVIVVDCDLR
NPTVHQMFKIPNMGGLTNIIVEDDRYEKYVISDKEFDNLGIITSGPIPPNPSELIGSNRMKSFLNKLKENYDYVLLDAPP
VLLVTDPTVLAPVVDGVILVIQANKTEIEATKRAKEILTNVKANILGAVLNKVKEQKSGYYYYYYYNDDGSKHKRKRRKR
>gnl|bykdb|A0A223K491 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus sakei] (length=248 residues).
MGLFRKEKKLDQDSMKEGVGLITLTSPTSVIAEQFRTIRTNIQFSSIDQKLRSLVFTSSGPSQGKSTISANVAVTWADQG
VNVLLVDADMRRPTIHQTFQVPNKKGLTSLLTEDEFDFNTTIQKTPVEHLFVLPCGVVPPNPSELLNTKKMDKLIVELTK
HFDLVIFDAPPVISVTDAQILASKVDGTILVAPQGIADKRSVIKSKELLDVVHARILGTIMNRVKPENTGGYYGGYYGGY
YGAEESKK
>gnl|bykdb|A0A223KVY1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cohnii] (length=235 residues).
MVLKRKKKQTVKGTTSRHLITDKLPKSPISEQYRTIRTNIQFSFVDTEMRSIMVTSSGPAEGKSTTACNLAVVFAQQGKQ
VLFVDADLRKPTAHYTFQQDNFKGLTTFLTRQSEFNDSINPSRIPNLDVMTSGPIPPNPAELLSSRAMEDLLAKAYEEYD
IVIFDTPPVLAVTDAQLLANQCDGTVLVVASGSTEKENAEKAKEMLASAKAKLLGVVLNMKKQKDSSYYYYYGGK
>gnl|bykdb|A0A223ZSC2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis subsp. tigurinus] (length=230 residues).
MPTLEIAQKKLDLARKAEEYYNALRTNIQLSGNNLKVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSQGLCETNVENLFVIQAGSVSPNPTALLQSENFATMIDTLRKYFDYIVVDTAPIGVVI
DAAIITQQCDASVLVTAAGETNRRDVQKAKEQLEQTSKPFLGIVLNKLNTSVEKYGSYGAYGSYGNYGKK
>gnl|bykdb|A0A224AXD1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactococcus garvieae] (length=231 residues).
MAKNKRSIDNNRYIITSVNPQSPISEQYRTIRTTIDFKMADQGIKSFLVTSSEAAAGKSTASANLAVAFAQQGKKVLLID
GDLRKPTVNITFKVQNRVGLTNILMHQSSIEDAIQGTRLSENLTIITSGPIPPNPSELLASSAMKNLIDSVSDFFDVVLI
DTPPLSAVTDAQILSSYVGGAVIVVRAYETKKESLAKTKKMLEQVNANILGVVLHGVDSSESPSYYYYGVE
>gnl|bykdb|A0A226QNV2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Geobacillus galactosidasius] (length=232 residues).
MARRDRKKIQKIERSLITMEDPKSPISEQYRTIRTNVQFSFVDKTMRSLMVTSAGPGEGKSTTTANLAIVFAQQGKKVLL
IDADLRKPTVHYTFRLNNYTGLTNVLTNSAPLLPSCQETSVENLYVLTSGPIPPNPAELLSSKTMEQCIQQLYNEFDLLI
FDTPPVLAVTDSQILANQCDGTILVIESGGTEIEAAVKAKELLEAANAKLLGVVLNKRKHREGGYYYYYRYK
>gnl|bykdb|A0A226R1Y5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. M1] (length=233 residues).
MALNLFKKKKNYRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A226S898 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus crispatus] (length=263 residues).
MALFRKKRDTNDTIKNGAQLITVANPRSAVSEQFRTIRTNINFMSVDKEIHTLAFTSANISEGKSTVTANVAITYAQAGR
KILLIDGDLRRPTLHSTFKVKNNTGLTTVLTSEADEINLNDVVEESGIDNLSILTSGPIPPNPAELIGSRRMETFIELVK
SHYDMVIIDLAPVLEVSDTQELASHLDGVVLVVRQGITQKAGITRAVQMLKFAKARILGYVMNDIRAGNGGYGYGYGYGY
GYGYGYGAEKKKGLFSRKKSDDQ
>gnl|bykdb|A0A226SMY0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus crispatus] (length=259 residues).
MSLFRKKRGTDDTIKHGAQLITVADPRSAVAEQFRTIRTNINFMAVDEEINTLAFTSANISEGKSTVTANVAITYAQAGR
KTLLIDADLRRPTLHSTFNVKNNTGLTTVLTSEADEINLNDVVEESGIDNLSILTSGPIPPNPAELIGSRRMETFIELVK
SHYDMVIIDLAPVLEVSDTQELASHLDGVVLVVRQGVTQKAGITRAVQMLKFAKARILGYVMNDIRAENGGYGYGYGYGY
GYGAEKKKGLFGRKKSDDQ
>gnl|bykdb|A0A226T2E6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus crispatus] (length=259 residues).
MSLFRKKRGTDDTIKHGAQLITVADPRSAVSEQFRTIRANINFMSVDKEIHTLAFTSANISEGKSTVTSNVAITYAQAGR
KTLLIDGDLRRPTLHSTFNVKNNTGLTTVLTSEADEINLNDVVEESGIDNLSILTSGPIPPNPAELIGSRRMETFIELVK
SHYDMVIIDLPPVLEVSDTQELASHLDGVVLVVRQGVTQKAGITRAVQMLKFAKARILGYVMNDIRAENGGYGYGYGYGY
GYGAEKKKGLFGRKKSDGQ
>gnl|bykdb|A0A226TIH6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus crispatus] (length=261 residues).
MSLFRKKRGTDDTIKHGAQLITVADPRSAVAEQFRTIRTNINFMAVDEEINTLAFTSANISEGKSTVTANVAITYAQAGR
KTLLIDADLRRPTLHSTFNVKNNTGLTTVLTSEADEINLNDVVEESGIDNLSILTSGPIPPNPAELIGSRRMETFIELVK
SHYDMVIIDLAPVLEVSDTQELASHLDGVVLVVRQGVTQKAGITRAVQMLKFAKARILGYVMNDIRAENGGYGYGYGYGY
GYGYGAEKKKGLFGRKKSDGQ
>gnl|bykdb|A0A226U3V8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus crispatus] (length=265 residues).
MSLFRKKRGTDDTIKHGAKLITVADPRSAVAEQFRTIRTNINFMAVDEEINTLAFTLAFTSANISEGKSTVTANVAITYA
QAGRKTLLIDADLRRPTLHSTFNVKNNTGLTTVLTSEADEINLNDVVEESGIDNLSILTSGPIPPNPAELIGSRRMETFI
ELVKSHYDMVIIDLAPVLEVSDTQELASHLDGVVLVVRQGVTQKAGITRAVQMLKFAKARILGYVMNDIRAENGGYGYGY
GYGYGYGYGAEKKKGLFGRKKSDDQ
>gnl|bykdb|A0A226UDY4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus crispatus] (length=261 residues).
MSLFRKKRGTDDTIKHGAKLITVADPRSAVAEQFRTIRTNINFMAVDEEINTLAFTSANISEGKSTVTANVAITYAQAGR
KTLLIDADLRRPTLHSTFNVKNNTGLTTVLTSEADEINLNDVVEESGIDNLSILTSGPIPPNPAELIGSRRMETFIELVK
SHYDMVIIDLAPVLEVSDTQELASHLDGVVLVVRQGVTQKAGITRAVQMLKFAKARILGYVMNDIRAENGGYGYGYGYGY
GYGYGAEKKKGLFGRKKSDDQ
>gnl|bykdb|A0A226V0D8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus crispatus] (length=261 residues).
MALFRKKRDTNDTIKNGAQLITVANPRSAVSEQFRTIRTNINFMSVDKEIHTLAFTSANISEGKSTVTANVAITYAQAGR
KILLIDGDLRRPTLHSTFNVKNNTGLTTVLTSEADEINLNDVVEESGIDNLSILTSGPIPPNPAELIGSRRMETFIELVK
SHYDMVIIDLAPVLEVSDTQELASHLDGVVLVVRQGITQKAGITRAVQMLKFAKARILGYVMNDIRAENGGYGYGYGYGY
GYGYGAEKKKGLFGRKKSDGQ
>gnl|bykdb|A0A229MA86 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. KbaB1] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNVEFASVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTYSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSTYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A229MIH9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. KbaL1] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQLDNIFGLTNVLTNSERLEKCIQATSVDNLGFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSEATEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A229NTG7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus herberti] (length=233 residues).
MSRSTRKWSLITESNPKSPISESYRMLRTGVEYAGVDEPVDLMMVTSCRAGEGKSTTSANVAVTFAQAGQRVLLIDADMR
KPSQHHIFGLSNRTGLTGVLNGRFSLEQGIQETAVNGLDVLTAGQTPPNPSEMLGSKAMSSLLELAKSSYDRVIIDTPPI
MAVTDAHIVAGKCDGVLLVIDSGKVKSDVARKAKASLENAGSRILGVVLNNVDRSSGDGYYYYYYGGDEGQNA
>gnl|bykdb|A0A231I2E5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis] (length=233 residues).
MALKLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A231NTA4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Acetobacterium sp. MES1] (length=227 residues).
MDSQNLITLSDPTSFITESYKLLRTNLNFKNLNNRYQVMLVTSAGKEEGKSTTISNLAVTFAQADKRVLLIDADLRLPQI
STIFNINKRKNGLSNMLVDELPLESLVNKIEKLEKLEILTAGNKHVSPTELLNSEAFETFIKKCREEYDVILIDTPPVLS
FADASIISNVVDGVLLVIAAHSTKKATIIEAKKNLDKVGAAVIGVILTKVKFKKNANYYRYNADKAK
>gnl|bykdb|A0A231PZV9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus agilis] (length=245 residues).
MGLFRKNKNQDANTMETGVKMITVTDPTSVDTEQFNTIRTNIKFSNVDKDYKTLMVTSSNMSEGKSTVSANIATAFAKQG
LHTLLVDSDLRRPTINATFGIDNPQGLSNYLSERSFDVNKIIYKTSVKNLYVMPSGPIPPNPSELIGSRRMAELIKKLSD
QLDLVIFDAPPVLSVTDAQIVSNNVDGTILVVRANKTEKAAVKEAVRLINQVGGHIIGTILNDVEVKGGGYYGYYGYSKD
SKKKK
>gnl|bykdb|A0A231RI63 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Cohnella sp. CIP 111063] (length=228 residues).
MSRYKWSVITDANPKSPISEGYRMLRTNVEYSAIDQTLQVIMVTSSKPGEGKSTTCANLAVAFAQTSKKVLLIDADLRKP
SQHHLFGKSNRIGLTTALFRQKELEDVIQQTNTDDLAIIPAGPTPPNPSELLASKRMAALLETARERYDVVIIDTPPLMY
VTDAQIAAAQSDGVILVVEAGKVKKDVALRAKASLDHVKARLIGVVLNNVPRKHSDTYYYYYGDRNDA
>gnl|bykdb|A0A231RQS6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Cohnella sp. CIP 111063] (length=221 residues).
MSALINKSRLIVQSTSKSIAGEAYRTLQTNIQFASLNKEIKTLLVTSTIPGEGKSTTISNLAIAYAESNKKVLLIDADLR
RPSLHKMFSTSSRFGLSYLLTKQCKLEESIIDTFIPNLSLISSGPVVSNPYELLNSGALSSLLDDLKSLFDIILIDSSPL
MPVSDSLIVSAKCDGVLYVIHYGKVKKEAAQKGIASLRNAEANIIGAVINNKKNHKVSYYY
>gnl|bykdb|A0A231SJ08 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus filamentosus] (length=239 residues).
MKQEVSQLARRDKDKVLQLENRDLISLTNPKSPIAEQFRTIRTNIEFSNIDADLRTIVVTSSSPAEGKSTITANLAVVFA
QQGKRVLVIDSDLRKPTTHYTFQIENHIGLSNVLTKQTTLEGTVQTTNQENLWALTSGPIPPNPSELLGSRSMISLLEKA
KREYDIIILDSPPVLAVTDAQILSNLTDGVVLVVSSGKTQINSAKKTKELLESAKAKILGVVLNNKKVQKNQYYYYGGE
>gnl|bykdb|A0A231VY50 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus sp. KR] (length=227 residues).
MPTLEIAQKKLDLAKKAEEYYNALRTNIQLSGNNLQVISITSVKPGEGKSTTSTNIAWAFARAGYKTLLVDADIRNSVMS
GVFKSREKITGLTEFLSGTTDLSHGLCDTNVENLFVVQAGSISPNPTALLQSENFSTMIDTLRKYFDYIIVDTAPIGIVI
DAAIITQKCDASVLVTAAGEANRKDVQKAKGQLEQTNKPFLGVVLNKFNTSAEKYGSYGEYGSYGKK
>gnl|bykdb|A0A233VCG6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Finegoldia magna] (length=230 residues).
MAKKHAYYDNTSMIDEAIRTLRTNLSFSSIDKQLKKIVITSSHPSEGKSTIALKLARSMAKNHQKVLLVDCDLRNPSVGK
IMGTQFNLGLTNLLVKGLDYNQVKMADSEESDLDIILTGPTPPNPSELLGSERMKRLLEKLETIYDVIILDTPPAGIHTD
AQVLSTMADGVLLVVAQGETKYEEIDVTLQNLKHVGANVLGTVLNKVEVKNKHKYGYGYGYGYKYGSSQS
>gnl|bykdb|A0A233VLF5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Finegoldia magna] (length=230 residues).
MAKKHAYYSNTSMIDEAIRTLRTNLSFSSIDKQLQKIVITSSHPSEGKSTIALRLARSMAKNHQKVLLIDCDLRNPSIGK
IMGTQFNLGLTNLLVKGLEFDQVKMKDSEESDLDILITGPTPPNPSELLGSERMKRMLEKLETIYDVIILDTPPAGILTD
AQVLSTMADGVLLVVAQGETKYEEIDVTLQNLKHVGANVLGTVLNKVEVKNKHKYGYGYGYGYKYGSSQS
>gnl|bykdb|A0A233VYL0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Finegoldia magna] (length=230 residues).
MAKKQAYYSNTSMIDEAIRTLRTNLSFSSIDKQLQKIVITSSHPGEGKSTIALRLARSMAKNHQKVLLIDCDLRNPSIGK
IVGTQFNLGLTNLLVKGLDFDQVKMEDSEESGLDIILTGPTPPNPSELLGSERMKRLLEKLETIYDVIILDTPPAGILTD
AQVLSTMADGVLLVVAQGETKYEEIDVTLKNLKHVGANVLGTVLNKVEVKNKHNYGYGYGYGYKYGNSQS
>gnl|bykdb|A0A235F9G7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Fictibacillus aquaticus] (length=226 residues).
MFKRKINTKQRTLVTSLNSKSPIFEAYRTLRTNIQFSSVDQDMRSIVVTSSGPGEGKSTTTANLAVAFAQQGKKVLLVDG
DLRKPTMQYTFQVQNISGLTSVLSRQSTLDKVVQKTNIDNLYLLTSGPIPPNPSEMLGSNGMKDLLAEALQEYEYVLFDS
PPVLAVTDAQILSNMTDGNILVVKSGQTEQEAAVRAKELLLASKGKMLGAVLNGKSQKDNTYYYYY
>gnl|bykdb|A0A239FZZ0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. OK838] (length=225 residues).
MRSKDKKQVNLIAQTNPKSPITEQYRLIRTNIQFSSVDKEIKTIVVTSAEPNDGKSTTAANLAIVLAQEEKKVVLVDSDL
RKPSVHHAFSLSNIEGLTSVLTKKMSIEKALMKTNVPNLEILTSGPIPPNPSELLNSKAIETAIEELKQMYDYIIFDTPP
VLIVPDSQIVANKCDGVIMVVSSGKTNKQSAVKAKELLVKANTSLLGVVLNGVETDNSHYYYYQS
>gnl|bykdb|A0A239R9S3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus equinus] (length=250 residues).
MPTLELAKSQAEMIKKLEEYYNSVRTNIQFSGRNLKVIALTSAQPNEGKSTTSVNLAISFARAGLRTLLIDADTRNSVMS
GTFRSKESYDGLTSYLSGNAELSDVICNTSVDNLMVIPSGKIPPNPTSLIQNDNYERMIETVRDLYDYVIIDTPPLGRVV
DAAIIAHSSDASLLVAKPGIDKRRTITKLKDQLEQSGSVFLGVILNKFDFKADKYGYGYGYGYGYGYGYGYGYGKYGKDE
KSSKGGKKKK
>gnl|bykdb|A0A239SSN4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus merionis] (length=229 residues).
MPQLELVRSKVQLAKNVEEYFNAIRTNIQFSGRNIRTIVITSVQPNEGKSTTSVNLAISLANSGFKTLLIDADTRNSVLS
GTFKVNGKTVGLSSYLSGNSELTDVLCDTNIENLMVVLAGQVPPNPTSLLQNANFDKMLKMTREVYDYVIVDSPPIGLVI
DAAIIAQHCDGAILVTESGVIRRKFLQKAKEQLEQSGTQFLGVILNKVEQRLENYGGYGSYGQYGQYGK
>gnl|bykdb|A0A239TEI9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus piscifermentans] (length=239 residues).
MSKKKKINNEKMSPLIAYDNPRSVTSEKFRGIRTNIMFSTADTNVKTVVFTSEKPAAGKSTISANVAATYAQAGYKTLLI
DGDMRKPTQQYFFSKSNIDGLSNLIIGKTYLAKAVNKTEIENLEVLTSGPIPPNPSELIGSHQMVDLLEELKELYDFIII
DTPPVNTVTDAQLYAKLAKYVVYIIDSKNNDRNSVKKGKELIEKTGAKILGVVLNKTVKEEGSSYYSYYGENENGEKEK
>gnl|bykdb|A0A239X640 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus acidominimus] (length=244 residues).
MPKLELNSRRLVDIGKTEEYFNSIRTNIQFSGSDLKTIVVSSVQPGEGKSTTSTSLAVSFANAGFKTLLIDADVRNSVMT
GTFIAHEKYLGLTSYLTGNARMNDVFCETDVDNLMVVPSGQMSPNPTSLLQNKYFAQLLQTVRDVFDYVIIDSPPIGLVI
DSAIIASQSDASLLVVEAGSVKRRFVQKAVEQLSQSGKPVLGVILNKVDTTKDSYGAYGNYGAYGNYGKEHRGNKSARTR
KSKK
>gnl|bykdb|A0A240A4D9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus stepanovicii] (length=231 residues).
MKRPKEYNKSPLITVDKPKSIISEKFKGIRTNIMFSASYKEIRMIVVASEKPASGKSTISANIAVTYAQAGYKTLIIDGD
MRRPTQHYIFNKSNRDGLSNVIIKKSSLHEAVQQTDVDNLDVLTSGPIPPNPSELIGSESLYNVLNQAQADYDFVLIDSP
PVNTVTDAQLFAEIAKNVVFVLDVEKNDRNEVKKGRVLLEKTGAKILGVVLNKAPKENATNNYYYEADSHD
>gnl|bykdb|A0A242A4B5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus sp. 8G7_MSG3316] (length=228 residues).
MAKKNNNLSPVSLVTVANANSVISEQLRAIRSNINFSSVDKDLQSMVITSSGAGEGKSTMSANLAVVFANSGKRVLLVDA
DLRKPTVALTFRLPNHRGLSTLIADRNSQFDDHIQESGVENLSIMTSGPIPPNPSELLQSQRMTDLIPELTAQFDLIIFD
MPPIGVVTDAQILAAKTDGTLLVVRERKTTKQGLIKAKKLLTLANAHLIGVVYNGVKKGNADNYYYYA
>gnl|bykdb|A0A242A540 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus sp. 8G7_MSG3316] (length=234 residues).
MAKQQERKGTQTHAVSLITLIDPSSPISEQYRTIRTNIQFASSADRRIQTIVITSSGPGEGKSTTSANLAVVFATSGQRV
LLVDADMRKPTVYKTFNLNNTAGLSTVLSTSTSVLEAAQKTVVDNLSVLTSGPKPPNPSELLGSTRMNQVIEEAKNLYDV
VIFDMPPVVAVTDAQIMASKADGTIVVVRENVSRKESLSKAKDLLNMVQARVLGVVYNGAEHSKDSGYYYYYGN
>gnl|bykdb|A0A242ARA2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus sp. 7F3_DIV0205] (length=233 residues).
MTNKVRPQKKQKTKAVSLITLADKSSPISEQYRTIRTNIQYAMVDRDLKTLVITSSGPSEGKSTTSANLAIVFANSGKRV
LLVDADMRKPTVAKTFSLDNIRGLSTLLGSRETLLHQVVQASGVDNLFLMTSGPKPPNPSELLDSRRMKELMMELKQQYD
LVIFDMPPVVAVTDAQIVSSKSDGTILVVRENVSKRDSLLKAKSLLELVDANILGVVYNGSKNVADQGYYYGS
>gnl|bykdb|A0A242B7W7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus sp. 7E2_DIV0204] (length=233 residues).
MANIVRAQKKQKTKAVSLITLADKSSPISEQYRTIRTNIQYAMVDRDLKTLVITSSGPSEGKSTTSANLAIVFANSGKRV
LLVDADMRKPTVAKTFSLDNARGLSTLLGSRETVLHQVIQNSGVDNLFLLTSGPKPPNPSELLDSRRMKELIQELKLQYD
LVIFDMPPVVAVTDAQIVASKTDGTILVVRENVSKRDSLLKAKSLLELVDANILGVVYNGSKNIEDQGYYYGS
>gnl|bykdb|A0A242BDL0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus faecium] (length=232 residues).
MARTQKQKATQTHAVSLVTLTNPSSPIAEQYRTIRTNIQFASAAGQQIKTIVVTSSGPGEGKSTTAANIAVVFAKSGQRV
LLVDADLRKPVIYKTFKLNNASGLSTVLSSSGSVADEIQRTPVENLSILPSGPKPPNPSELLSSPRMDQILAEARQLFDV
VIFDMPPVVAVTDAQIMSSKTDGTLLVVRENTSRKESLSKAKELLDMVQARVLGVVYNGAEHSKDAGYYYGN
>gnl|bykdb|A0A242C415 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus sp. 5B3_DIV0040] (length=234 residues).
MAKIKEHKGTQTHAVSLITLVDPSSPISEQYRTIRTNIQFASSADQQIKTLVITSSGPGEGKSTTSANLAVVFAKSGQRV
LLVDADMRKPTVYKTFNLNNASGLSTVLSTTTSVLEASQKTVIDNLSVLTSGPKPPNPSELLGSSRMNQVIEEARNLYDV
VIFDMPPVVAVTDAQIMASKADGTLLVVRENVSRKESLAKAKDLLTMVQARILGVVYNGAENSKDSGYYYYYGN
>gnl|bykdb|A0A242CDD1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus sp. 4G2_DIV0659] (length=233 residues).
MTNKIRQQKKQKTRAVSLITLADKSSPISEQYRTIRTNIQYAMVDRDLKTLVITSSGPSEGKSTTSANLAVVFANSGKRV
LLVDADMRKPTVAKTFSLDNSRGLSTLLGSRETVLHQVVQPSGIDNLSLMTSGPKPPNPSELLDSRRMGELLRELKQQYD
LVIFDMPPVVAVTDAQIVSSKTDGTIMVVRENVSKRDSLLKAKNLLEMVDANILGVVYNGSKNITDQGYYYGS
>gnl|bykdb|A0A242CM03 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus sp. 4E1_DIV0656] (length=235 residues).
MMAKKQERTGTQTHAVSLITMVDPSSPISEQYRTIRTNIQFASSADKQIKTIVVTSSGPGEGKSTTSANLAVVFAKSGQR
VLLVDADMRKPTVYKTFSLNNASGLSTVLSTSTSVLEAAQKTVIDNLSVLTSGPKPPNPSELLGSARMNQVMEEAKNLYD
VVIFDMPPVVAVTDAQIMASKADGTILVVRENVARKESLTKARDLLNMVQARIIGVVYNGAEHSKDSGYYYYYGN
>gnl|bykdb|A0A242CS91 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus sp. 4E1_DIV0656] (length=213 residues).
MRSMKGNYSIISEQVKLIRENVDYLCQQQDAQTILITSGESGTGKSTVSANLAVAYAQKGNRTLLIDADLRKPTQHYLFS
QEMHVGLSNYIRRDISIESCVQQVILEDCEFSIITSGAIMSNPNDLLASSKMTAALQEVKQLYDVVIIDTPPVNVVSDAL
ILAKKVDGVLLVVHADKTNKQSAKNAVKKLRLVNANILGVVANGTDTGENYYY
>gnl|bykdb|A0A242D375 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus sp. 3G6_DIV0642] (length=235 residues).
MMAKKQERTGTQTHAVSLITLIDPSSPISEQYRTIRTNIQFASSADKQIKTIVVTSSGPGEGKSTTSANLAVVFAKSGQR
VLLVDADMRKPTVYKTFSLNNASGLSTVLSTSTSVLEAAQKTVIDNLSVLTSGPKPPNPSELLGSARMNQVMEEAKNLYD
VVIFDMPPVVAVTDAQIMASKADGTILVVRENVARKESLTKARDLLNMVQARIVGVVYNGAEHSKDSGYYYYYGN
>gnl|bykdb|A0A242DZU6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus sp.] (length=232 residues).
MARTQKQKATQTHAVSLVTLTNPSSPIAEQYRTIRTNIQFASAAGQQIKTIVVTSSGPGEGKSTTAANIAVVFAKSGQRV
LLVDADLRKPVIYKTFKLNNASGLSTVLSSSGSVADEIQRTPVENLSILPSGPKPPNPSELLSSPRMDQILAEARQLFDV
VIFDMPPVVAVTDAQIMSSKTDGTLLVVRENTSRKESLTKAKELLDMVQARVLGVVYNGAEHSKDAGYYYGN
>gnl|bykdb|A0A242E0N7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus sp.] (length=229 residues).
MKKKKIAASPVPLVALADQSITAEKYRTIRSNIQFAAIDRELNTLVITSSGPDEGKSITAANLAVVFANSGKQVLLVDAD
LRKPTVALSFQLPHNEGLSNLLSERERIADDYITETHIENLWVLPSGPKPPNPSEVLGTKRMEEIIEELILDFDLVIFDM
PPVATVTDAQILAAKTDGTLLVVRERKTKKQELLKAKELLQIAKANILGVVYNGTKKESDLTYYYQSLE
>gnl|bykdb|A0A242EDU7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus sp. 2F9_DIV0599] (length=235 residues).
MMAKKQERTGTQTHAVSLITLIDPSSPISEQYRTIRTNIQFASSADKQIKTIVVTSSGPGEGKSTTSANLAVVFAKSGQR
VLLVDADMRKPTVYKTFSLNNASGLSTVLSTSTSVLEAAQKTVIDNLSVLTSGPKPPNPSELLGSARMNQVMEEAKNLYD
VVIFDMPPVVAVTDAQIMASKADGTILVVRENVARKESLTKARDLLNMVQARIIGVVYNGAEHSKDSGYYYYYGN
>gnl|bykdb|A0A242F872 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus faecium] (length=232 residues).
MARTQKQKATQTHAVSLVTLTNPSSPIAEQYRTIRTNIQFASAAGQQIKTIVVTSSGPGEGKSTTAANIAVVFAKSGQRV
LLVDADLRKPVIYKTFKLNNASGLSTVLSSSGSVADEIQRTPVENLSILPSGPKPPNPSELLSSPRMDQILAEARQLFDV
VIFDMPPVVAVTDAQIMSSKTDGTLLVVRENTSRKESLTKAKELLDMVQARVLGVVYNGAEHSKDAGYYYGN
>gnl|bykdb|A0A242FPB8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus faecium] (length=229 residues).
MKKKKIAASPVPLVALADQSITAEKYRTIRSNIQFAAIDRELNTLVITSSGPDEGKSITAANLAVVFANSGKQVLLVDAD
LRKPTVALSFQLPHNEGLSNLLSERERIADDYITETHIENLWVLPSGPKPPNPSEVLGTKRMEEIIEELILDFDLVIFDM
PPVATVTDAQILAAKTDGTLLVVRERKTKKQELLKAKELLQIAKANILGVVYNGTKKESDLTYYYQSLE
>gnl|bykdb|A0A242GYF9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus sp. 12C11_DIV0727] (length=233 residues).
MANIVRAQKKQKTKAVSLITLADKSSPISEQYRTIRTNIQYAMVDRDLKTLVITSSGPSEGKSTTSANLAIVFANSGKRV
LLVDADMRKPTVAKTFSLDNARGLSTLLGSRETVLHQVIQNSGVDNLFLLTSGPKPPNPSELLDSRRMKELIQELKLQYD
LVIFDMPPVVAVTDAQIVASKTDGTILVVRENVSKRDSLLKAKSLLELVDANILGVVYNGSKNIEDQGYYYGS
>gnl|bykdb|A0A242HKB9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus sp. 12E11_DIV0728] (length=234 residues).
MAKRKKQSETTHAVSLITLVDKSSPVSERYRTIRTNIQFASSADRQIKTMVITSSGPGEGKSTTAANLAVVFANSGQSVL
LIDADMRKATVHKTFLLNNGVGLSNVLSTDMKVSDAVQRTVVPNLYVMTSGPKSPNPSELLGSTRMDQLIKELRSDYDFV
IFDMPPIVAVTDAQIIASKADGTMLVVRENYTRKDSLQKARELLSMVNANVLGAVFNGSTDVTDQGYYYYGTEK
>gnl|bykdb|A0A242IG19 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus sp. 10F3_DIV0382] (length=229 residues).
MKKKKTSAPPVPLVALADQSITAEKYRTIRSNIQFAAIDRELNTLVITSSGPDEGKSITAANLAVVFANSGKQVLLVDAD
LRKPTVALSFQLPHNEGLSNLLSERERIADDYITETHIENLWVLPSGPKPPNPSEVLGTKRMEEIIEELILDFDLVIFDM
PPVATVTDAQILAAKTDGTLLVVRERKTKKQELLKAKELLQIAKANILGVVYNGTKKESDLTYYYQSFE
>gnl|bykdb|A0A242IGU7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus sp. 10F3_DIV0382] (length=232 residues).
MARTQKQKATQTHAVSLVTLTNPSSPIAEQYRTIRTNIQFASAAGQQIKTIVVTSSGPEEGKSTTAANIAVVFAKSGQRV
LLVDADLRKPVIYKTFKLNNASGLSTVLSSSGSVADEIQRTPVDNLSILPSGPKPPNPSELLSSPRMDQILAEARQLFDV
VIFDMPPVVAVTDAQIMSSKTDGTLLVVRENTSRKESLTKAKELLDMVQARVLGVVYNGAEHSKDAGYYYGN
>gnl|bykdb|A0A242IK42 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus faecium] (length=229 residues).
MKKKKIAASPVPLVALADQSITAEKYRTIRSNIQFAAIDRELNTLVITSSGPDEGKSITAANLAVVFANSGKQVLLVDAD
LRKPTVALSFQLPHNEGLSNLLSERERIADDYITETHIENLWILPSGPKPPNPSEVLGTKRMEEIIEELILDFDLVIFDM
PPVATVTDAQILAAKTDGTLLVVRERKTKKQELLKAKELLQIAKANILGVVYNGTKKESDLTYYYQSFE
>gnl|bykdb|A0A242K5G6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus sp. 9E7_DIV0242] (length=230 residues).
MAKYLKNQDSEKGVSLITLADKASPVSEQYRTIRTNIQYSMVDYDLRTLVITSSGPGEGKSTTAANLAIVFANSGKRVLL
VDADLRKPTVAKTFNLSNANGLSSILGNRQTYLDQTIQDSGVDNLSILTSGPKPPNPSELLGSQRMERLIEELGKRYDMI
IFDMPPVVTVTDAQILSSKVNGTILVVREGVSKRESLKKAKSLLEYVGANVLGVVYNGAKNLIDQNYYYG
>gnl|bykdb|A0A242L6R8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus sp. 6C8_DIV0013] (length=231 residues).
MAKNKQTKLAAPEQATLFTVVDPMSNISEQFRTIRTNILYSSVENQTQSIIVTSAGPSEGKSTTSANLAIAFAQSGMKTV
LVDADLRRPTVHRSFYMENTKGLSSLLSIRRMSLGEVIQPSDVRNLDLITSGPISPNPSELLASSRMRKVLHILKQEYDF
IIFDVPPVGTVTDAQLIASQVDGALLVVREDQTEKSGLERAVKLLDQVDANIIGAIYTGEITEQNYGYYQS
>gnl|bykdb|A0A242LC23 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus termitis] (length=233 residues).
MTNKGRVQKKQKTKAVSLITLADKSSPISEQYRTIRTNIQYAMVDRDLKTLVITSSGPSEGKSTTSANLAIVFANSGKRV
LLVDADMRKPTVAKTFALDNIRGLSTLLGSRETMLHQVVQSSGVDNLFVMTSGPKPPNPSELLDSRRMKELILELKQQYD
LVIFDMPPVVAVTDAQIVSSKTDGTILVVRENVSKRDSLLKAKSLLEMVDANILGVVYNGSKNISDQGYYYGS
>gnl|bykdb|A0A242LN25 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus sp. 7D2_DIV0200] (length=233 residues).
MANIVRAQKKQKTKAVSLITLADKSSPISEQYRTIRTNIQYAMVDRDLKTLVITSSGPSEGKSTTSANLAIVFANSGKRV
LLVDADMRKPTVAKTFSLDNARGLSTLLGSRETVLHQVIQNSGVDNLFLLTSGPKPPNPSELLDSRRMKELIQELKLQYD
LVIFDMPPVVAVTDAQIVASKTDGTILVVRENVSKRDSLLKAKSLLELVDANILGVVYNGSKNIEDQGYYYGS
>gnl|bykdb|A0A242WJN8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis serovar cameroun] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQLDNIFGLTNVLTNSERLEKCIQPTSVDNLSFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSEATEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A242WY17 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis serovar malayensis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLSFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSEATEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A242X4E0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis serovar malayensis] (length=228 residues).
MVLKKKVIQGRRQPIVYEQPGSFVAEQYRNIRTSIEFTSVDKRIRSLMVTSSNASEGKTTTAVNIAIAFAQQDKKVLLID
ADLRKPVLHQMMQVDNSFGLTSVLTRSKNLETCVKHTKIENLDILPCGPIPPNPSELLGARSMKDMLSEAYGTYELLIFD
TAPILLVTDAKIMANQCDASVLVIRSGVTEKGSALKGKKELDSAEGKLLGVILNDKETQGEEDYYYGS
>gnl|bykdb|A0A242Y8F0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis serovar novosibirsk] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A242YTG3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis serovar londrina] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTNSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A243A275 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis serovar kim] (length=233 residues).
MALNLFKKKKNYRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTNSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A243AHS3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis serovar navarrensis] (length=234 residues).
MALNSLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFASVDRKLHSLMITSANPSEGKTTTTANMAVVFAQQGKK
VLLIDADMRKPAMHQMFQVDNIVGLTNVLTKSERLEKCVQMTAVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSTYD
LVIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A243B4C3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis serovar poloniensis] (length=233 residues).
MALNLFKKKQNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A243B6S5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis serovar pingluonsis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNVEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSMYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKSLLESAKGKLLGVVLNDREREQSLYYYYGAN
>gnl|bykdb|A0A243CHV1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis serovar yosoo] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASVLVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDRERENGLYYYYGAN
>gnl|bykdb|A0A243CTN3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis serovar vazensis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNVEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSMYDL
VIFDLPPILAVTDAQIMANQCDASILVVRSESTEKESAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A243D9P4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis serovar subtoxicus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDRERENGLYYYYGAN
>gnl|bykdb|A0A243DL51 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis subsp. darmstadiensis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLNFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDRERENGLYYYYGAN
>gnl|bykdb|A0A243E509 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis serovar toumanoffi] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNVEFAAVDTNLHSLMVTSANPSEGKTTTTANIAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A243EPQ8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis subsp. kumamotoensis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDLNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTYSERLEKCVQTTSVENLNFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A243FCH7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis subsp. kyushuensis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDMNLHSLLVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSIDNLSFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A243GIY2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDLNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTYSERLEKCVQTTSIDNLSFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A243HWL5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis serovar thailandensis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNVEFASVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVENLHFLACGPIPPNPAELLGSKSMQELLAQAYSTYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSEATEKETALKAKGLLESAKGKLLGVVLNDREREHGLYYYYGAN
>gnl|bykdb|A0A243JKW4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis serovar pirenaica] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNILGLTNVLTNSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A243JPZ8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis serovar yunnanensis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDLNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTYSERLEKCVQTTSIDNLSFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A243KUQ6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis serovar iberica] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTNSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDRERENGLYYYYGAN
>gnl|bykdb|A0A243L3F5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis subsp. higo] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNVEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQLDNIFGLTNVLTNSERLEKCIQSTSVNNLSFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VVFDLPPILAVTDAQIMANVCDASILVVRSEATEKETAVKAKVLLESAKGKLLGVVLNDRERENGLYYYYGAN
>gnl|bykdb|A0A243L5D3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis subsp. jegathesan] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTNSERLEKCVQTTSVENLNFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDRERENGLYYYYGAN
>gnl|bykdb|A0A243MMR4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis serovar zhaodongensis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTQSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A243MW75 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis serovar sinensis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSLYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKEAAVKAKGLLESAKGKLLGVVLNDREREQSLYYYYGAN
>gnl|bykdb|A0A243NJW9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis subsp. medellin] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIVGLTNVLTNSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDRERENGLYYYYGAN
>gnl|bykdb|A0A243NPL4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis serovar canadensis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNVEFASVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVENLHFLACGPIPPNPAELLGSKSMQELLAQAYSTYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSEATEKEAALKAKGLLESAKGKLLGVVLNDREREHGLYYYYGAN
>gnl|bykdb|A0A243PN59 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus paracasei] (length=247 residues).
MNFSIMNLLHRHDEDQETQKNGVMLVTFVEPKHVVSEQFRTVRTNIEFAGAALDKCQIVMFTSSAMSEGKSTVSANVAVT
WAQAGKRVLLIDADLRRPTIQATFRKLNIDGVTTVLTGRTKVEEVVEETFVDNLSVITSGPIPPNPSELLNSKRMGKLLD
WARGNFDIVVLDAPPVLAVSDVQVLVPKTDGVVVVANMGKTLKSDLQRTVEILKLANAKILGSVERVRTKHGDKGYGYGY
GYGNTDS
>gnl|bykdb|A0A244CEJ7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus reuteri] (length=248 residues).
MSLFHRTQQQSTDTMDNGAKLITVAHPKSPISEQFRTIRTNINFMAIDKPIKTLAMTSANVSEGKSTVTDNVAVVWAQTG
QRVLLIDSDLRRPTLHATFSKSNQHGLTTILTSGTNSVDLREIIQPSGVDNLDILTAGPIPPNPAELLNSQRMKTLLDTV
KGIYDMVIVDVPPMLEVTDTQILSRHLDAVVLVVKQGQTQKLAVKRAVELLNLAHANLLGYIMNDVNADGDAAYGYGYGY
GYGEDTNK
>gnl|bykdb|A0A248LAW4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Exiguobacterium sp. N4-1P] (length=231 residues).
MAKKNKMNKDARNLITVTQPKSPIAEQYRTIRTNIEFMAVDKEIQVILITSATQSEGKSTTSSNLAVAYAQQGKKVLIID
TDMRRPTVHYTFKVANGLGLSSLLTRQAELEKAVLPTKIDNLSILTAGPIPPNPAELLSSRSMENLILQLREAYDVIILD
APPLLQVADSRITSKLTDGVVLVVGCTTSDRQRVLKAKEQLELAEAKILGVVLNRRELTDDSAYQYYYSYE
>gnl|bykdb|A0A249DHA1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus rhamnosus] (length=251 residues).
MNWLPFKFSFKKNQEDQESQKNGVMLVTFAEPKHVVSEQYRTVRTNIEFAAAALDKCQVIMFTSSAMSEGKSTVSANVAV
TWAQAGQKVLLIDADLRRPTVHATFRKLNLEGVTTVLTGKSKPSEVMEKTFVDNLSIIPSGPIPPNPSELLNSKRMTDLL
NWARENFDVVVLDAPPVLAVSDVQVLVPKTDGVVIVTNIGKTQKGDLRRTVEVLKLSKAKILGSVERVKSRHGDKGYGYG
YGYGYGYQRNS
>gnl|bykdb|A0A249N3U4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus rhamnosus DSM 14870] (length=250 residues).
MSWSIKKVFNRHKEDQETQKNGVMLVAFAEPKHVVSEQFRTVRTNIEFAGAALDKCQVVMFTSSAMFEGKSTVSANVAVT
WAQAGKKVLLIDADLRRPTVHATFRKLNLDGVTTILTGKNKPEEVVEDTFVDNLSMISSGPVPPNPSELLNSKRMGELLE
WARSNFDIIVLDAPPVLAVSDVQVLVPKTDGVVVVANIGKTLKGDLRRTVEVLKLAQAKILGSVERVKAKHGDRGYGYGY
GYGYGYQSQK
>gnl|bykdb|A0A249XIP7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNYRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A250E408 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Geobacillus stearothermophilus] (length=232 residues).
MARKPAASIRKAERKLITFDNPKSPIAEQYRTIRTNIQFSFIDAPLRSLIVTSTNPGEGKTTTAANLAVVFAQQGKKTLL
VDADLRKPTVHYTFRLNNYMGLTNVLTGSAPLLPTCQATEIDHLSVLTSGPIPPNPAELLSSKAMAQCLEQLYETFDLVV
FDTPPVLAVTDAQILANQCDGTVLVIESGGTEIEAAVKAKELLEAANAKLLGVVLNKRKHRDGGYYYYYQYK
>gnl|bykdb|A0A252F2F8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Butyricicoccus porcorum] (length=509 residues).
MTMSEQQHNSRHAEEAWLEDENKISLELVLGDMWKGFLRFGWIVMLVFAVAGAVISTAYTAASFSPRYQAISTFTVKAST
GMSDSDDRANYYYSSQSAEQMASTFPYIIHNDVMYDVIKQDLGIGAITASISAEVVPDTNMVTVKVQDSSAESALAVLNS
VMENYPQVARYVLGSTKLSVLKKPTVTEKPINIPSYPRKAVKGAAMGILLALAVLFFYAVTRSTIRTEDDFRDVLNQKCL
GLLPLMKFKKIRGDASPVVSVLNPRVNSSFRESVRALRVHILKELDSHPRDRVILVTSTLPNEGKTTVALNLALSLAQNG
ASVILVDADLRNQTVKQALNLSEESAGLTEVLEQDVTIEQALMQYEDTRVRLLAGDHVSEHPSEQLGSKEMAKVVAQLRK
MADYVVLDSAPCGMLSDAISLAEHADCALYVVKQDYATGNRILSSLDRLSVSRIRVIGCVFNAIASGLSGYGYGYYGRYG
RYGRYGRYGKYGTYGEKERAVSEQAKPES
>gnl|bykdb|A0A256BIM6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Aerococcus sp. 1KP-2016] (length=250 residues).
MFKYRKDIKFFEKMNAEQRLGASLVTVTQPNDVISEAFRQIRTNIQFSMVDQDYKSIMITSSGAWEGKSTVTANTAAVIA
QQGLRVLLVDADMRKPTVAKTFGIDTTVGLTSLLTNREANIMDTVNYVSEANLYVLAAGPIPPNPSELLGSKRMAELIAE
MEDLFDLVIFDTPPILAVTDAQIVATRVDGVIVVVRAGIANKNNVRKTKELLDMVNANVIGAVYNGEESKKMGYGYGYGY
GYGHNNDQEK
>gnl|bykdb|A0A256SMN4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus reuteri] (length=250 residues).
MSLFHRTQQQSTDTMDNGAKLITVAHPKSPISEQFRTIRTNIDFMAIDKPIKTLAMTSANVSEGKSTVTDNLAVVWAQTG
QKVLLIDSDLRRPTLHATFNKSNQHGLTTILTSGTNSVDLRTIIQSSGVDNLDILTSGPIPPNPAELLNSQRMKTLLDTV
KGIYDMVIVDVPPMLEVTDTQILSRHLDAIVLVVKQGQTQKLAVKRTVELLNLAHANLLGYVMNDVNTDGDVAYGYGYGY
GYGYGEDTNK
>gnl|bykdb|A0A256SPR2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus reuteri] (length=249 residues).
MSIFHRRKNKATNDTLVNGAKLITVAHPKSPISEQFRTIRTNINFMAIDKPIKTLAMTSANVSEGKSTITDNVAVVWAQT
GQRVLLIDADLRRPTLHATFNKSNQEGLTTILTSGTNSIDLRQIVQPSGVEDLDILTSGPVPPNPAELLNSQRMKTLIES
VKSVYDMVIVDVPPMLEVTDTQVLSHYLDAIVLVVKEGQTQKLAVKRAVELLNLAHANLLGYVMNDVNTDGDAGYGYGYG
YGYETGSAQ
>gnl|bykdb|A0A256V8E5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus reuteri] (length=244 residues).
MSLFKRKQQHSTDTMDNGAKLITVAHPKSPISEQFRTIRTNINFMAIDKPIKTLAMTSANMGEGKSTVTDNVAVVWAQTS
QKVLLIDSDLRRPTLHATFNKSNQHGLTTILTSGTNSVDLREIIQSSGVENLDILTSGPIPPNPAELLNSQRMKTLLDTV
KGIYDMVIVDVPPMLEVTDTQILSRHLDAIVLVVKQGQTQKLAVKRAVELLNLAHANLLGYVMNDVNADGDAAYGYGYGE
DTNK
>gnl|bykdb|A0A256VAC7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus reuteri] (length=249 residues).
MSIFHRQKNKATNDTLVNGAKLITVAHPKSPISEQFRTIRTNINFMAIDKPIKTLAMTSANVSEGKSTITDNVAVVWAQT
GQRVLLIDADLRRPTLHATFNKSNQEGLTTILTSGTNSIDLRQIVQPSGVENLDILTSGPVPPNPAELLNSQRMKTLIES
VKSVYDMVIVDVPPMLEVTDTQVLSHYLDAIVLVVKEGQTQKLAVKRAVELLNLAHANLLGYVMNDVNTDGNAGYGYGYG
YGYGTGSAQ
>gnl|bykdb|A0A256VGQ4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus reuteri] (length=248 residues).
MSLFHRTQQQSTDTMDNGAKLITVAHPKSPISEQFRTIRTNINFMAIDKPIKTLAMTSANVSEGKSTVTDNVAVVWAQTG
QKVLLIDSDLRRPTLHATFNKSNQHGLTTILTSGTNSVDLREIIQPSGVDNLDILTAGPIPPNPAELLNSQRMKTLLDTV
KGIYDMVIVDVPPMLEVTDTQILSRHLDAVVLVVKQGQTQKLAVKRAVELLNLAHANLLGYVMNDVNADGDAAYGYGYGY
GYGEDTNK
>gnl|bykdb|A0A258AEQ8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Aerococcus viridans] (length=254 residues).
MFKNRRNYFDKMNAEQRRGASLITVTQPNDVISEAFRQIRTNIQFSMVDQDYKSIMITSSGVWEGKSTVTANTAAVIAQQ
GLRVLLVDADMRKPTVAKTFGIDTTVGLTSLLTNREANIMDTVNYVSEANLYVLAAGPIPPNPSELLGSKRMGELIAEME
DLFDLVIFDTPPILAVTDAQIIATRVDGVIVVVRAGIANKNNVRKTKELLDMVNANVIGAVYNGEESKKMGYGYGYGYGY
GYGYGYGHNNDQEK
>gnl|bykdb|A0A259TJ80 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. XY044] (length=228 residues).
MRQSANRNKLIMNVNRGSSISEGYRNIRTNIQFSGWNQKLQVLAVTSTQAGEGKSTTISNLAVAYAQEGKNVLLIDADLR
HPSLQSIFNVPNRLGLSNLLAEQCAFGDVVQTTVVDNLTLVTAGPVPPNPTELLSSDRLQEVIDGWKSVYDVILIDTSPV
MAVADGLIVSSVCDGVILVVLSGKVKREYIQKTKEKLELAKATILGVVLNQKKYSKSEANQYRYYGHQ
>gnl|bykdb|A0A259UGP8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Sporomusa acidovorans DSM 3132] (length=229 residues).
MKSQLYLNNVIDQTSLTKEAFRVIRTKILYSKLYANTKSLLFTSAGAGEGKSMVVINTAITLAQTGKKVIILDCDLRNPS
QHKLFVKPNIGLTNFFDQPCSINNIVQDTGIHNLQLVTSGPIPANPAELLDSNQLTEILSLLCNRSDYLLIDSPPVLPVT
DACILGSKADGILLVVSIGKVRPEMLQRAKAHLEEANGNLLGLIINRSELYSEQRAYYHYYENIAKTAN
>gnl|bykdb|A0A259UMX8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Sporomusa acidovorans DSM 3132] (length=236 residues).
MAHIRRLIVHEQAKSPIAEAFRTLRTNIQFAKADGVIKTVMMTSAGPGEGKSTTMANLAVAFAQSGKKVILMDCDLRKPV
VHKIFGVKNKGLTNILVDDIPIDNIIQQTEVPNLQVVTSGPIPPNPSELLGSSKMQQIINQLRDKADILFLDAPPTVAVT
DASVLAAKVDGIVLVVTSGINRPEMLQRAKELLVKAKGTILGVVLNRVEIEEEHAYYYYYYGSGDHTQKRSHKRSE
>gnl|bykdb|A0A259UQW0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Sporomusa silvacetica DSM 10669] (length=228 residues).
MNKRKLIVQEDAKSPISEAYRTLRTNIQFAKVDSEIKTIMFTSAGPGEGKSTTAANTAVALAQSGKTVLLVDCDLRKPVQ
HRTFGKKNRGVTNILVEDLPCEQFIQATDVPGLKILTSGPIPPNPSELLGSAKMVKLLDTLKNQADYVIIDAPPVVAVTD
ASVLSSKVDGILLVVSAGIARPEMTQKAKEALERANGHILGVVLNRVEIEAEHSYYYYYYGHGEKSAK
>gnl|bykdb|A0A259UTJ1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Sporomusa silvacetica DSM 10669] (length=230 residues).
MMGNRALIVNHSPKSIWAEAFRTLRTKIIYSKSGMVKSILFTSASAGEGKSITVANTAVVLAQTNKKVIVVDCDLRKPVQ
YKIFKKKKTSRGLTNFLTGECEIADIVQDTDIPNLRLVTSGPLLVNPSELLDSDKFKEAISSLKEQADYIIIDSPPVLAV
TDSCILGSKMDGIILVVGVEKVQPEMALRAKEHLEAVDGNILGIIINRSDTFVEQNAYFHYCGNVGNVAN
>gnl|bykdb|A0A261QMS5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillaceae bacterium SAS-127] (length=233 residues).
MFNRRKKNDFDVIRRKLVTLFNPKSPISEQYRTIRTNITFSSVGQEIRSLMVTSPSPGEGKSTTAANLAIVFAQQGKKVL
LVDADLRKPTMHYTFDIFNSVGLTNVLTKQKALSAAVQQSQLNQLHILCSGPIPPNPAELLGSYTMAEFLQEAYYEYEVV
IFDTPPVLLVTDAQVVANQCDASILVVSSGQTNADTAMKAKEVLQSAQSKLLGVVLNNVSNKKSGYDYYYSQK
>gnl|bykdb|A0A263BS50 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. SA5d-4] (length=236 residues).
MARKVKNSRKSLLQTGNRSIITHRSPKSSVSEQYRTLRTNIEFAAVDESLRTFMVTSANPSEGKSTTVANLAVVFAQQDK
KVLLVDADMRRPTVHYTFRTDNIKGLTNYLTKQATLEEVVCETEVNNLQIISCGPIPPNPAELLSSKAMDLFIEEALQMF
DIVIFDTPPVLAVTDAQVLANKVQGVVLVVNSGRTETESALKTKDLLTNAKAKLLGVVLNEKKQKQGEYYYYYGRR
>gnl|bykdb|A0A264DFJ9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. VTT E-133280] (length=228 residues).
MSQLPNKQRHLITVTNPRSPVSEAFRALRTNIDFSSVDETIQVIMVTSSGPEEGKSTVSANLAAAYAQADKKVLLIDADL
RKPTAHKTFSLSNRFGLSSLLSQQAVLEDTVQDSGVSNLSIMTSGPIPPNPAEMMASNRMSTLLQDLRQRYDVILIDTPP
LLAVTDAQIMASKSDGVIMVVSYGKVKRDIAVKAKANLDRVGAKMLGVVLNNVKRKASEGYYYYYYGN
>gnl|bykdb|A0A264W1E9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Tetzosporium hominis] (length=236 residues).
MAKKPKFIVEQSRQVVVERSPKSIISEQFRTARTNINFSVPAGELNTLVFTSSVQAEGKSTVSANLAHLFAQEGKKVLFI
DADMRKPTLHLTMHKENTVGLSNVLTKQAVWSEAVHVSETQPNLSFVTSGPVPPNPAELLASPQFDNMIEEMSREYDLVI
FDAPPLLSVTDAQILANKCDGTVLVVLAGTTQKDSVRRAKELLDTSQAHILGVIMNKFKMEKDHYYYYQYYGATDK
>gnl|bykdb|A0A264YTC3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus aryabhattai] (length=239 residues).
MGKLFKKRKGVSSSNRLTHIRSLISHKKPKSPISEQYRTIRTNIQFSSIDGEMRSVMVTSTLASEGKSTTAANLAVVFAQ
QGKRVLLVDADMRKPSVQYTFQLENHIGLTNVLAKQTNLASGIQESHVDNLWVLASGPIPPNPSELLASQAMESLIQEMY
KQFDMVIFDTPPVLPVTDSHILANKCEGILLVVRSRQTEREAVLKAKDILQKQKGKLLGVVLNGRSEEEGNYYYYYGTK
>gnl|bykdb|A0A265E5K4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Salinicoccus roseus] (length=235 residues).
MFGKKRSHSYVSGPRELIVERQPKSPVSEQFRTVRTNIMYSNIDTEIKTVLVTSATPGAGKSTTAANLAVAYAQSGKRTV
LIDADLRRPTMHYTFEMTNQRGMSTAIVNDVPVENIVRETEIENLDLITSGPIPPNPSELLSSNKMMHLLRTFSMHYDMV
IIDSPPLLAVTDAQVLSKITDGTVLVTNVAENNRDRLLEAKDLLNKADANILGVVMNNKKMNTKKDDYYYYYGSE
>gnl|bykdb|A0A265EAL5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Salinicoccus roseus] (length=249 residues).
MNKKRRGNKESAEGRKIVMATKEQTSVSEQFRTIRTNIMYSSVDKPIRSVLFTSATPGAGKSTIAANMAIAYAQAGKRTL
LLDADLRRPTTHYTFEVMNRSGLSTAIVSDVELVDLVKHTDYEMLDLITSGPIPPNPSELLSSKRLEQFMNTLNIHYEMI
IIDSPPLLSVTDAQILSKRADGVVLVTNVENNNRNQLLEAKDLLNRADANIIGLLLNQRDVRSGGKDGYYYYESASEKSW
QHNLKHKTP
>gnl|bykdb|A0A265EJF3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Marinococcus halophilus] (length=231 residues).
MARKKKQEMNTNQRKLITWLNSKSPVSEQYRTIRTNIQYSSVDKEMQTMVVTSAGPGEGKSTTVANLAVTMAQQEKKVLL
VDADLRKPTVHYTFRRMNTHGLINALTNHGEYAAYVQETEVPNLDILPSGPIPPNPSEILGSRSMAHLVELAREQYDVIL
FDAPPVLAVTDVQVISRHCDGSILVVKAGETENDAARKAKDLLEVSGVPILGCILNQKKGMDQSYYYYYGG
>gnl|bykdb|A0A265N8T9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Virgibacillus indicus] (length=233 residues).
MARRKNLSNPKNKIRHLIAKLNPKSPITEQYRTVRTNLQFASVDEELTSMLVTSSGPGEGKSMTTANLAVVYAQQGKKVL
LIDADLRKPTVHYTFRLDNLRGLSNVLVGENTLNETINRTDVENLDVISCGPIPPNPAELLASRKMNHLLKEAKMSYDIV
IFDTPPVLAVTDAQILANIVDGSLLVIRSKHTEVEAATKAKEALEPAKAKLLGTVLNDREKKHSNYYYYYGTN
>gnl|bykdb|A0A267MIJ9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaeromicrobium sediminis] (length=227 residues).
MKDLVTLNNPKSPISESFRVLRTNIQFSSLDKDLRSILVTSSTQGEGKTTTICNLAITIAQSGKSVLLVDCDLRRPRIHN
NFELNNYKGLTNILAEQNNEDDCIKESTIVNLSVLSSGPKPPNPSEVLGSKSMKNFIESMKEKYDYVLLDAAPVGLVTDG
AILSTLADGVLLVAASGEVAIEAAKRSKELLENVNANILGVVLNKVSVEKSKYYKYYYNQYYYQEAK
>gnl|bykdb|A0A267TNK9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus hisashii] (length=231 residues).
MARNKTTSRSKRHLIAKKDPKSPITEQYRTIRTNIQYASVDQAIRSIVVTSTGPMEGKSTTTANLAVVFAQQGKKTLLID
ADLRKPTAHYTFQLPNTFGLTSVLTKQAELMDAVHMTDVENLFVLTSGPIPPNPAELLASVSMEYLLKEAYNLYDFILFD
TPPVLTVTDAQVLANLADGSILVTSSGTTDRDGAIKAKEILTSAQAKLLGAVLNNKKADKDTHYYYYYAEH
>gnl|bykdb|A0A267X9D0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. 7788] (length=227 residues).
MIFKRKKREKRDLSCISVLNPHSVIAEQFRTIRTNIEFTSIQTRLKSILVTSSLPKEGKSFTAANLAAVFAQQKKRVLLM
DADLRKPSVHEYFDLSHHTGLTNVLLNNCSLEEAILPTPIEHLELLPSGTIPPNPAELLSSSVMKQLFYEIEQQYDMVIV
DSAPLLPVADAKILANRTDGSILVVLSGKTKIAAVKKSKEVLEGTTGKLLGAMLNGKKEKKGRLYMY
>gnl|bykdb|A0A268AEU5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Terribacillus saccharophilus] (length=244 residues).
MQHLLIRDKLGESTVAKRKKQFKTNVRSLITKFNPKSPISEQYRTIRTNIEFASVDATMRSLLVTSSGPSEGKSSTTANL
AVVFAQQGKKVLLIDADLRKPTVHYTFKLDNRAGLSTVLVGEKPLEEATKETDVPNLDILTCGPIPPNPSELLGSNAMKQ
LIKKAQETYDMVIFDTPPVLAVTDAQILANTCDGALIVVRSEQTEYDAIQKAKELLEPAHAKLLGIVLNDVAQKKSNTYY
YYGS
>gnl|bykdb|A0A268BVI8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Terribacillus sp. 7520-G] (length=230 residues).
MAKRKKQFKTNVRSLITKQNPKSPISEQFRTIRTNVEFASVDEKIQSMLVTSSGPSEGKSSITANLAIVFAQQGKKVLLI
DADLRKPTTHYTFKMDNRVGLSTVLIGEKTLEEAAQETDVPNLDLLTCGPIPPNPSELLGSNAMKRLLEIAKEVYDMVII
DTPPVLAVTDAQILANICDGSIIVARSEQTEYDSLLKAKELIEPAKAKLLGVVLNDVAQKHSNTYYYYGN
>gnl|bykdb|A0A268DSY6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus siamensis] (length=226 residues).
MGFRKKKSRRGLAQISVLHHKSLVAEQYRTIRTNIEFSSVQTHLRSILVTSSVPGEGKSFSAANLAAVFAQQEKKVLLVD
ADLRKPTIHETYQLENVQGLTNVLVGNASLDETVQNTLIDNLYVLTSGPTPPNPAELLSSKAMGELIQEMYSRYSLVVFD
SPPLLAVADGQILANQTDGSVLVVLSGKTKMDTVQKAKDALQQSKAKLLGALLNKKKIKKTEHYSY
>gnl|bykdb|A0A268DV27 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus siamensis] (length=213 residues).
MSEPKSINSEQYRTIRTNIEFSSVDTEVKSLLITSAGPEEGKSTTAANLAVVFAQQGKKVLLIDADLRKPTVHFTFKLDN
GTGLTSLLLQQIPFQKAVLRAEEANLDILTSGPIPPNPAELLSTGAMRDLLSEASAVYDKVILDTPPVLAVADTKILGSY
TDGAIMVISSGKTDKEKAAKAKEALDYCPCKLLGAVMNGKKQTKHSDYAYYGQ
>gnl|bykdb|A0A268E417 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. 7586-K] (length=233 residues).
MARKDRKQIFNLQNRSLISLTNPKSPIAEQFRTIRTNIQFSSVDKELQTIIVTSSGPGEGKSTNTANLAVVFAQQGKRVL
LIDADLRKPTVHYTFRTENHVGLSNVLTRQLTLEEAVSTTAQEKLWVLSSGPIPPNPSELLGSKNMQVLLEQAKEEYDVI
VIDTPPVLAVTDAQILANLADGVVLVVSSGKTERDSAKKAKELLESAQAKILGVVLNNKKAEESHYYYYYGGK
>gnl|bykdb|A0A268HI84 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Terribacillus saccharophilus] (length=244 residues).
MQHLQIEDKLGESTVAKRKKQFKTNVRSLITKFNPKSPISEQYRTIRTNIEFASVDTAMRSLLITSSGPSEGKSSTTANL
AVVFAQQGKKVLLIDADLRKPTVHYTFKLDNRAGLSTVLVGEKPLEEATKETDVPNLDILTCGPIPPNPSELLGSNAMKQ
LIQKAQETYDMVIFDTPPVLAVTDAQILANTCDGALIVVRSEQTEYDAIQKAKELLEPAHAKLLGIVLNDVAQKKSNTYY
YYGS
>gnl|bykdb|A0A268I732 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Virgibacillus sp. 7505] (length=230 residues).
MAKRKKQFKTNVRSLITKFNPKSPISEQYRTIRTNIEFASVDATMRSLLVTSSGPSEGKSSTTANLAVVFAQQGKKVLLI
DADLRKPTVHYTFKLDNRAGLSTVLVGEKPLEEATKETDVPNLDILTCGPIPPNPSELLGSNAMKQLILKAQETYDMVIF
DTPPVLAVTDAQILANTCDGALIVVRSEQTEYDAIQKAKELLEPAHAKLLGIVLNDVAQKKSNTYYYYGS
>gnl|bykdb|A0A268IUP6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. 7894-2] (length=223 residues).
MEHKRKLISKNDPKSPISEQYRTIRTNIQFSSVDEEIRTIMITSSGPGEGKSTTTANLAVVFAQQGKKVLLVDADLRKPT
VHYTFNVMNTSGLTSVLTNQMPLKEAVKAIDMKNLFILPSGPIPPNPSELLGSKAMDYFIKTVMDEFDIILFDTPPVLAV
TDAQILSNKCQGTILVAGSGKAEKDQLLKTKELLEAAKGKLLGVVLNNKKMKESQHYYYYGAN
>gnl|bykdb|A0A268JUZ8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. 7884-1] (length=234 residues).
MVFKRNKKLKITDPSRKLIANLDPKSPISEQYRTIRTNVQYSSIDKELKTLMVTSSGPAEGKSTTAANLAVVFAQLGKKV
LLVDADLRKPTVHRSFGENNLFGFTTVLTKQATLGSTVLETEEKDLYILTSGPVPPNPAELLSSKSMEQFIEEAKEQFDY
VLFDTPPLLAVADPQILANKVDASIFVVFSGKTEIDQAKKAKELLENAQSKLVGVVLNHKEVKGNDYYYYYGSK
>gnl|bykdb|A0A268NZL8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus clausii] (length=231 residues).
MARLTRAKKKPVQKKRQLIADVNRRSPITEQYRTIRTNIEYSAVDTEIKSLLVTSAGPGEGKSTTASNLAVVIAQNGQTV
LLIDADMRKPTAHYTFGLMNNRGLTNVLTRQQKQDDVIQETNVENVSLLTCGPIPPNPAELLNSKMMELVLQEAREKFDM
VILDTPPVMAVADAQILANKVDGTIIVTSSGKTDREQLQKTKENLVKANAHLLGVVLNNKPIDDTTYYYYK
>gnl|bykdb|A0A268S3B3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus clausii] (length=231 residues).
MARLTRTKKKPVQKKRQLIADVNRRSPITEQYRTIRTNIEYSAVDTEIKSLLVTSAGPGEGKSTTASNLAVVIAQNGQTV
LLIDADMRKPTAHYTFGLMNNRGLTNVLTRQQKQDDVIQETNVENVSLLTCGPIPPNPAELLNSKMMELVLQEAREKYDM
VILDTPPVMAVADAQILANKVDGTIIVTSSGKTDREQLQKTKENLVKANAHLLGVVLNNKPVDDTTYYYYK
>gnl|bykdb|A0A269ZJ50 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus kefiranofaciens] (length=266 residues).
MSLFKKKRGTDETIKKGAKLITVTDPKSPVTEQFRTIRTNINFMAVDHDIKSVAFTSANISEGKSTVAANVAVTYAQAGR
KVLLIDADLRRPTVHRTFNLSNHVGLSTVISSTAKEVDLDEVVQDSGIADLAILPAGPTPPNPSELIGSKRMQDFISLVE
DHYDMVIIDMAPVLEVSDTQELARRLDGIILVVRQGKTQKAAIKRAVEILNFSKAKVLGFIMNDISSDNAGYGYGYGYGY
GYGYGYGYGYGEEDKKKKGFFSGRKK
>gnl|bykdb|A0A270ANA1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus simplex] (length=234 residues).
MTLRKEVGFLRSKDEKQVNLIAQTNPKSPITEQYRLIRTNIQFSSVDKEIKTIVVTSSEPNDGKSTTAANLAIVLAQEEK
KVLLVDADLRKPSVHYAFNLSNIHGLTSVLTKKVDLRKTILNSNVLNLDILTSGPIPPNPSELLNSKAIETAIDELKEMY
DYIIFDTPPVLVVPDSQIVANKCDGVIMVVASGKTNKQSAVKAKELLEKANTSMLGVVLNGVEEDNSNYYYYQS
>gnl|bykdb|A0A271LXW2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillaceae bacterium SAOS 7] (length=224 residues).
MDVLRRKLVTFLNPKSPISEQYRTIRTNITFSSIGQEIRSLMVTSPSPGEGKSTTAANLAIVFAQQGKKVLLVDADLRKP
TMHYTFNIFNSVGLTNVLTKQKALSATVQQSQLDQLHILCSGPIPPNPAELLGSYMMAEFLQEAYQEYEVVIFDTPPALL
VTDAQVVANQCDASILVVSSGQTNADTAMKAKEVLQSAQSKLLGVVLNNMSSKKSGYDYYYSQK
>gnl|bykdb|A0A285BIP0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Thermoanaerobacterium sp. RBIITD] (length=241 residues).
MIEAENNNLDKSNIVKAKTSISEAFRALRTNLQFTSVDNKVKSILITSSLPNEGKSTIIKNLAYALAMTGSRIIVIDCDL
RNPTVHQMFKISNMNGLTNIIVEDANYQKYIISDKEYDNLDIIPSGPIPPNPSELLGSNKMKNFINNLKEDYDYILLDAP
PVLLVTDPTVLAPIVDGVILVVQANKTEIDVTKRAKEILTNLKANILGVVLNKVKEHNKGYYYYYYYSDDGSKHKKKRRK
R
>gnl|bykdb|A0A285CJA7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus oleivorans] (length=235 residues).
MALKGFKRERKRSSQSRSLITHINPRSPIAEQYRTMRTNIQFTQVDQTIRSLMVTSSGPGEGKSTTVANLAVVFAQQGKK
VLVVDADMRKPTVHYTFRLNNTLGLTNILTKQATLEEAINDSLIDNLYVMTSGPVPPNPAELLGSSAMENLLAELYEQFD
LVIFDTPPVLAVTDAQILANQCNGTILVVSSGKTEIDYANKSKELLLNAKGRLLGVVLNNKKDKKGSYYYYYGGK
>gnl|bykdb|A0A285GM50 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Orenia metallireducens] (length=247 residues).
MFDMFKKNKQKDSRSLLKTRNNELIVKHNPKSPASEAYRSIRTNISFLSPDNPLTKIAITSSGPSEGKSLTIANLAVSMA
QNGKNVIIIDADMRKPMQHKFYDLPNFEGLSNILTGEIDFEDGLRETGIDGLQVITTGTTPPNPAELLNSKRMEEIIKRA
DKEADMVFIDTPPVIAVTDAAVLSNKVDGVILIVASHQTEESMIVRAKEQLDKVNANIIGTIITKYPVNSRGGYYDYYYY
YGNSFKG
>gnl|bykdb|A0A285N9Z0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Terribacillus aidingensis] (length=230 residues).
MAKRKKQFKTNVRSLITKFNPKSPISEQYRTIRTNVEFASVDQKLSTLLVTSSGPSEGKSSTTANLSVVFAQQGKRVLLI
DGDLRKPTVHYTFKLDNRIGLSTVLVGEKAIEETVKETDVPNLDILTCGPIPPNPSELLGSKAMKQMLQLAQETYDVIVF
DTPPVLAVTDAQILANICDGSIIVARSEQTEYEAIQKAKELLEPAHAKLLGIVLNDVAQKKSNSYYYYGS
>gnl|bykdb|A0A285PM55 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Weissella viridescens] (length=253 residues).
MSLFKRHYKEDVETQTNGARLITFTEPKNVISEQLRTVRTNIEYAGAALDKLQVVMFTSSQMSDGKSTVSSNVAVTWAQA
GKKVLIVDADLRRPTVHTTFRLDNRQGLTTILASDLQPKDLVHESMVPGLSALTSGPVPPNPAELLGSPRMAALVEWMRN
NYDIVVLDVPPLNLVTDAQVMLPLADGVVLLITLNQTQKVNLERAVELLNLTSTKVLGVVSRAKRNDGDSGYGYGYGYGY
GYGYGYGYGSTQD
>gnl|bykdb|A0A285PWQ7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Eubacterium] hallii] (length=238 residues).
MKKLNLTIEDMPYAAEEALNRLRVNIKFCGKNTKKILITSGVPNEGKSTVSVHLWKLLAEAGFPTVLVDVDLRKSEHNTI
LKMQGVEEGINHYLSGMAEYEDVVYETNIPNGHWVPIAELLENPSALLEDPRLEELLNRLSEDYRYVIIDTPPLDNISDG
ALIASMSDGAVLVVRCAETPKNIVKQSLQQIDRVGCPLLGVVLNRAEVKGGAFQKYYGRYGKYTKYGSYYGPDEKKIR
>gnl|bykdb|A0A285RHY0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lysinibacillus xyleni] (length=229 residues).
MPNRKKRKSAHNPGERKLVTQIKTDSFIAEQYRTIRTNLQFSLPNEKSKTILVTSSIPGEGKSTTAANLAVVFAQEGKKV
LIIDADMRRPTLHQLFDVFNLEGLSNLLSRQRKFSEVVQETEIENLYIVPSGNIPPNHSELLYSKNLDLLINHVKQIYDI
IIFDTPPLLSVSDALILSNKCDGTLLIVSSGKVNKTDVKKAITSLETSQAKIIGVVLNNLKMNRSSYYY
>gnl|bykdb|A0A285U983 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lysinibacillus acetophenoni] (length=234 residues).
MENTRSDDKQKTSLGPNSLITFLEPKSVIAEQFNTIRSNINFTLPDHDVKKILVTSSTAGEGKSTIASNLAVVFAKEGKR
VLIIDADMRRPTLHSTFDIENRYGLSNTLSKKVTYMESVQETFIFELYILPSGPVPMNPSELLASKTLNKLMEIFEQYFD
VIIFDAPPLLPVTDAQIISNICDGTILVVNSGKVNRADVLKAKSLLEASHAKILGVVLNNFKLPNNHYYYSEYK
>gnl|bykdb|A0A285U9H4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lysinibacillus acetophenoni] (length=238 residues).
MKRGLFKKKHTISKNPQRNLVTFTDSNSIISEQFRTVRTNINFSLPDKELKSIVITSSTPGEGKSTNAANIAVVFAQEGK
KVLLVDADMRKPTIHYTFQLQNSLGLSNVLANRNNLVKVIQESFIYKLHIITSGPIPPNPTELLLSKNMDFFIEEMKKKY
DVIIFDAPPVLSVSDPQILAHKCDGTLLIINTGVTEKENVMKAKEILLSTHAKLLGVILNNYKLTESHYHYQTNYKYE
>gnl|bykdb|A0A285U9V6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lysinibacillus acetophenoni] (length=239 residues).
MKSKSKNYSSNSGRKLITAKRPQHIISEQFRTIRTNLQFSMPDKDLKTLLITSSIPGEGKSTNAANIAIVFAQEGKRVLL
VDADMRKPTLHYTFPMSNSQGLSTILTRQHEFIEAIEVTDVNGLFLIPSGPIPPNPSELLSSKNMELFLETVVQEFDIVI
FDAPPVLSVSDALILSNKCDGTLLIVNSGAVDKSDVVKAKASLQASQATILGAVLNNFKLPNSKYYYDMYGYGDKKGKR
>gnl|bykdb|A0A285UAV9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Salinicoccus kekensis] (length=236 residues).
MNKRNHEEGTAPKYLVVDKQPHATVSEQFRTIRTNIMYSSVNTDIKSVLFTSDLAGSGKSTVAANMAVAYAQAGKKTLLL
DADLRRPTSHETFRVGNREGLSTLIVNDIHLKEVIKGTEFDNLDLITSGPIPPNPAELLSAPKLDAIMVRLVTHYDMVII
DSPPILSVTDAQLLSKNADGVVLVTNVEKNNRDRLNEAKDLLNKSGANILGIVLNGRTAEYKRDGHNYYYQKSQAT
>gnl|bykdb|A0A285USR2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Salinicoccus kekensis] (length=235 residues).
MFGKNKKHTYSSGPRELIVEKQPKSPISEQFRTIRTNIMYSSVDTEIKTVLFTSASPGAGKSTMAANVAVAYAQSGKRTL
LIDADLRRPTTHYTFEATNQRGLSTVIINDMPAADVVKETNIENLEIMTSGPIPPNPSELLASRKTSLLLKTFAMDYDIV
LIDTPPLLAVTDAQVLSKIVDGVILVTNVEANNRGHLQDAKALLEKADANILGVVMNNKNMGRSKDEYYYYYGSE
>gnl|bykdb|A0A290PYQ3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactococcus raffinolactis] (length=235 residues).
MGIFHKGKKDDKPNPVSLITMFNKRSVISEQCRTIRSNIRFSMVDKDLKSLVITSAGPKEGKSTVANNLAVVFADAGLKT
LLVDADLRKPTADLTWALSRDEGLSNLLVDKTSNYENYVSKTKVEGLFVLTSGHVPPNPSELLGTERMQEILQTLTQNFD
LVIFDTPPLTAVTDAQILASRTDGTILVVRERQRDKREIMLSKQLLDMAQANILGVVFNGTKASRDDYYYYGSKS
>gnl|bykdb|A0A290UWP2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Macrococcus sp. IME1552] (length=233 residues).
MFKKSKSKIKNRTEKARKLITLEDPKSPVSEQFRTLRTNISFSTPGSQLQKLLITSSVQQEGKSTVSANLACVFAQNNTK
VLFIDADMRKPTVHNTFGVKNAVGLSTYLTEQSTLKQTIQPTEVENLDIMSAGPVPPNPSELLNSKNLDIMLDELCTYYD
LIIFDSPPVLSVTDSQIISAKVDGMVLVIDKQENNKSNVKEACDLLTVSENSKLLGIVFNNDEYDTDKYYVYQ
>gnl|bykdb|A0A290UZW8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Macrococcus sp. IME1552] (length=235 residues).
MFKKKRSKTNIDQLEIVNRPKSVISEQIRTLRTNILFTSADVQIKKMLVTSSEQGEGKSTISANLAASFAQAGYRTLLVD
ADLRKPTQHKIFEQMNVKGLSNLIAGQVSVEETINVNVLQGLDLLTSGPVPPNPAELLGSLAMEDLLINLSEMYDLVLLD
TPPVLAVADSQILGNLVDGSLLVINSRLTHRDKVIDAKKQLDKSSSKTLGIVLNDLDKKDDGDYYYYYGEKQKSN
>gnl|bykdb|A0A291BNY7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Brevibacillus brevis X23] (length=231 residues).
MSMRRQKPDDRYQKLIAHWEPLSPLVEGYRTLRLNIQFSMGDKLMQTILVTSPGASEGKTITAANLSLMMAKDRKKTVLL
DFDLRNPRVHFTFDMPNLYGISSYFSDMCQIDDIIQPSGVSELSIITAGPIPHNPAEMLGTPRLLELMAYLRHNFDFVIV
DSPPLIVSDAMVLAREMDGCVMVVDASKTKRDSAVKAVEQLKAAGANLLGVVLNNKKVGKREGYYGYGYNA
>gnl|bykdb|A0A291DAY6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus oralis] (length=230 residues).
MPTLEIAHKKLDQARKAEEYYNALRTNIQLSGNNLKVIAITSVKSGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEYLSGTTDLSQGLCETNVENLFVIQAGSVSPNPTALLQSENFATMIDTLHKYFDYIIVDTAPIGVVI
DAAIITQKCDASVLVTAAGETNRRDVQKAKEQLEQTSKPFLGVVLNKFNTSVEKYGSYGAYGNYGNYGKK
>gnl|bykdb|A0A291DIG9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus sp. FDAARGOS_375] (length=234 residues).
MAKIKEQKGTQTHAVSLITLVDPSSPISEQYRTIRTNIQFASSADKHIKTLVITSSGPGEGKSTTSANLAVVFAKSGQRV
LLVDADMRKPTVYKTFSLNNASGLSTVLSTTTSVLEASQKTVIDNLSVLTSGPKPPNPSELLGSSRMNQVIEEAKNLYDV
VIFDMPPVVAVTDAQIMASKADGTLLVVRENVSRKESLTKAKELLNMVHAHILGVVYNGAEHRKDSGYYYYYGN
>gnl|bykdb|A0A292DJI5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus lugdunensis] (length=231 residues).
MTKKNEKRKNLSTPLFTEDNSKSIVSEKVRGIRSNIMFSGVEEVQSIIVTSEKPAAGKSIISANIAITYAQAGYKTLIID
GDMRKPTQHYHFETTNYDGLSNLIIGKSNFDKSIIKTRVKNLDLMTAGPTPPNPSELIGSGAFENILRDLNEIYDFILID
TPPIISVTDAQVYLRFVPNCVMVIDVQNNNKNEVKKAKELIEKVGGRVLGAVLNKTPKEKSSSYYYYGDDE
>gnl|bykdb|A0A292YCP6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Effusibacillus lacus] (length=231 residues).
MYRVRSKQLQVKLICLYDPKSTVAEAYRTLRTNIQFAGVDRQIKTLMVTSAGPGEGKTTTVTNLAIAMAQSGKKVILVDG
DLRKPTIHNTFYISNRLGLTNLLTGQAEFVKVVHRIPELPLDVIPAGSIPPNPADFLGSQPMQRLIASLREEYEMVLVDT
PPILPVTDGQLLASYIDGVLLVLGCNKVQIDHARKAIALLKHVGANVIGSVLNNKKEKGRNSYHYRYYAED
>gnl|bykdb|A0A2A1KEP9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus haemolyticus] (length=236 residues).
MVRKEPKRKKLDTPLYVHDKPKSIVSEKFRGIRSNIMFSSANGEIKSVIITSEKPAAGKSIISANIAVTYAQAGYKTLIV
DGDMRKPTQHYNFETSNYDGLSNLIIGKSDFDKAIRSTRVENLDLLTSGPIPPNPSELIASDRFKKLYSQLIEMYDFILI
DTPPVISVTDAQVFLQLVPECVLVVDAERNNKNEVKKAKDLILKADGHILGAVLNKTPQDKSSNYYYYYGDETNND
>gnl|bykdb|A0A2A2IGH7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Virgibacillus profundi] (length=233 residues).
MARKKNQSRPNSKVRHLIAKLNPKSPITEQYRTVRTNLQFASVDEELTSMLVTSSGPGEGKSMTTANLAVVYAQQGKKVL
LIDADLRKPTVHYTFRLDNLRGLSNILVGGSTLIEAINQTDVDNLDVISCGPIPPNPAELLASRKMKQVLTEAKMSYDIV
IFDTPPVLAVTDAQILANIVDGSLLVVRSKHTEIEAATRAKEALEPASAKLLGTVLNDREKKESNYYYYYGTN
>gnl|bykdb|A0A2A2NZJ8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus toyonensis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A2A2VZV6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. 7705b] (length=227 residues).
MVFRKKKARRGLAQISVLHHKSIVAEQYRTIRTNIEFSSVQTNLRSILVTSSVPGEGKSFSAANLAAVFAQQQEKKVLLV
DADLRKPTINQTFQVENLTGLTNVLVGNASLNETVQKTPIDNLYVLTSGPTPPNPAELLSSKAMGDLISDIYDQFSLVIF
DSPPLLAVADAQILANQTDGSVLVVLSGKTKTDTVLKAKDALEQSNAKLLGALLNKKKMKKSEHYSY
>gnl|bykdb|A0A2A2W0I0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. 7705b] (length=237 residues).
MALRKSKGSWSRKNVIALTEPKSLNSEQYRTIRTNIEFSSVDRQMKSVMITSACPGEGKSTTAANLAVVFAQQGKKVLLI
DADLRKPTVHTTFQLENMTGLTSVLLKKSSLKQAVQMSQEQNLDVLTSGPIPPNPAELLSSKWMEELADEACAAYDMVIF
DTPPILPVADAQILGNVADGSVLVISSGKTEKEKAAKAKEALDSCNSNLLGAIMNGKKRSKHSDYGYYGHEDNFIQK
>gnl|bykdb|A0A2A2X971 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus salivarius] (length=220 residues).
MQKFELRLDDIDFQSQESFKTLRFNVEFSGEKNQVFYITSTYPNEGKSTVSLELALAFSDNGKKALLIDADLRKSVSRQL
IRTGSIEMGLSDYLVGRAQFDDVIAQSNIENFSMIFSGPIPLNPSEILDGERFKHLIETVKEKFDIVIIDTPPMGSVIDA
AVIAKNCDGGIIVINSGQASYRQIRKTKEQLERADSKIIGCVLNKVDSSNNDYYYGYYNK
>gnl|bykdb|A0A2A3AA03 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Salimicrobium sp. WN024] (length=222 residues).
MKRTLIAHENPRSPISEQYRTIRTNLDFASVDSKLHTMTVTSAGPSEGKSLTTANLAIVFAQQGKRVLLVDGDLRKPTVH
YTFRLDNVSGLSNYVAGHGDTVREIAQPTQVDGLDIVTSGPIPPNPSELLGSARMEAFIDEAKQKYDLVIFDSPPVLAVT
DSQVLTSQTDGALLVVRNKKTEKEAANRSKELLEQAKAKVLGIVLNDVPQKESGYYAYYGNR
>gnl|bykdb|A0A2A3AAC2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Salimicrobium sp. WN024] (length=228 residues).
MVRKQTVNKRGSYLVNGRHSLAAEQYKTIRTNLEFASVDRKLRSFFVTSPGPGEGKSTTAANLAVVFSEQGKRVILIDAD
MRKPTLHYTFSSNNGVGLSTYLAGQKTSVTNVIQETAVENLDIITSGPVPPNPAELLGGSSVKTLMNELKSTYDLIIFDT
PPVLSVTDSQLLAPHTEGVVLVVRSRKTRKEEANKAKEVLLHSQARILGAVLNGNEMGRRKKNYYYYA
>gnl|bykdb|A0A2A3TUW9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus brevis] (length=256 residues).
MTTMAWFKRNKKKLDDTSLKYGVGLVSYTEPNGMIAEQFKTIRTNIQFSSVDKQLQSILFTSSEPSEGKSTISNNMAVTW
ADQGTKVVLVDADLRRPAVHRSFDVSNRMGLTNYLSGNADLSAVVRETMVKDLSVITSGPVPPNPAELLGSKRIENLLSE
LTAEFDLVIVDAPPVNTVTDAQLLASRIDGTVLVVPQGIADKNGVRRAKQLLETVHANILGTVMNRVTAQKSVGYYGGNY
YGVSYYGGYYGTDDKK
>gnl|bykdb|A0A2A3TZX6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus brevis] (length=256 residues).
MTTMAWFKRNKKKLDDTSLKYGVGLVSYTEPNGMIAEQFKTIRTNIQFSSVDKQLQSILFTSSEPSEGKSTISNNMAVTW
ADQGTRVVLVDADLRRPTVHRSFDVSNRMGLTNYLSGNADLSAVVRETMVKDLSVITSGPVPPNPAELLGSKRIENLLSE
LTAEFDLVIVDAPPVNTVTDAQLLASRIDGTVLVVPQGIADKNGVRRAKQLLETVHANILGTVMNRVTAQKSVGYYGGNY
YGGSYYGGYYGTDDKK
>gnl|bykdb|A0A2A4BNX5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus simplex] (length=234 residues).
MTLRKEVGFLRSKDEKQVNLIAQTNPKSPITEQYRLIRTNIQFSSVDKEIKTIVVTSSEPNDGKSTTAANLAIVLAQEEK
KVLLVDADLRKPSIHYAFNLSNIHGLTSVLTKKMSLRKTILNSNVSNLDILTSGPIPPNPSELLNSKAIEAAIEELKGMY
DYIIFDTPPVLVVPDSQIVANKCDGVIMVVASGKTNKQSAVKAKELLVKANTSLLGVVLNGVETDNSNYYYYQS
>gnl|bykdb|A0A2A5IRK2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus pumilus] (length=227 residues).
MIFKRKKREKRDLSCISVLNPHSVIAEQFRTIRTNIEFTSIQTRLKSILVTSSLPKEGKSFTAANLAAVFAQQKKRVLLM
DADLRRPAVHEYFDLSHHTGLTNVLLNNCSLEEAILPTPIEHLELLPSGTIPPNPAELLSSSVMKQLFYEIEQQYDMVIV
DSTPLLPVADAKILANRTDGSILVVLSGKTKIAAVKKSKEVLEGTTGKLLGAMLNGKKEKKGRLYMY
>gnl|bykdb|A0A2A5L7G5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus rhamnosus] (length=250 residues).
MSWSIKKVFNRHKEDQETQKNGVMLVAFAEPKHVVSEQFRTVRTNIEFAGAALDKCQVVMFTSSAMSEGKSTVSANVAVT
WAQAGKKVLLIDADLRRPTVHATFRKLNLDGVTTILTGKNKPEEVVEDTFVDNLSMISSGPVPPNPSELLNSKRMGELLE
WARSNFDIIVLDAPPVLAVSDVQVLVPKTDGVVVVANIGKTLKGDLRRTVEVLKLAQAKILGSVERVKAKHGDRGYGYGY
GYGYGYQSQK
>gnl|bykdb|A0A2A5RPS0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactococcus fujiensis JCM 16395] (length=231 residues).
MFKRHEKIDNSRSLITNLNPKSPISEQYRTIRTTLDFKLSDQNLTSFLVTSSEAGVGKSTTIANLAITFAQQGKKVLLVD
ADLRKPSVHTTFKINNRIGLTNVLTHQIKANEAFQKTDFCKDLTVISSGPIPPNPAELLSSAGMKKFITEMSQEYEVILF
DTPPLNAVTDAQIISRLVGGVVLVARAYQTRKDNLIKAKKLLEQINANILGVVIHGIETTDTSYYYYYGAE
>gnl|bykdb|A0A2A5RZC1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactococcus piscium] (length=231 residues).
MSKIQKDVDNNRAIITSVNPQSPISEQYRTIRTTVEFKMADQGIKSFLVTSSEASAGKSTTVANLAVAFAQQGKKVLVID
GDLRKPTVNRTFKVQNRVGLTNVLMNQSSIQDVLQRTRVSENLTVITSGPIPPNPSELLGSNAMKQLLDAVTGHFDLVLV
DTPPLSAVTDAQILTSYLGGVVIVVHANQTKKDDLFKTKKLLEQVNANILGVVLHGTEPNDSASYYYYGVE
>gnl|bykdb|A0A2A5S7E0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactococcus raffinolactis] (length=231 residues).
MAKNKRSIDNNRYIITSVNPQSPISEQYRTIRTTIGFKMADQGIKSFLVTSSEAAAGKSTASANIAVAFAQQGKKVLLID
GDLRKPTVNITFKVQNRVGLTNILMHQSSIEDAIQGTRLSENLTIITSGPIPPNPSELLASSAMKNLIDSVSDLFDVVLI
DTPPLSAVTDAQILSSYVGGAVIVVRAYETKKESLAKTKKMLEQVNANILGVVLHGVDSSESPSYYYYGVE
>gnl|bykdb|A0A2A5TB04 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Eubacterium maltosivorans] (length=244 residues).
MKDSIITYKSPKDPISEAFRNMRTNITFADIDEELRVLTITSTGKGEGKSTIIANYAVALAQSKKKVLLIDCDLRRPRIH
RLFEQPNKRGLTNVLLRECEPTEAIQTTDVENLFIISSGPIPPNPSEILASKRLIELINQFKLAFDYILIDAPPVGVVTD
AAVLSHVTDGYIVVAAISVTNKEGVRLALETLRNVNGNIVGVVANNAPVSKRSGYYYYYSAYEEDQHQSKKEKKQRKIKE
KRGK
>gnl|bykdb|A0A2A7B2T0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Faecalibacterium prausnitzii] (length=243 residues).
MNRLEFRKLPQLSYPVNEAFNTLSTNVSFLGRDIKKIMLTSSHASEGKSFTSLTLCRKLAERGKRVVLVDTDLRRSMITT
VYGVQFAPGSKKQGLSHYLAGIAEKEEVLFHTNVPGMDFIPMGHELLNPIPLLSSERFQNLLDGLAEEYDYVIVDAAPVG
VVIDAAEIAKVCDGILLVVSYNQVHRQELIDAKNQLEQTGCPILGTILNQVDYEGFANKKYYYKSHYSSYYKAYEKEAEE
KKS
>gnl|bykdb|A0A2A7BXG1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus wiedmannii] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNVEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTAVDNLNFLACGPIPPNPAELLGSKSMQELLGQAYSMYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKESAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A2A7G409 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus pseudomycoides] (length=225 residues).
MFFRKGLQSKRKLIAYEKPQSVLAEQYRNIRTNIQFASVDQKIRSLVVTSANPGEGKTTTTANLAVAFAQQGEKILLVDA
DLRKPVLHQLFQVDTIFGLTNVLSKQRTLQECIAKTDIENVHLLPCGPIPPNPAELLSSAMMGELLKEAEKHYDLILFDT
PPVLAVTDAQVVANQCQGTILVLCSGKTEKEQALKAKNVLQHTNTTLLGVVLNGKPQSEHTYGYY
>gnl|bykdb|A0A2A7G473 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus pseudomycoides] (length=234 residues).
MVLKSLFKKKKHHRQRRQLIAYDQPKSPISEQYRNIRTNIEFASVDRKIHSLMVTSANPSEGKTTTTSNIAVVFAQQGKR
VLLVDADLRKPATHQMFQVDNIFGLTNVLTAGERLEKCIQKTAVDKLDFLPSGPIPPNPAELLGSKAMKELLSQTYSLYD
LVIFDLPPILPVTDAQIMASQCDASVLVVRSEQTEKEAALKAKTLLESAKGKLLGVVLNDREREQSLYYYYGAN
>gnl|bykdb|A0A2A7GXR2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. AFS098217] (length=234 residues).
MVLKSLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLQSLIVTSANSGEGKTITAANMAVVFAQQGKK
VLLIDADMRKPALHQMFQVDNIFGLTNVLTQSKHLETCIQKTSVDNLHFLSCGPIPPNPAELLGSKSMQELLTQAYSMYD
LVIIDMPPILAVTDAQIMANQCDASVLVVRSESTEKGAAVKAKGLLESAKGKLLGVVLNDCEREQSLYYYHGAN
>gnl|bykdb|A0A2A7HVY2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=229 residues).
MVLKKKILRARRQLIAYEQPKSSVSEQYRNIRTNIEFASVDKKIRSLIVTSANQSEGKTTTAANIAIVFAQQGKKVLLID
ADLRKPALHQMMQVDNMFGLTSVLTRSKTLETCVKQTKIGNLTLLPCGPIPPNPAELLGASSMKDLLSEAYGTYDLVIFD
TSPILPVTDAQIMANQCDASVLVIRSGATEKEAALKAKQSLDSAKGTLLGVVLNDKEQNGSEYYYYGSN
>gnl|bykdb|A0A2A7IHX8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. AFS096315] (length=231 residues).
MVKKTAKESLKRFLITLTNPKSPFAEQYRTVRTNIQFSSIDKKIKSILVTSSEPSEGKTTTIANLAVTYAQQEKKVLLVD
ADLRKPQLHSDFKLENFKGLTTAIAQEKPLKEVIQKTEINNLSILTSGPIPPNPSELLSSEKMKKLIAQMYEQFDVILFD
APPLLAVTDAQIISQVCDGTILVVRRGYTAKEKIKKAKELLTLVNANILGVVLNRAEQGKDGYYDYYGSEK
>gnl|bykdb|A0A2A7KEA0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus pseudomycoides] (length=234 residues).
MVLKSLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLQSLIVTSANSGEGKTITAANMAVVFAQQGKK
VLLIDADMRKPALHQMFQVDNIFGLTNVLTQSKHLETCIQKTSVDNLHFLSCGPIPPNPAELLGSKSMQELLTQAYSMYD
LVIIDMPPILAVTDAQIMANQCDASVLVVRSESTEKGAAVKAKGLLESAKGKLLGVVLNDCEREQSLYYYHGAN
>gnl|bykdb|A0A2A7PXP6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus aviarius] (length=252 residues).
MRFFKRNKTKLDEDSMKYGVALITKNDPKSAISEQYRTIRTNLKFSFMKDNFKILAVMSALPSEGKSTVSANLAVSWAEQ
GRKTLLIDVDLRRPTVHQTFKVSNKYGISNIITSSASSVNISEMIDKTDNDYLDILTSGPIPPNPAELLESERFARLLEF
LKEKYDFIILDAPPVDTVTDGQIVAAKADGVALVVPQRIARKDAVLQAVRLLNKVDANILGVIMNRFTTGETGGDYYGGY
YGGYYGVNEEKE
>gnl|bykdb|A0A2A7QCB6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus sp. UMNPBX18] (length=248 residues).
MSLFKRKQQHSADTMDNGAKLITVAHPKSPISEQFRTIRTNINFMAIDKPIKTLAMTSANMSEGKSTVTDNVAVVWAQTG
QKVLLIDSDLRRPTIHATFNKSNQHGLTTILTSGTNSVDLREIIQPSGVNNLDILTSGPTPPNPAELLNSQRMKTLLDTV
KGIYDMVIVDVPPMLEVTDTQILSRHLDAIVLVVKQGQTQKLAVKRTVELLNLAHANLLGYVMNDVNTDGDAAYGYGYGY
GYGEDTNK
>gnl|bykdb|A0A2A7QDH8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus sp. UMNPBX18] (length=249 residues).
MSIFHRRKNKATNDTLVNGAKLITVAHPKSPISEQFRTIRTNINFMAIDKPIKTLAMTSANVSEGKSTITDNVAVVWAQT
GQRVLLIDADLRRPTLHATFNKSNQEGLTTILTSGTNSIDLRQIVQPSGVENLDILTSGPVPPNPAELLNSQRMKTLIES
VKSVYDMVIVDVPPMLEVTDTQVLSHYLDAIVLVVKEGQTQKLAVKRAVELLNLAHANLLGYVMNDVNTDGDAGYGYGYG
YGYGSGSAQ
>gnl|bykdb|A0A2A7QEJ5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus sp. UMNPBX17] (length=268 residues).
MSLFKKKRGTDETIKNGANLITVADPKGPVTEQFRTIRTNINFMAVDHDIKSVAFTSANISEGKSTVAANVAVTYAQAGR
KVLLIDADLRRPTVHRTFNLSNHVGLSTVISSTAKEVDLDDVVQDSGIADLAILPAGPTPPNPSELIGSKRMQDFISLVE
DHYDMVIIDLAPVLEVSDTQELARRLDGIILIVRQGKTQKAAIKRAVEMLNFSKAKVLGFIMNDISSDNAGYGYGYGYGY
GYGYGYGYGYGYGEEDKKKKGFFSGRKK
>gnl|bykdb|A0A2A7QVG8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus sp. UMNPBX6] (length=262 residues).
MSLFKKKRGTDETIKNGANLITVADPKGPVTEQFRTIRTNINFMAVDHDIKSVAFTSANISEGKSTVAANVAVTYAQAGR
KVLLIDADLRRPTVHRTFNLSNHVGLSTVISSTAKEVDLDDVVQDSGIADLAILPAGPTPPNPSELIGSKRMQDFISLVE
DHYDMVIIDLAPVLEVSDTQELARRLDGVILLVRQGKTQKAAIKRAVEMLNFSKAKVLGFIMNDISSDNAGYGYGYGYGY
GYGYGYGEEDKKKKGFFSGNKK
>gnl|bykdb|A0A2A7QZD6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus sp. UMNPBX5] (length=253 residues).
MSLFKKKTNVSNETIRYGVKLITVKDPKNVISEQFRTIRTNISFMGIDHPIKTLAFTSANISEGKSTVTDNIAVVWANAG
KRVLLIDADLRRPTLHQTFNISNREGLTTILTSDALEMDITNMIKETEIDNLSILTSGPIPPNPAELLNSQRMQALIASV
EQSYDVVILDVPPILAVSDTQALVSHLDGVVLVVKMGQTEKAGLKRSVELLKLAHANILGYVMNDVGRNGDSAYGYGYGY
GYGYGYGYSSDNK
>gnl|bykdb|A0A2A7R7D9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus sp. UMNPBX3] (length=246 residues).
MSLFHRTQQQPTDTMDNGAKLITVAHPKSPISEQFRTIRTNINFMAIDKPIKTLAMTSANVSEGKSTVTDNVAVVWAQTG
QKVLLIDSDLRRPTLHATFNKSNQHGLTTILTSGTNSVDLREIIQPSGVENLDILTAGPIPPNPAELLNSQRMKTLLDTV
KGIYDMVIVDVPPMLEVTDTQILSRHLDAIVLIVKQGQTQKLAVKRTVELLNLAHANLLGYVMNDVNAESDAAYGYGYGY
GEDTNK
>gnl|bykdb|A0A2A7RFE5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus sp. UMNPBX1] (length=259 residues).
MSLFRKKRGTDDTIKHGAQLITVADPRSAVSEQFRTIRANINFMSVDKEIHTLAFTSANISEGKSTVTSNVAITYAQAGR
KTLLIDGDLRRPTLHSTFNVKNNTGLTTVLTSEADEINLNDVVEESGIDNLSILTSGPIPPNPAELIGSRRMETFIELVK
SHYDMVIIDLPPVLEVSDTQELASHLDGVVLVVRQGVTQKAGITRAVQMLKFAKARILGYVMNDIRAENGGYGYGYGYGY
GYGAEKKKGLFGRKKSDGQ
>gnl|bykdb|A0A2A7T0T8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus faecium] (length=229 residues).
MKKKKIAASPVPLVALADQSITAEKYRTIRSNIQFAAIDRELNTLVITSSGPDEGKSITAANLAVVFANSGKQVLLVDAD
LRKPTVALSFQLPHNEGLSNLLSERERIADNYITETHIENLWVLPSGPKPPNPSEVLGTKRMEEIIEELILDFDLVIFDM
PPVATVTDAQILAAKTDGTLLVVRERKTKKQELVKAKELLQIAKANILGVVYNGTKKESDLTYYYQSLE
>gnl|bykdb|A0A2A7W987 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus butanolivorans] (length=234 residues).
MTIRKEAGFLRSKDEKQVNLIAQTNPKSPITEQYRLIRTNIQFSSVDKEIKTIVVTSAEPNDGKSTTAGNLAIVLAQEEK
KVLLVDADLRKPSIHYAFNLSNIHGLTSVLTKKMDLRKTILNSNVSNLDILTSGPIPPNPSELLNSKAIETAINELKDIY
DYIIFDTPPVLVVTDSQIVSNKCDGVIMVVASGKTNKQSAVKAKELLEKANTALLGAVLNGMESDTSNYYYYQH
>gnl|bykdb|A0A2A7WZF6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. AFS002410] (length=231 residues).
MSKKTAKETLKRFLITLTNPKSPFAEQYRTVRTNIQFSSIDKKVKSILVTSSEPSEGKTTTIANLAVTYAQQGKKVLLVD
ADLRKPQLHSDFKLENFKGLTTAIAQEKSLKDFIQKSQIDNLSILTSGPIPPNPSELLSSEKMKNLIAIMYEQFDIVLFD
APPLLAVTDAQIISQVCDGTILVVRRGHASKEKIKKAKELLTLVNANILGVVLNRAEQEKDGYYYYYGNEK
>gnl|bykdb|A0A2A7XFC7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus wiedmannii] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMSVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSMYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKEAAVKAKGLLESAKGKLLGVVLNDREREQSLYYYYGAN
>gnl|bykdb|A0A2A7ZCX7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus mycoides] (length=234 residues).
MVLNSLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFASVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKK
VLLIDADMRKPAMHQMFQVDNIVGLTNVLTHSQRLEKCIQTTNVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSMYD
LVIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREHGLYYYYGAN
>gnl|bykdb|A0A2A7ZNU6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSEHLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDRERENGLYYYYGAN
>gnl|bykdb|A0A2A8B956 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus pseudomycoides] (length=229 residues).
MVLKKKASRARRRLIAYEQPKSFVSEQYRNVRTNIEFASVDKKIRSLIVTSANSSEGKTTTAANIAIVFAQQGKKVLLID
ADLRKPALHHMLQVENVFGLTSVLTRSKKLETCVENTKIRNLNFLPCGPIPPNPAELLGSNSMKDLLSEAYGMYDLVIFD
TSPILPVTDAQVMANQCDASVLVVRSGVTEKDTAIKAKQALDGAKGTLLGVILNDKEQTGSEYYYYSSN
>gnl|bykdb|A0A2A8EP65 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus wiedmannii] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSMYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKESAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A2A8FHS4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. AFS026049] (length=225 residues).
MRSKDKKQVNLIAKTNPKSPITEQYRLIRTNIQFSSVDKDIQTIVVTSSEPNDGKSTTAANLAIVLAQEEKKVVLVDADL
RKPSAHYAFSLSNIEGLTSVLTKKMSIEKALMNTNVPNLEILTSGPIPPNPSELLNSKAIETAIDELKGMYDYIIFDTPP
VLVVPDAQIVANKCDGVIMVVASGKTNKQSAVKAKELLLKANTSLLGVVLNGVETDNSNYYYYQS
>gnl|bykdb|A0A2A8HI61 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus toyonensis] (length=233 residues).
MALNLFKKKKNHRQRHQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSEATEKESAVKAKGLLELAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A2A8IKL6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. AFS006103] (length=256 residues).
MTKRWKKQLRVVRQENQRQEVRNLALKKKKVNSKDASRKLVTAIDPKSPISEQYRTIRTNIQYSSIDEEIRAIMVTSSGP
GEGKSTTAANLAVTFAQLGKKVLLVDADLRKPTVHHTFAVNNLFGFTTVLTKQKTLEKTVLETEEQDLFILTSGPIPPNP
AELLSSKSMEQFIEEAKTQFEYIIFDTPPLLAVTDPQILANKCDGSIMVVYSERTEIDQAKKAKELLENAQSKLLGVVLN
HKEVQNGDYYYYYGAK
>gnl|bykdb|A0A2A8IM05 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. AFS006103] (length=229 residues).
MVVSKTNNGKRPIQLITHENPQSPITEQYRQIRNNIRFASVDKEIKTIVVTSPEPSDGKSTTAANLAIILAQQEKRVILV
DADLRRPSIHYAFSVSNLGGLTSVLTWQKSLKTEITTTQVPNLDILTCGPVPPNPSELLNSKAMERVIEELKESYEYVVF
DTPPILAVTDSQIMANKCDGVVLVVCSRKTKNYKGLYAKELLEKANSHLLGVVVNGVKVKRNWYYGQYY
>gnl|bykdb|A0A2A8INT6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=234 residues).
MALNSLFKKKKNHRQRRQLIAHQQPKSPISEQFRNIRTNVEFASVDTNLHSIMVTSANPSEGKTTITSNMAVVFAQQGKK
VLLIDADMRKPAMHQVFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLYFLACGPVPPNPAELLGSKSMQELLAQAYSMYD
LVIFDLPPILAVTDAQIMANVCDASILVVRSEATEKEAAVKAKGLLQLAKGKLLGVVLNDCEREHGLYYYYGAN
>gnl|bykdb|A0A2A8KY26 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus anthracis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNVEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSMYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A2A8MY29 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus wiedmannii] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSLYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A2A8PIZ7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSIDNLSFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A2A8PZ54 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFASVDTNLHSFMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCIQTTAVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSMYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGTN
>gnl|bykdb|A0A2A8R8C3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFASVDTNLHSFMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCIQTTAVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSMYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESARGKLLGVVLNDREREQGLYYYYGTN
>gnl|bykdb|A0A2A8RUD3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=229 residues).
MVLKKKASRVRRQLIAYEKPKSSVSEQYRNVRTNIEFASVDKKIRSLIVTSANSSEGKTTTAANIAIVFAQQGKKVLLID
ADLRKPALHQMLQIENVFGLTNVLTRSKKLETCVANTQIRNLNFLPCGPIPPNPAELLGANSMKDLLSEAYGMYDLVIFD
TSPILPVTDAQIMANQCDASVLVIRSGVTEKDTAIKAKQALDGAKGTLLGIILNDKEQTGSEYYYYGSN
>gnl|bykdb|A0A2A8S7F3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. AFS018417] (length=224 residues).
MFGKQRQTERKLVAHYEPKSQIAEQYRNIRTNIQFTAVDSDVRSIVVTSSCTGEGKTTTIANLAVVFGQQGKQVLVIDAD
MRKSKLHEMFHIHNQFGLTNVLSGQASFEQCVHKTEIENVSFLPSGPIPPNPAELLSFRMMGEMLEQAYAAFDIVLIDTP
PVLAVTDAQIVANRCDGIILVVRSEVTEKAQIVKTKQLLDNASGKLLGVVLNDKKQQTDQYGYY
>gnl|bykdb|A0A2A8S7K5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. AFS018417] (length=234 residues).
MALKGLFQKNNNYRQRRQLIAHNQPKSPVAEQFRNIRTNIEFAAIDTNIHSLMVTSPSPSEGKTTTVGNIAVVFAQQGKR
VLLVDADLRKPALHQMFQVDNIFGLTNILTHGERFEKCVQTTNVENLYFLPCGPIPPNPAELLGSKTMKEFLGQAYNMYD
LVIFDLPPILPVSDAQIMANQCDASLLVVRSAYTEKEAALKAKRLLEAAKGKLLGVVLNDREREQSLYYYYGTN
>gnl|bykdb|A0A2A8T7I8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus megaterium] (length=224 residues).
MLTLKRRLLAHNSPKDPVAEQYRTIRTNIQFSGTDEEIKSLLLTSSGPSEGKSTTAANLAAVYAQQGLNVLLIDGDLRKP
TAHYTFRLENHTGLTNVLTKQSQLGQAVQSTEVPNLYVLTSGPIPPNPSELLASKQMGEVLAEMKERFDMVIFDTPPILA
VADAQILANQVDASLLIVSSSKTEKDAALKAKELLTQAKSKLLGAVLNNRKMEEGNYYYYYGSN
>gnl|bykdb|A0A2A8TFM0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. AFS017274] (length=235 residues).
MKSLARNKRYKMTEIKKRSSISMLKSKSPVVEQYRTIRTNLQFSAVEKDIRSMIFTSANAGEGKSTTSINVAAVFAQQGK
RILIIDADLRKPSVHTNFNMENYLGLTNIISKQNQLLDAVQPSIYPNLDVLTSGPIPPNPSELLGSNGMVTVLDEAKLNY
DLVILDTPPVNAVTDAQVLANMTDGVVLVVSSGRTEIQQAKKAKELLENANAKLLGAILNKKKQKHPDEYYYYGR
>gnl|bykdb|A0A2A8TS72 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. AFS017274] (length=234 residues).
MTLRKEVGFLRSKDEKQVNLIAQTNPKSPITEQYRLIRTNIQFSSVDKEIKTIVVTSSEPNDGKSTTAANLAIVLAQEEK
NVLLVDADLRKPSVHYAFNLSNIHGLTSVLTKKMDLRKTILNSNVSNLDILTSGPIPPNPSELLNSKAIETAIDELKGKY
DYIIFDTPPVLVVPDSQIVANKCDGVIMVVASGKTNKQSAVKAKELLVKANTSLLGVVLNGVETYNSNYYYYQS
>gnl|bykdb|A0A2A8TWB4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=234 residues).
MVLKSLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFASVDKNIHSLMITSANPSEGKTTTTANMAVVFAQQGKK
VLLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTAVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSMYD
LVIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDRESEQGSYYYYGAN
>gnl|bykdb|A0A2A8UY74 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. AFS015896] (length=234 residues).
MALNSLFKKKKNHRQRRQLIAHQQPKSPISEQFRNIRTNVEFASVDTNLHSIMVTSANPSEGKTTITSNMAVVFAQQGKK
VLLIDADMRKPAMHQVFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLYFLACGPVPPNPAELLGSKSMQELLAQAYSMYD
LVIFDLPPILAVTDAQIMANVCDASILVVRSEATEKEAAVKAKGLLQLAKGKLLGVVLNDCEREHGLYYYYGAN
>gnl|bykdb|A0A2A8V8W0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. AFS015802] (length=232 residues).
MAKNKKKLLMNTKRKLVTKTDPKSPISEQYKTIRTNINFSSVDREIRSLLVTSAGPGEGKSTTAANLAVVFAQQGKKVLL
VDSDMRKPTAHYTFNLTNTFGLTTVLTKQHTLSEVTNPSDVENLDILTCGPVPPNPAELMSSKAMEHFLVEAYQAYDLLI
FDTPPILAVTDAQVLANQVHGTVLVVSSGTTEIDSAVKAKDLLSSTKGKLLGVVLNNREVKDTSYYYYYGKK
>gnl|bykdb|A0A2A8VX90 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus megaterium] (length=237 residues).
MGRKQKKANNDKFLTLKRRLLAHNSPKAPVAEQYRTIRTNIQFSNTDEAITSIVLTSSGPGEGKSTTASNLATVYAQQGL
RVLLIDADLRKPTAHYTFRVENHIGLTNVLTNQSTLGKAVQATEVPELFLLTSGPIPPNPAELLASNRMAELLKEMKAEF
DMVVFDTPPVLAVSDAQILANQVDGTILVVSSGKTDKEAAVKAKELLHKANAKVLGAVLNNRKLDEGSDYYYYYGAN
>gnl|bykdb|A0A2A8WVM0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus anthracis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQKTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSMYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKESAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A2A8X2X5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=234 residues).
MALNSLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFASVDKNIHSLMITSANPSEGKTTTTANMAVVFAQQGKK
VLLIDADMRKPVMHQMFQVDNIFGLTNVLTHSERLEKCVQTTTVENLHLLACGPIPPNPAELLSSKSMQEFLAQAYSMYD
LVIFDLPPILAVTDAQIMANVCDASILVVRSESTEKEAAIKAKGLLESAKGKLLGVVLNDLERENGLYYYYGAN
>gnl|bykdb|A0A2A8Z563 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=229 residues).
MVLKKKILRARRQLIAYEQPKSAVSEQYRNIRTNIEFASVDKKIRSLIVTSANQSEGKTTTAANIATVFAQQGKKVLLID
ADLRKPALHQMMQVDNIFGLTSVLTRSKTLETCVTQTKIGNLTFLPCGPIPPNPAELLGASSMKDLLSEAYGTYDLVIFD
TSPILPVTDAQIMANQCDASVLVIRSGATEKEAALKAKQSLDSAKGKLLGVVLNDKEQNGSEYYYYSSN
>gnl|bykdb|A0A2A9A1Y9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNVEFASVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSLYDL
VIFDLPPMLAVTDAQIMANVCDASILVVRSESTEKESAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGTN
>gnl|bykdb|A0A2A9B6J3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A2A9BRE3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. es.034] (length=234 residues).
MGKNKKLKKLMANTKRKLVTQISPKSPISEQYKTIRTNINFSSVDREMRSIMVTSSGPGEGKSTTAANMAVVFAQQGKSV
LLVDADMRKPTAHYTFNVTNTFGLTTVLTRQKMLREVIHPTEVDHLDLLTCGPVPPNPAELLSSRSMEEFLVDVYEDYDM
VIFDTPPVLAVTDAQVLANQCHGTILVVSSGTTEIESAQKGKELLQSAKGKLLGVILNNREIKDTSYYYYYGKR
>gnl|bykdb|A0A2A9IC54 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactococcus lactis] (length=231 residues).
MAKNKRRIDNNRYIITSVNPQSPISEQYRTIRTTIDFKMADQGIKSFLVTSSEAAAGKSTASANLAVAFAQQGKKVLLID
GDLRKPTVNITFKVQNRVGLTNILMHQSSIEDAIQGTRISENLTIITSGPIPPNPSELLASSAMKDLIDSVSDFFDVVLI
DTPPLSAVTDAQILSSYVGGVVLVVRAYETKKESLAKTKKILEQVNANILGVILHGVDSSDSPSYYYYGVE
>gnl|bykdb|A0A2A9IPX8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactococcus lactis] (length=231 residues).
MAKNKRSIDNNRYIITSVNPQSPISEQYRTIRTTIDFKMADQGIKSFLVTSSEAAAGKSTASANIAVAFAQQGKKVLLID
GDLRKPTVNITFKVQNRVGLTNILMHQSSIEDAIQGTRLSENLTIITSGPIPPNPSELLASSAMKDLIDSVSDFFDVILI
DTPPLSAVTDAQILSSYVGGVVLVVRAYETKKESLAKTKKILEQVNANILGVVLHGVDSSESPSYYYYGVE
>gnl|bykdb|A0A2A9R9B1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. AFS088145] (length=231 residues).
MVKKATKEKLKRFLITLTNPKSPFAEQYRTVRTNIQFSSIDKKIKSILVTSSEPSEGKTTTIANLAVTYAQQEKKVLLVD
ADLRKPQLHSDFKLENFKGLTTAIAHDKSLKEVIQKTDISNLSILTSGPIPPNPSELLSSGKMKNLIAQMYEQYDVILFD
APPLLAVTDAQIISQVCDGTILVVRRGYTAKEKIKKAKELLTLVNANILGVVLNRAEQDKDGYYDYYGSEK
>gnl|bykdb|A0A2A9T8H1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDMNLHSLLVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTYSERLEKCVQTTSIDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A2A9Y594 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus megaterium] (length=236 residues).
MARKKKNQKNDKVLTLKRRLLAHNSPKDPVAEQYRTIRTNVQFSGADEEIKSLVLTSSGQAEGKSTTAANLAIVYAQQGL
KVLLIDSDLRKPTAHYTFRLENHTGLTNVLTRQSTLGQGVQETEVPDLYMLTSGPIPPNPSELLASNQMKEMLSEAKQQF
DMVIFDTPPILAVADAQILANQVDASILIVSSGKTEIGAALKAKELLTQAKSKLLGAVLNDRKIEEGNYYYYYGSN
>gnl|bykdb|A0A2A9ZI47 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus megaterium] (length=224 residues).
MLTLKRRLLAHNSPKDPVAEQYRTIRTNIQFSGVDQEIKSLLLTSSGTAEGKSTTASNLAAVYAQQGLKVLLVDADLRKP
TAHYTFRLENHSGLTNVLTRQSSLGQAVQETEVSDLYVLTSGPVPPNPSELLASSQMEELLKEMKQQFDMIIFDTPPILA
VADAQILANQLDASILVVSSGKTEKEAALKAKELLVHAKSKLLGAVLNNRKADSGNYYYYYGSN
>gnl|bykdb|A0A2B0AD07 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTNSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A2B0EJ24 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus megaterium] (length=236 residues).
MARKRKEHKNDKLLTLKRRLLAHNSPKDPVAEQYRTIRTNIQFSNADQDIKSIVLTSTGPGEGKSTTASNLATVYAQQGL
RVLLIDADLRKPTAHYTFRLENHVGLTNVLTKQSTLGQAVQGTEVPELFLLTSGPIPPNPAELLASNNMTELLKEMKEEF
DIVIFDTPPVLAVADAQILANQVEGSILVVSSGKTDKEAAIKAKELLLKANAKVLGAVLNNRKMEEGSDYYYYYGV
>gnl|bykdb|A0A2B0KN53 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=234 residues).
MALNSLLKKKKNYRQRRQLIAHQQPKSPISEQYRNIRTNVEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKK
VLLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQATAVENLSFLACGPIPPNPAELLGSKSMQELLAQAYSIYD
LVIFDLPPILAVTDAQIMANQCDASILVVRSESTEKESAVKAKGLLESAKGKLLGVVLNDRERENGLYYYYGAN
>gnl|bykdb|A0A2B0KZ90 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=229 residues).
MVLKKKILRARRQLIAYEQPKSSVSEQYRNIRTNIEFASVDKKIRSLIVTSANQSEGKTTTAANIAIVFAQQGKKVLLID
ADLRRPALHQMMQVDNIFGLTNVLTRSKTLGTCVTQTKIGNLTFLPCGPIPPNPAELLGASSMKDLLSEAYGTYDLVIFD
TSPILPVTDAQIMANQCDASVLVIRSGATEKEAALKAKQSLDSAKGTLLGVVLNDKEQNGSEYYYYGSN
>gnl|bykdb|A0A2B0MA26 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=229 residues).
MVLKKKAIRGRRQLIAYEQPKSSVSEQYRNIRTNIEFASVDKKIRSLIVTSASSSEGKTTTAANIAVVFAQQGKKVLLVD
ADLRKPALHQMLQVENVFGLTSVLTRSKTLEACVKKTQIGSLDFLPCGPIPPNPAELLGASSMKELLSEAYGMYDFVIFD
TSPILPVTDAQIMANQCDASVLVIRSGSTEREAALKAKQALDSAKGKLLGVILNDKEQNGSEYYYYGSN
>gnl|bykdb|A0A2B0NEL8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus megaterium] (length=236 residues).
MARKKKNSKNDKLLTLKRRLLAHNSPKDPVAEQYRTIRTNIQFSGTDEEIKSLVLTSSGQAEGKSTTAANLAIVYAQQGL
KVLLVDADLRRPTSHYTFRLENHTGLTNVLTRQSTLGQAVQNTEVPDLYLLTSGPIPPNPSELLAANQMKEMLSEAKQQF
DMVIFDTPPILAVADAQILANQVDASILIVSSGKTEKDAALKAKELLTQAKSKLLGAVLNDRKIEEGNYYYYYGSN
>gnl|bykdb|A0A2B0QEH4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus megaterium] (length=236 residues).
MARKNKAQKNDKMLTLKRRLLAHNSPKDPVAEQYRTIRTNIQFSNVDQDIKTIVLTSSGAEEGKSTTSANLATVYAQQGL
KVLLIDADLRKPTGHYTFRLENHIGLTNVLTRQSTLAQAVQESEIPHLSVLTSGPIPPNPSELLASAQMAELLKEMKEQF
DMIIFDTPPILAVADAQILANQVDGTILVVSSGKTEKDAALKSKELLSNAQGKLLGVVLNNRKVEEGNYYYYYGTN
>gnl|bykdb|A0A2B0R5B9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus megaterium] (length=236 residues).
MARKNKAQKNDKMLTLKRRLLAHNSPKDPVAEQYRTIRTNIQFSNVDQDIKTIVVTSSGAEEGKSTTTSNLATVYAQQGL
NVLLIDADLRKPTGHYTFRLENHIGLTNVLTRQSTLAQAVQESEIPHLSVLTSGPIPPNPSELLASSQMAELLKEMKEQF
DMIIFDTPPILAVADAQILANQVDGTILVVSSGKTEKDAALKSKELLSNAQGKLLGVVLNNRKVEEGNYYYYYGTN
>gnl|bykdb|A0A2B0VFJ0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTNSERLENCVQTTSVENLKFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDRERENGLYYYYGAN
>gnl|bykdb|A0A2B0Y1Y0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus megaterium] (length=236 residues).
MARKNKAQKNDKMLTLKRRLLAHNSPKDPVAEQYRTIRTNIQFSNVDQDIKRIVVTSSGAEEGKSTTASNLATVYAQQGL
NVLLIDADLRKPTGHYTFRLENHIGLTNVLTRQSTLAQAVQESEIPHLSVLTSGPIPPNPSELLASAQMAELLKEMKKQF
DMIIFDTPPILAVADAQILANQVDGTILVVSSGKTEKDAALKSKELLSNAQGKLLGVVLNNRKVEEGNYYYYYGTN
>gnl|bykdb|A0A2B1GT15 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. AFS077874] (length=231 residues).
MVKKTAKESLKRFLITLTNPKSPFAEQYRTVRTNIQFSSIDKKIKSILVTSSEPSEGKTTTIANLAVTYAQQEKKVLLVD
ADLRKPQLHSDFKLENFKGLTTAIAQEKPLKEVIQKTEISNLSILTSGPIPPNPSELLSSEKMKKLIAQMYEQYDVILFD
APPLLAVTDAQIISQVCDGTILVVRRGYTAKEKIKKAKELLTLVNANILGVVLNRAEQGKDGYYDYYGSEK
>gnl|bykdb|A0A2B1PFD6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTNSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDRERENGLYYYYGAN
>gnl|bykdb|A0A2B1Q7E7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. AFS076308] (length=235 residues).
MAPKKKNTQSNPNRKLITAVAPKNAISEQYRTIRTNIQYSSVDEEIRAIMVTSSGPSEGKSTTAANLAVTFAQQGKKVLL
VDADLRKPTIHHTFQVNNIYGFTTVLTKQTTIAKAVVETEVNDLFILTCGPIPPNPAELLSSKSMEQFIADAKEMFDYVI
FDTPPLLAVADPQILANQCDGTILVVYSEKTEIEQAKKSKELLQNAQGKLLGVVLNHKEIKKNDYYYYYGTYGTK
>gnl|bykdb|A0A2B1SZ67 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus megaterium] (length=224 residues).
MLTLKRRLLAHNSPKDPVAEQYRTIRTNIQFSGTDEEIKSLLLTSSGPSEGKSTTAANLAAVYAQQGLNVLLIDGDLRKP
TAHYTFRLENHTGLTNVLTKQSQLGQAVQSTEVPNLYVLTSGPIPPNPSELLASKQMGEVLTEMKERFDMVIFDTPPILA
VADAQILANQVDASLLIVSSSKTEKDAALKAKELLTQAKSKLLGAVLNNRKMEEGNYYYYYGSN
>gnl|bykdb|A0A2B1YC94 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=229 residues).
MVLKKKAIRGRRQLIAYEQPKSSVSEQYRNIRTNIEFASVDKKIRSLIVTSANSSEGKTTTAANLAVVFAQQGKKVLLID
ADLRKPALHQMLQIDNMFGLTSVLTRSKTLEACVKKTQIGSLDFLPCGPIPPNPAELLGASSMKDLLSEAYGTYDLVVFD
TSPILPVTDAQIMANQCDASVLVIRSGATEKEAALKAKQALDSAQGKLLGVVLNDKEQSGSEYYYYGSN
>gnl|bykdb|A0A2B2AY04 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus megaterium] (length=236 residues).
MARKKKDQKNDKMLTLKRRLLAHNSPKDPVAEQYRTIRTNIQFSGADEEIKSLVLTSSGPSEGKSTTAANLAAVYAQQGI
NVLLIDGDLRKPTAHYTFRLENHTGLTNVLTKQSQLGQAVQSTEVPNLYVLTSGPIPPNPSELLASKQMGEVLAEMKERF
DMVIFDTPPILAVADAQILANQVDASLLIVSSAKTEKDAALKAKDLLTQAKSKLLGAVLNNRKMKEGNYYYYYGSN
>gnl|bykdb|A0A2B2BAN8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus megaterium] (length=236 residues).
MARKKKEQRNDKMLTLKRRLLAHNSPKDPVAEQYRTIRTNIQFSGTDEEIKSLVLTSSGPSEGKSTTAANLAAVYAQQGL
NVLLIDGDLRKPTAHYTFRLENHTGLTNVLTKQSQLGQAVQSTEVPNLYVLTSGPIPPNPSELLASKQMGEVLAEMKERF
DMVIFDTPPILAVADAQILANQVDASLLIVSSSKTEKEAALKAKELLTQAKSKLLGAVLNNRKMEEGNYYYYYGSN
>gnl|bykdb|A0A2B2CFS6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. AFS073361] (length=214 residues).
MIDSKSPISEQYRTIRTNIQYSSVDHDVKSLMVTSTGPGEGKSTTVANLAVVFAQQGKKVLLIDADLRKPTVHYTFNQSN
TSGLTSVLTKQVDLVKAVLGTEEENLYILTSGPIPPNPAELLSSRAMEQFFHDAEALFDIILFDTPPVLAVTDAQILANK
CEGTILVVSSGKTEKEMVVKAKELLDAAQSKLLGVVLNNKKLQNNNYYYYYGAK
>gnl|bykdb|A0A2B2DE33 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus megaterium] (length=225 residues).
MLTLKRRLLAHNSPKDPVAEQYRTIRTNIQFSGVDQEIKSLLLTSSGTAEGKSTTASNLAAVYAQQGLKVLLVDADLRKP
TAHYTFRLENHSGLTNVLTRQSSLGQAVQETEVRDLYVLTSGPIPPNPSELLASHQMEELLKEMKQQFDMVIFDTPPILA
VADAQILANQVDASILIVSSGKTEKEAALKAKELLVHAKSKLLGAVLNNRKADNGSYYYYYYESN
>gnl|bykdb|A0A2B2E826 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus megaterium] (length=237 residues).
MARKGKESKNDKVLTLKRRLLAHNSPKDPVVEQYRTIRTNIQFSGVDQDIKSLLLTSSGTAEGKSTTASNLGAVYAQQGL
KVLLVDADLRKPTAHYTFRLENHTGLTNVLTRQSNLGQAVQKTEVKGLYVLTSGPIPPNPSELLASHQMEESLQEIKQEF
DIVIFDTPPILAVADAQILANQVDASILVVSSGKTEKDRALKAKELLVHAKSKLLGAVLNNRKADSSSYYYYYYGSN
>gnl|bykdb|A0A2B2EBN6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLENCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A2B2GKZ8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTNSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A2B2JQB3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A2B2NMA4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQLRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPDMHKMFLIDNIVGLTSVLTRNEQLEKCVQKTAVENLHFLPCGPIPPNPADLLGSKSMQELLAQAYSRYDL
VIFDLPPLLAVADAQIMANVCDASILIVRSESTEKETAVKAKGLLESAKGKLLGIVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A2B3GA23 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNVEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQMTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSMYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKESAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A2B3KLN4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTNSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLDSAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A2B3MAY3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus megaterium] (length=236 residues).
MARKTKEQKNDKMLTLKRRLLAHNSPKDPVAEQYRTIRTNIQFSGTDEEIKSLLLTSSGPSEGKSTTAANLAAVYAQQGL
NVLLIDGDLRKPTAHYTFRLENHTGLTNVLTKQSQLGQAVQSTEVPNLYVLTSGPIPPNPSELLASKQMGEVLAEMKERF
DMVIFDTPPILAVADAQILANQVDASLLIVSSAKTEKDAALKAKDLLTQAKSKLLGAVLNNRKIEEGNYYYYYGSN
>gnl|bykdb|A0A2B3QBY2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A2B3QXY3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis] (length=229 residues).
MVLKKKKVRQRRQLIAHARSNSSIAEQYRNIRTNIEFAAVDKPIQSLLITSPTSEAGKTTTAANLAVVFAQQGKKVLIVD
TDLRKPVLHKLFQVDNKYGLISTLTGAQILEDCIKPTEINGLYIFPCGPIPPNPAELLGSETMKETISHLHQIYDFIIFD
TPPILAVSDAQILANQCHSSLLVIRCGVTEKADALKAKHILGNTHGKLLGAILNDREQQKGEEYYYSQN
>gnl|bykdb|A0A2B3VZE6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus megaterium] (length=221 residues).
MRSLISHQKPKSPIAEQYRTLRTNIQFSNIDRNIRSIMVTSSFQEEGKSTTAANLAVVFAQQGKRVLFVDGDLRKPTVQY
TFQLENHIGLTNVLTKQTTLGAAVKNSHITDLWILTSGPIPPNPAELLGSQAMEELLEEMYSQFDMIIFDTPPVLPVADA
HILANQCDGIVLVMKSGAVEKEAALKAKDILEHADGKLLGVVLNQKKNPADGQYYYYGTKA
>gnl|bykdb|A0A2B3W4M0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus megaterium] (length=235 residues).
MARKNKNNDKLLTVQRRLVAHNSPKSPSAEQYRTIRTNIQFSTLEEDIQTIVTTSSGPGEGKSTTSANLAIVYAQQGKKV
LLVDSDLRKPTVHYSFRLENYVGFTNVLTKQETLLNAVKKTDVPDLFVLTSGPIPPNPSELLASDYMNEVLEQMKAEFDF
IIFDTPPTLAVTDSQILSNKADGTILVVSSGKTNMDAAKKAKGLLSNSKGRLLGVILNNRKMDNDSQYYYYYGTN
>gnl|bykdb|A0A2B4AZ19 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A2B4GPB7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus megaterium] (length=224 residues).
MLTLKRRLLAHNSPKDPVAEQYRTIRTNIQFSGVDQEIKSLLLTSSGTAEGKSTTASNLAAVYAQQGLKVLLVDADLRKP
TAHYTFRLENHSGLTNVLTRQSSLGQAVQETEVSDLYVLTSGPVPPNPSELLASSQMEELLKEMKQQFDMIIFDTPPILA
VADAQILANQLDASILVVSSGKTEKAAALKAKELLVHAKSKLLGAVLNNRKADSGNYYYYYGSN
>gnl|bykdb|A0A2B4LMA8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=234 residues).
MALNSLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDKNIHSLMITSAKPSEGKTTTTANMAVVFAQQGKK
VLLIDADMRKPAMHQMFQTDNIFGLTNVLTHSERLEKCVQTTSVENLHFLACGPIPPNPAELLGSKSMQELLAQVYSMYD
LVIFDLPPILAVTDAQIMANVCDASILVVRSEATEKEAAVKAKALLESAKGKLLGVVLNDREREHGLYYYYGAN
>gnl|bykdb|A0A2B4NQW4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. AFS075960] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNVEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLGQAYSMYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKESAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A2B4Y7H6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus mycoides] (length=234 residues).
MALNSLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFASVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKK
VLLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTGVDNLYFLACGPIPPNPAELLGSKSMQELLAQAYSMYD
LVIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A2B5SDM1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus toyonensis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTLVDNLQFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A2B5W0B8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus toyonensis] (length=233 residues).
MALNLFRKKKTHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTYSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSEATEKETAVKAKGLLESAKGKLLGVVLNDCEREEGLYYYYGAN
>gnl|bykdb|A0A2B5YZZ8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus toyonensis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLSFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A2B6K842 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus pseudomycoides] (length=229 residues).
MVLKKKASRARRQLIAYEQPKSSISEQYRNVRTNIEFASVDKKIRSLIVTSANSSEGKTTTAANIAIVFAQQGKKVLLID
ADLRKPALHQMLQVENVFGLTSVLTRSKTLETCVENTKIRNLNFLPCGPIPPNPAELLGSNSMKDLLSEAYGMYDLVIFD
TSPILPVTDAQVMANQCDASVLVVRSGSTEKDTAIKAKQALDGAKGTLIGVILNDKEQTGSEYYYYSSN
>gnl|bykdb|A0A2B6TSE5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus wiedmannii] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQLDNIFGLTNVLTHSERLEKCVQTTAVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSLYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQSLYYYYGAN
>gnl|bykdb|A0A2B7EDP1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus pseudomycoides] (length=229 residues).
MVLKKKASRARRQLIAYEQPKSSISEQYRNVRTNIEFASVDKKIRSLIVTSANSSEGKTTTAANIAIVFAQQGKKVLLID
ADLRKPALHQMLQIENIFGLTSVLTRSKTLETCVENTKIRNLNFLPCGPIPPNPAELLGSNSMKDLLSGAYGMYDLVIFD
TSPILPVTDAQVMANQCDASVLVVRSGVTEKDTAIKAKQALDGAKGTLLGVILNDKEQTGSEYYYYGSN
>gnl|bykdb|A0A2B8CUL5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSEHLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A2B8HXM0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus anthracis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNVEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTYSERLEKCVQTTLVDNLSFLACGPIPPNPAELLGSKSMQELLAQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKESAVKAKGLLESAKGKLLGVVLNDREREQSLYYYYGAN
>gnl|bykdb|A0A2B8U5B8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. AFS055030] (length=231 residues).
MVKKTTKEKLKRFLITLTNPKSPFAEQYRTVRTNIQFSSIDRKIKSILVTSSEPSEGKTTTIANLAVTYAQQEKRVLLVD
ADLRKPQLHSVFKLENFKGLTTAITHEKSLKDVIQKTELNNLSILTSGPIPPNPSELLSSEKMKKLIEQMYEQYDVILFD
APPLLAVTDAQIISQVCDGTILVVRRGHAAKEKIKKAKELLTLVNANILGVVLNRAEQEKDGYYYYYGNEK
>gnl|bykdb|A0A2B8UTL5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. AFS054943] (length=234 residues).
MALNSLFKKKKNHRQRRQLIAHQQPKSPISEQFRNIRTNVEFASVDTNLHSIMVTSANPSEGKTTITSNMAVVFAQQGKK
VLLIDADMRKPAMHQVFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLYFLACGPVPPNPAELLGSKSMQELLAQAYSMYD
LVIFDLPPILAVTDAQIMANVCDASILVVRSEATEKEAAVKAKGLLQLAKGKLLGVVLNDCEREHGLYYYYGAN
>gnl|bykdb|A0A2B9AM63 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. AFS053548] (length=231 residues).
MVRKTTKEKLKRFLITLTNPKSPFAEQYRTVRTNIQFSSIDRKIKSILVTSSEPSEGKTTTIANLAVTYAQQEKKVLLVD
ADLRKPQLHSDFKLENFKGLTTAIAQEKSLKDVIQKTDISNLSILTSGPIPPNPSELLSSEKMKKLIAQMYEQYDVILFD
APPLLAVTDAQIISQVCDGTILVVRRGYTAKEKIKKAKELLTLVNANILGVVLNRAEQDKDGYYDYYGSEK
>gnl|bykdb|A0A2B9B0G2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=229 residues).
MVLKKNKVRQRRQLIAHARPNSSIAEQYRNIRTNIEFAAVDKPIQSLLITSPTSEAGKTTTAANLAVVFAQQGKKVLIVD
TDLRKPVLHELFQVDNKFGLTSTLTGAQILEDCIKRTEVNGLYLLPCGPIPPNPAELLGSETMKETISHLHQIYDFIIFD
TPPILAVSDAQILANQCHSSLLVIRCGVTEKADALKAKHILGNTQGKLLGVVLNDREQQKGEEYYYSQN
>gnl|bykdb|A0A2B9BIE3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=229 residues).
MVLKKKILRARRQLIAYEQPKSSVSEQYRNIRTNIEFASVDKKIRSLIVTSANQSEGKTTTAANIATVFAQQGKKVLLID
ADLRKPALHQMMQVDNIFGLTSVLTRSKTLETCVTQTKIGNLTFLPCGPIPPNPAELLGASSMKDLLSEAYGTYDLVIFD
TSPILPVTDAQIMANQCDASVLVIRSGATEKEAALKAKQSLDSAKGKLLGVVLNDKEQNGSEYYYYSSN
>gnl|bykdb|A0A2B9CZI3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=229 residues).
MVLKKKTLRARRQLIAYEQPKSSVSEQYRNIRTNIEFASVDKKIRSLIVTSASQSEGKTTTAANIAIVFAQQGKKVLLID
ADLRKPALHQMMQVDNIYGLTSVLTRSKTLETCVAQTKIGNLTFLPCGPIPPNPAELLGASSMKDLLSEAYGTYDLVIFD
TSPILPVTDAQIMANQCDASVLVIRSGATEKEAALKAKQSLDSAKGTLLGVVLNDKEQNGSEYYYYGSN
>gnl|bykdb|A0A2B9E9V1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSEGLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A2B9FHL1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTNSERLEKCIQTTSVDSLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A2B9LQK9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=229 residues).
MVLKKKTLRARRQLIAYEQPKSSVSEQYRNIRTNIEFASVDKKIRSLIVTSANQSEGKTTTAANIAIVFAQQGKKVLLID
ADLRKPALHQMMQVDNMFGLTSVLTRSKTLETCVKQTKIGNLTFLPCGPIPPNPAELLGASSMKDLLSEAYGTYDLVIFD
TSPILPVTDAQIMANQCDASVLVIRSGATEKEAALKAKQSLDSAKGTLLGVVLNDKEQNGSEYYYYGSN
>gnl|bykdb|A0A2B9NNV7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A2B9PT39 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFASVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKM
LLIDADMRKPAMHQMFQVDNIVGLTNVLTHSQRLEKCIQTTNVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSMYDL
VIIDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDRELENGSYYYYGAN
>gnl|bykdb|A0A2B9QYJ1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus megaterium] (length=236 residues).
MARKKKDQKNDKMLTLKRRLLAHNSPKDPVAEQYRTIRTNIQFSGADEDIKSLVLTSSGPSEGKSTTAANLATVYAQQGL
NVLLIDGDLRKPTAHYTFRLENHTGLTNVLTKQSQLGQAVQSTEVPNLYVLTSGPIPPNPSELLASKQMGEVLAEMKERF
DMVIFDTPPILAVADAQILANQVDASLLIVSSAKTEKDAALKAKDLLTQAKSKLLGAVLNNRKMEEGNYYYYYGSN
>gnl|bykdb|A0A2B9SSK3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus megaterium] (length=235 residues).
MARKKNQVNDKILTVKRRLVAHTNPKLPVAEQYRTIRSNIQFSSLDEDIRSLVMTSAGPGEGKSTTAANLAIVYAQQGKR
VLLVDADLRKPTVHFSFRLENHIGFTNVLTKKTKLLDAVHQTDIPNLLVLTSGPIPPNPSELLGSKNMDELLQTMYDNFD
FIVFDTPPTLAVTDAQVLSNKAEATILVVSSGTTDRNAAQKAKELLTNAKAKLLGVILNNRKIESGDYYYYYGSN
>gnl|bykdb|A0A2B9SVI2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus megaterium] (length=222 residues).
MHMRSLISHQKPKSPITEQYRTVRTNIQFSNVDRDIQSIMVTSSFQEEGKSTTAANLAVVFAQQKKKVLLVDADLRKPSV
QYTFQLQNHTGLTNVLTRQTVLHSAVQAAGIDSLDVLTSGPIPPNPTELLGSQAMKELLEEMYKQYDIVIFDTPPVLPVA
DAHILANQCHGLVLVIKSGHVEKDSALKAKDILESAKGKLLGVIINQKQQPDDEQYYYYGTK
>gnl|bykdb|A0A2B9U2X1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MVLNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQSLYYYYGAN
>gnl|bykdb|A0A2C0FDC0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAQQQPKSPISEQYRNIRTNIEFAVVDTNLHSLMITSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQLDNIFGLTNVLTHSERLEKCVQKTAVDNLQFLACGPIPPNPAELLGSKSMQELLGQAYSMYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDCEREQGLYYYYGAN
>gnl|bykdb|A0A2C0K880 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALKLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A2C0KQ47 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus megaterium] (length=236 residues).
MARKKKDQKNDKILTLKRRLLSHNSPKDPVAEQYRTIRTNIQFSGADEEIKSLVLTSSGPSEGKSTTAANLATVYAQQDL
NVLLIDGDLRKPTAHYTFRLENHTGLTNVLTRQSSLGQAVQSTEVPNLYVLTSGPIPPNPSELLASKQMGEVLDEMKERF
DMVIFDTPPILAVADAQILANQVDASLLIVSSAKTEKDAALKAKELLTQAKSKLLGAVLNNRKMEEGNYYYYYGSN
>gnl|bykdb|A0A2C0PDF7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus megaterium] (length=236 residues).
MARKKKDQKNDKMLTLKRRLLAHNSPKDPVAEQYRTIRTNIQFSGTDEEIKSLVLTSSGPSEGKSTTAANLAAVYAQQGL
NVLLIDGDLRKPTAHYTFRLENHTGLTNVLTKQSQLGQAVQSTEVPNLYVLTSGPIPPNPSELLASKQMGEVLAEMKERF
DMVIFDTPPILAVADAQILANQVDASLLIVSSSKTEKEAALKAKDLLTQAKSKLLGAVLNNRKMEEGNYYYYYGSN
>gnl|bykdb|A0A2C0TMJ3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus megaterium] (length=224 residues).
MLTLKRRLLSHNSPKDPVAEQYRTIRTNIQFSGADEEIKSLVLTSSGPSEGKSTTAANLATVYAQQGLNVLLIDGDLRKP
TVHYTFRLENHTGLTNVLTRQSSLGQAVQQTEVPNLYVLTSGPIPPNPSELLASKQMTEVLAEMKERFDMVIFDTPPILA
VADAQILANQVDASLLIVSSSKTEKDAALKAKELLTQAKSKLLGAVLNNRKMEEGNYYYYYGSN
>gnl|bykdb|A0A2C0V213 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus megaterium] (length=236 residues).
MARKKKDQKNDKMLTLKRRLLAHNSPKDPVAEQYRTIRTNIQFSGADEEIKSLVLTSSGPSEGKSTTAANLAAVYAQQGI
NVLLIDGDLRKPTAHYTFRLENHTGLTNVLTKQSQLGQAVQSTEVPNLYVLTSGPIPPNPSELLASKQMGEVLAEMKERF
DMVIFDTPPILAVADAQILANQVDASLLIVSSAKTEKDAALKAKDLLTQAKSKLLGAVLNNRKMNEGNYYYYYGSN
>gnl|bykdb|A0A2C0XGG5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSMYDL
VIFDLPPILAVTDAQIMANQCDASILVVRSESTEKESAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A2C0Z2Z8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKVLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A2C0ZYJ1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. AFS041924] (length=231 residues).
MSKRTAKEKLQRFLITLTNPKSPFAEQYRTVRTNIQFSSIDKKIKSILVTSSEPSEGKTTTIANLAVTYAQQGKKVLLVD
ADLRKPQLHADFKLENFKGLTTAVAQEKSLKDVIQKTPTDNLTVLTSGPIPPNPSELLSSEKMKSLIEQMYEQYDVILID
APPLLAVTDAQIISQVCDGTILVVRRGYTAKEKIKKAKELLTLVNANILGVVLNRAEQDKDGYYDYYGIEK
>gnl|bykdb|A0A2C1BPU3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKNKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSDRLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A2C1DIN6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=229 residues).
MVLKKKILRARRQLIAYEQPKSSVSEQYRNIRTNIEFASVDKKIRSLIVTSANQSEGKTTTAANIAIVFAQQGKKVLLID
ADLRKPALHQMMQVENIFGLTSVLTRSKTLETCVTQTKIGNLTFLPCGPIPPNPAELLGASSMKDLLSEAYGTYDLVIFD
SSPILPVTDAQIMANQCDASVLVIRSGATEKEAALKAKQSLDSAKGKLLGVVLNDKEQNGSEYYYYGSN
>gnl|bykdb|A0A2C1F214 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFNKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNVEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTAVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSMYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQSLYYYYGAN
>gnl|bykdb|A0A2C1HQ92 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus megaterium] (length=236 residues).
MARKGKDNKNDKLLTLKRRLLAHNSPKDPVAEQYRTIRTNIQFSNADQEIKSLVLTSSGPAEGKSTTATNLATVYAQQGL
KVLLIDADLRKPTAHYTFRLENHAGLTNVLTRQSTLGQAVQETEVQDLYILTSGPIPPNPSELLSSNQMEEILKEMKQQF
DIVIFDTPPILAVADAQILANQVDASILVVSSGKTDKEAALKAKELLVNAKSKLLGAVLNNRKTESGNYYYYYGSN
>gnl|bykdb|A0A2C1IXE0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus megaterium] (length=236 residues).
MARKNKAQKNDKMLTLKRRLLAHNSPKDPVAEQYRTIRTNIQFSNVDQAIKTIVVTSSGAEEGKSTTTSNLATVYAQQGL
KVLLIDADLRKPTGHYTFRLENHIGLTNVLTRQSTLAQAVQESEIPHLSVLTSGPIPPNPSELLASAQMAELLKEMKEQF
DMVIFDTPPILAVADAQILANQVDGTILVVSSGKTEKDAALKSKELLSNAQGKLLGVVLNNRKVEEGNYYYYYGTN
>gnl|bykdb|A0A2C1JT93 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus megaterium] (length=228 residues).
MSRRIKYKSKTLVSLIADKSPKSVIAEQYRLIRTNIEFASVDKNIKSIVVTSPAPGDGKSTTATNLSIVLAQQGKKVILV
DADLRKPSIHYTFKLDNMDGLTSVLTKKTNLEKAIIKTHILNLSILTSGLIPPSPSELLNSQVMESLIEELNGKFDYIIF
DTPPVLAATDSQVLANKCDGVIMVITRGKTIRNEAAKAKKLLHNTKSHQLGVVLNRVEPNASSYSYLY
>gnl|bykdb|A0A2C1K0T9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. AFS040349] (length=225 residues).
MKHRGKSTIQLIAHSNPNTAITEQYRHIRTSIMYSSVDKELKSIMITSSEPGEGKSMTAANLAVVLAQQGKKVVLVDADL
RKPSIHFTFNSSNIDGLTSVLTKKISLNGAISSTYVPDLDILTCGPIPPNPSELLDSKAMESVIKELKATFDYVVIDTPP
VITVTDPQIIANKCDGIVMVVKRGKTKKDKAQKAKELLEKAESRLIGVVENGVKYTETNYYGRYN
>gnl|bykdb|A0A2C1KTJ8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. AFS040349] (length=214 residues).
MTSPKSPIAEQFRTVRTNIQFSSVDQELRSLVVTSSGPAEGKSTTTANLAVVFAQQGKKVLLIDADLRKPTVHYTFRLEN
HTGLTNVLTKQKTLEETVYVTGQENLWVLPCGPIPPNPSELLGSKGMIALLEQAKEDYDMIILDTPPVLAVTDAQVLANI
TDGVVLVVSSGKTETEAAKKTKELLESAQAKILGVVLNNKKTQDSQYYYYYGGK
>gnl|bykdb|A0A2C1LEC2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNVEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLGQAYSMYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKESAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A2C1LGL8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=234 residues).
MALNSLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDKSIHSLMITSANPSEGKTTTTANMAVVFAQQGKK
VLLIDADMRKPAMHQMFQMENIFGLTNVLTHSERLEKFVQKTAVDNLHFLACGPIPPNPAELLGSKSMQELLAQVYSMYD
LVIFDLPPILAVTDAQIMANVCDASILVVRSEATEKEAAVKAKALLQSAKGKLLGVVLNDCEREHGLYYYYGAN
>gnl|bykdb|A0A2C1MAK3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKQNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSIDNLSFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANICDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A2C1Z7I7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. AFS037270] (length=235 residues).
MALKKKKSQSNPSRKLITSVAPKNAISEQYRAIRTNIQYSSVDEEIRAIMVTSSGPAEGKSTTAANLAVTFAQLGKKVLL
VDADLRKPTVHHTFQVNNIYGFTTVLTKQTTLEKAVVETVEKDLFILTCGPIPPNPAELLSSKSMEQFITDAKEMFDYVI
FDTPPLLAVADPQILANQCDGTILVVYSEKTEIELAKKSKELLQNAQGKLLGVVLNHKEIKKNDYYYYYGTYGTK
>gnl|bykdb|A0A2C1ZPV6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=229 residues).
MVLKKKILRTRRQLIAYEQPKSSVSEQYRNIRTNIEFASVDKKIRSLIVTSANQGEGKTTTAANIAIVFAQQGKKVLLID
ADLRRPALHQMMQVDNIFGLTNVLTRSKTLETCVTQTKIGNLTFLPCGPIPPNPAELLGASSMKDLLSEAYGTYDLVIFD
TSPILPVTDAQIMANQCDASVLVIRSGATEKEAALKAKQSLDSAKGTLLGVVLNDKEQNGSEYYYYGSN
>gnl|bykdb|A0A2C2CPN4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNVEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSMYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A2C2HZH1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MVLNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMSVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSLYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A2C2PU94 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus megaterium] (length=236 residues).
MARKEKKNKNDKVLTLKRRLLAHNSPKDPVAEQYRTIRTNIQFSGADQDIKSLILTSSGTAEGKSTTASNLAAVYAQQGL
KVLLIDADLRKPTVHYTFRLENHAGLTNVLTRQSTLGQVVQGTEVRDLYVLTSGPIPPNPSELLASYQMEELLKEMKQQF
DMVIFDTPPILAVADAQILANQVDASILVVSSGKTEKEAALKAKELLVHAKSKLLGAVLNNRKADSGNYYYYYGSN
>gnl|bykdb|A0A2C2V301 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. AFS031507] (length=233 residues).
MALKKKKLTSKDASRKLVTAIDPKSPISEHYRTIRTNIQYSSIDQEIRAIMVTSSGPAEGKSTTAANLAVTFAQLGKKVL
LVDADLRKPTVHHTFGVNNLFGFTTVLTKQRALEKTVLETGEQDLYILTSGPIPPNPAELLSSKSMEQFIEDAKAEFEYI
IFDTPPLLAVADPQILANQCDGSILVVYSEKTEIEPAKKAKELLANAQSKLLGVVLNHKEAKSGDYYYYYGAK
>gnl|bykdb|A0A2C2VIH4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNVEFASVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTYSESLEKCVQTTAVENLSFLACGPIPPNPAELLGSKSMQELLAQVYSIYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A2C3EL17 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus thuringiensis] (length=233 residues).
MALNLFKKKQNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A2C3GD95 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus anthracis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNVEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTAVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSLYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A2C3I590 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus megaterium] (length=236 residues).
MARKEKKNKNDKLLTLKRRLLAHNSPKDPVAEQYRTIRTNIQFSGADQDIKSLILTSSGTAEGKSTTASNLAAVYAQQGL
KVLLIDADLRKPTVHYTFRLENHAGLTNVLTRQSTLGQAVQETEVRDLYVLTSGPIPPNPSELLASHQMEELLKEMKHQF
DMVIFDTPPILAVADAQILANQVDASILVVSSGKTEKEAALKAKELLVHAKSKLLGAVLNNRKADSGNYYYYYGSN
>gnl|bykdb|A0A2C3JN90 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKKNHRQRRQLIAQQQPKSPISEQYRNIRTNIEFAAVDLNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTYSERLEKCVQTTSVENLNFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A2C3K495 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. AFS029533] (length=231 residues).
MVKKTTKEKLKRFLITLTNPKSPFAEQYRTVRTNIQFSSIDKKIKSILVTSSEPSEGKTTTIANLAITYAQQEKKVLLVD
ADLRKPQLHSDFKLENFKGLTTAIAQEKSLKDVIQKTDISNLSILTSGPIPPNPSELLSSEKMKKLIAQMYEQYDVILFD
APPLLAVTDAQIISQVCDGTILVVRRGYSAKEKIKKAKELLTLVNANILGVVLNRAEQDKDGYYDYYGSEK
>gnl|bykdb|A0A2C3WIN1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus toyonensis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQPTSVENLSFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSEATEKETAVKAKGLLESAKGKLLGVVLNDRERDQGLYYYYGAN
>gnl|bykdb|A0A2C3ZSN9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus toyonensis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLSFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSEATEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A2C4CFM2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus toyonensis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSEATEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A2C4EFH3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus toyonensis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTNSERLEKCVQTTSVDNLSFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VVFDLPPILAVTDAQIMANVCDASILVVRSEATEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A2C4F221 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus toyonensis] (length=227 residues).
MVLKRKKQRQQRQLIAHIQPNSSIAEQYRNIRTNIEFASVDKPIKSLLITSPNSEAGKTMTAANIAVVFAQQGKKVLIVD
TDLRKPVLHQVFHVDNRFGLTSVLTGAYVLEDCIKQTEIDGLFLLPCGPIPPNPSELLGLDSMKEIMATLRQIYDFIIFD
TPPVLLVADTQIMANQCESSILIIRCGVTEKNEALKAKYILEKAQGKLLGVVLNDKQQQPREEYYYN
>gnl|bykdb|A0A2C4PUA3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus wiedmannii] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSMYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A2C4QLQ0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus toyonensis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQPTSVDNLSFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSEATEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A2C4R3B9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus toyonensis] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPVMHQMFQVDNIFGLTNVLTNSERLEKCVQTTSVDNLSFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSEATEKESAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A2C4RGC3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. AFS043905] (length=225 residues).
MRGKDNKQVNLIAQTNPKSPITEQYRLIRTNIQFSSVDKEIKTIVVTSSEPNDGKSTTAANLAIVLAQDEKKVLLVDADL
RKPSVHYAFNLSNINGLTSILTKKMNLRKTILNSNVSNLDILTSGPIPPNPSELLNSKAIETAIDELKGMYDYIILDTPP
VLVVPDSQIVSNKCDGVIIVVASGKTNKQSAVKAKELLVKANTSLLGVVLNGVETDNSNYYYYKS
>gnl|bykdb|A0A2C4WCS1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus toyonensis] (length=233 residues).
MALNLFRKKKTHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTYSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSEATEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A2C5BLP5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus wiedmannii] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMSVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSLYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKEAAVKAKGLLESAKGKLLGVVLNDREREQSLYYYYGAN
>gnl|bykdb|A0A2C5FM64 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus pseudomycoides] (length=229 residues).
MVLKKKASRARRQLIAYEQPKSSISEQYRNVRTNIEFASVDKKIRSLIVTSANSSEGKTTTAANIAIVFAQQGKKVLLID
ADLRKPALHQMLQVENVFGLTSVLTRSKTLETCVENTKIRNLNFLPCGPIPPNPAELLGSNSMKDLLSAAYGMYDLVIFD
TSPILPVTDAQVMANQCDASVLVVRSGSTEKDTAIKAKQALDGAKGTLLGVILNDKEQTGSEYYYYSSN
>gnl|bykdb|A0A2C5GEC6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus wiedmannii] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSLYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKEAAVKAKGLLESAKGKLLGVVLNDREREQSLYYYYGAN
>gnl|bykdb|A0A2C5HYA7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus aryabhattai] (length=236 residues).
MARKGKENKNDKVLTLNRRLLAHNSPKDPVAEQYRTIRTNVQFSGVDQEIKSLLLTSSGTAEGKSTTASNLAAVYAQQGL
KVLLVDADLRKPTAHYTFRLENHSGLTNVLTRQSSLGQAVQETEVSDLYVLTSGPIPPNPSELLASHQMEELLKEMKQQF
DMVIFDTPPILAVADAQILSNQVDASILVVSSGKTEKEPALKAKELLVHAKSKLLGAVLNNRKADSGNYYYYYGSN
>gnl|bykdb|A0A2C5JQI9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus toyonensis] (length=233 residues).
MALNLFRKKKTHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTYSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAKIMANVCDASILVVRSEATEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A2C5PFA3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus wiedmannii] (length=233 residues).
MALNLFKKKKNHHQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLIITSANPSEGKTVTTANMAVVFAQQGKKV
LLIDADMRKPNMHKMFLIDNIVGLTHVLTRNEQLEKCVHKTAVENLHFLPGGLIPPNPAELLGSKSMQELLAQAYSMYDL
VIFDSPPILAVTDAQILANVCDASILIVRSESTEKEAAVKAKGLLESAKGKLLGVVLNDHEREQSLYYYYGAN
>gnl|bykdb|A0A2C5RIV9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus cereus] (length=233 residues).
MALNLFKKKQNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAS
>gnl|bykdb|A0A2C8ENT6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus algidus] (length=241 residues).
MNLFRKEKKLSTDSIDNGVGLITVTQPTSTIAEQFRTVRTNIQFSSIDKEMKVIMATSSGPSEGKSTVITNLAVTYANQG
LKVLLIDADMRRPTAHQTFGLSNQTGLTNCLTEKDIDIAKAVEETPIENLYVMPAGPTPPNTSELLNTKRMDAILTAVAE
QMDMVIIDTPPLISVTDAQIVATKVDGTILVVREGVANKGAVVKAKELLDTVHARIIGTILNDVSGSDESGYYGGYYGYY
K
>gnl|bykdb|A0A2C9XLI9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus sp. 2G9_DIV0600] (length=235 residues).
MMAKKQERTGTQTHAVSLITLIDPSSPISEQYRTIRTNIQFASSADKQIKTIVVTSSGPGEGKSTTSANLAVVFAKSGQR
VLLVDADMRKPTVYKTFSLNNASGLSTVLSTSTSVLEAAQKTVIDNLSVLTSGPKPPNPSELLGSARMNQVMEEAKNLYD
VVIFDMPPVVAVTDAQIMASKADGTILVVRENVARKESLTKARDLLNMVQARIIGVVYNGAEHSKDSGYYYYYGN
>gnl|bykdb|A0A2C9XR37 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Enterococcus sp. 10A9_DIV0425] (length=226 residues).
MKKKNTILPVSLLSITDKNAMVSEQYRTIRSNIQFASVDQELKTMVVTSSGPGEGKSTTAANLAVVFANSGKRVLIVDAD
LRKPSVALTFQLPNVNGLSNYIGDRGGQAENYYSPSAVENLWVMTSGPKPPNPSEMLDSKRMEEIIAELAAKFDLVIFDL
PPIATVTDAQILAAKTDGTLLVVRERKTIKYELLKAKELLTIAQARILGVVYNGAKANADVNYYYY
>gnl|bykdb|A0A2D0AUT9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. K2I17] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTSNMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSMYDL
VIFDLPPILAVTDAQIMANVCDASILVVRSESTEKEAAVKAKGLLESAKGKLLGVVLNDREREQSLYYYYGAN
>gnl|bykdb|A0A2D1KK06 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus coryniformis subsp. torquens DSM 20004 = KCTC 3535] (length=254 residues).
MTTEGELMALFKKKKQLDSSSMKNGVGLITVTKPTSTIAEQFRTIRTNIQFSSADQQLKTLVFTSADPSEGKSTISSNVA
VTWADQGNKVLLIDGDLRRPTVARSFRVSNSHGLTTILTAKQANLSESIHETEVPNLYVLPSGPVPPNPSELLNSSKMDQ
LLKVLKEQFDIIILDVPPVNTVTDAQILASKVDGVILVVPQGIALKGAVLRARDLLKKVNANLIGAVLNRVTDAASGGYY
GGYYGGYYGTDDKK
>gnl|bykdb|A0A2D1SZ29 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Solibacillus sp. R5-41] (length=223 residues).
MARKLVTVSDSKSIISEQFRTIRTNIAFSMPDQELKTVLVTSSTPGEGKSTIAANLGVVFAQEGKRVLIIDGDLRKPTLH
QTFKTFNKLGLSNVLAKKAAFYEAIQETSIEGLNVMTSGPIPPNPAELLSSKALDILIQDVKKDYEMIIFDAPPLLVVSD
AQILSNKCDGTLLIANTGVVEKEVVVKATAILATSQANVLGVVLNNYVFPSHKHYYDYYSYDE
>gnl|bykdb|A0A2D2AAT6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lactobacillus plantarum] (length=235 residues).
MKLRRRVANMHTGIQLTTLTAPMSVVTEQVKTIRTNLNYAMVGKPLKTLMITSAIQGEGKSTVGSNLAVEYAKKGLQVLL
VDADLRRPTIHQTFAISNQRGVSSWLSGQLTDVNEAIYPVLDHLFVMPSGPKPPNPAELLASDRMTKFLTVATRKLDLVI
VDAPPILPVTDARILAGQVDGTVLVVRQNFVEKVAVRQAVSALKNARAQLLGTILNDVDIKTHGYGYGYYGTETN
>gnl|bykdb|A0A2G1CNB2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Thermoanaerobacterium thermosaccharolyticum] (length=240 residues).
MIEADNNVYKNNIVKSKTTVSEAFRSLRTNLQFTSVDKKVKSILITSSLPNEGKSTIIKNLAYALAMTGVKVIVVDCDLR
NPTVHQMFKIPNMGGLTNIIVEDDRYEKYVISDKEFDNLGIITSGPIPPNPSELIGSNRMKSFLNKLKENYDYVLLDAPP
VLLVTDPTVLAPVVDGVILVIQANKTEIEATKRAKEILTNVKANILGAVLNKVKEQKSGYYYYYYYNDDGSKHKRKRRKR
>gnl|bykdb|A0A2G3NX83 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus macedonicus] (length=246 residues).
MPQLELVRAKAQMVKSMEEYYNSIRTNIQFSGRDLKVITLTSAQSGEGKSTTSVNLAISFARAGFRTLLIDADTRNSVMS
GTFKSKERYQGLTSFLSGNAELSDIICDTNIDNLMIIPAGQVPPNPTSLIQNDNFKAMIEIVRGLYDYVIIDTPPLGLVI
DAAILAHYSDASLLVVKAGADKRRTVTKLKEQLEQSGSAFLGVILNKYDIHLDKYGSYGSYGGYGSYGNYGKSEEKTKIG
RGKRKK
>gnl|bykdb|A0A2G5NMS9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Macrococcus goetzii] (length=233 residues).
MFKKSKSKIKNRTEKARKLITLEDPKSPVSEQFRTLRTNISFSTPGSQLQKLLVTSSVQQEGKSTVSANLACVFAQNNTK
VLFIDADMRKPTVHNTFGVKNAVGLSTYLTEQSTLKQTIQPTEVENLDIMSAGPVPPNPSELLNSKNLDIMLDELCTYYD
LIIFDSPPVLSVTDSQIISAKVDGMVLVIDKQENNKSNVKEARDLLTVSENSKLLGIVFNNDEYDTDKYYVYQ
>gnl|bykdb|A0A2G5VWY2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Sporosarcina sp. P10] (length=234 residues).
MFNKKKQPKQSVARKLVTQTSPKSVVSEQFRTVRTNINFSMPDHDLKSILFTSATPGEGKSTASANTAVVFAQEGKKVLL
VDADMRKPTTHYTFSRMNATGLSNLLTRQWELEDIIQQTDIEGLDLITSGPIPPNPAELLGSKTMDVLIESLKEKYDMII
FDAPPVLSVTDAQILSNKAEGTILVLNAGTTEKESVLKAKEALVSSQANILGTILNNFILQKDHYYYQYYGNDE
>gnl|bykdb|A0A2G5WJC9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Sporosarcina sp. P13] (length=234 residues).
MFTKKKQPKQSVARKVVTYTNPKSVVSEQFRTLRTNINFSMPDHDLKSILFTSAVPGEGKSTASANTAVVFAQQGKKVLL
IDADMRKPTTHYTFSRMNATGLSNLLTRQWELDDVIQQTDIEGLDLITSGPIPPNPVELLSSKTMDTLLEKLKAKYDLLI
FDAPPVLSVTDAQILSNKAEGTILVLNAGKTEKDSVLKAKEALVSSQANILGTVFNNFVLHKDHYYYQYYGNEE
>gnl|bykdb|A0A2G5WVR0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Sporosarcina sp. P16a] (length=242 residues).
MVNKISRKKKRQAKRFVGRKLVTQSNSKSSVSEQFRTLRTNINFSMPDQELKTILFTSAAQGEGKSTISANTAVVFAQAG
KKVLLIDADMRKPTTHYTFNRMNATGLSNLLTRNWEIKDVIQKTDIEGLDLITSGPIPPNPAELLGSKTMDHVLEQLTGM
YDLLLFDAPPVINVTDAQILSHRCDGTIIVLHARKTEKDSVVKAKEALLSSQANIIGTVLNNFERQKDHYYNQYYGNVEA
GT
>gnl|bykdb|A0A2G5WW59 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Sporosarcina sp. P16a] (length=234 residues).
MFNKKKQAKQSVARKLVTETNPKSVVSEQFRTIRTNINFSMPDHDLKSILFTSATPGEGKSTASANTAVVFAQEGKKVLL
IDADMRKPTTHYTFSRMNATGLSNLLTRQWELEDIIQQTDVEGLDLITSGPIPPNPAELLGSKTMDVLIERLKEKYDMII
FDAPPVLSVTDAQILSNKAEGTILVLNTGTTEKDSVLKAKETLISSQANVIGTILNNFILQKDQYYYQYYGNDE
>gnl|bykdb|A0A2G5WYY7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Sporosarcina sp. P16b] (length=234 residues).
MFKKKKQPKQSVARKLVTKTSPKSVVSEQFRTIRTNINFSMPDHDLKSILFTSATPGEGKSTASANTAVVFAQEGKKVLL
IDADMRKPTTHYTFSRMNATGLSNLLTRQWELEDIIQQTDTEGLDLITSGPIPPNPAELLGSKTMDVLIDRLKEKYDMII
FDAPPVLSVTDAQILSNKAEGTILVLNAGTTEKESVLKAKEALVSSQANILGTILNNFILQKDHYYYQYYGNDE
>gnl|bykdb|A0A2G5XLQ4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Sporosarcina sp. P19] (length=234 residues).
MFKKKRQPKQAVARKLVAHSTPKSIVSEQFRTIRTNINFSMPDEELKSILFTSAAPGEGKSTSSANTAVVFAQEGKKVLL
IDADMRKPTTHYTFSRMNATGLSNLLTRQWEIDDIIQQTDIEGLDLITSGPIPPNPAELLGSKTMDALIEKLEGKYDLII
FDAPPVLSVTDAQILSNKADGTILVLNAGTTEKESIVKAKEALASSQANILGTILNNFILQKDHYYYQYYGNEE
>gnl|bykdb|A0A2G5ZH12 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Sporosarcina sp. P29] (length=234 residues).
MFKKNKQNKQSVARKLVTAISPKSVVSEQFRTVRTNINFSMPDHDLKSILFTSAAPGEGKSTASANTAVVFAQEGKKVLL
IDADMRKPTTHYTFSRMNATGLSNLLTRQWNLEDVIQQTDVEGLDLITSGPIPPNPAELLGSKTMDTLLEELKTMYDMII
FDAPPILSVTDAQILSNKAEGTILVLNAGTTEKDSILKAKEALLSSQANILGTILNNFILQKDHYYYQYYGNNE
>gnl|bykdb|A0A2G6QF89 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. 100374] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAIDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTLVDNLSFLACGPIPPNPAELLGSKSMQELLAQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKESAVKAKGLLESAKGKLLGVVLNDREREQSLYYYYGAN
>gnl|bykdb|A0A2G7HF70 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium combesii] (length=236 residues).
MDRNLSLITIKEPKSPISEAYRTLRTNIQFSSFDEKISVIFVTSSTPGEGKSTTSANLAITMAQNGSETILVDCDLRKPN
VHKLFKLSNTRGLSNLLIEDNGIDKVIQQSGIENLHILTSGIKPPNPSELLSSKKMKKFIEMSKEHYDYIILDTPPVGVV
TDAQLVSQYSDGGILVTASEQVERELAIRAKQLLQKVNAKILGVVLNKVDTSSGNGYRYYNYYYEEDGKKKKRSKK
>gnl|bykdb|A0A2G7LZM5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenibacillus sp. LK1] (length=227 residues).
MPRLTNEKGTLVTMANPKSTSSESYRKLRTNIQFSSIDSQIQTIMIASALSGEGKTTTIGNLAVTYAQEGKKVLLMDTDL
RKPTVHRMFNVPNHVGLTSVLSSQYKVTEVLRETGVEGLHVLSSGPIPPNPSEMIGSRKMTALLQDLKEEYDVILFDTPP
VLAVTDALIISSLCDGVILVVSAGKVKKDLVKKAKAHLEHVNARILGAVLNNVQLPKSRSSYYGGNA
>gnl|bykdb|A0A2G8IS37 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus pumilus] (length=227 residues).
MIFKRKKREKRDLSCISVLNPHSVIAEQFRTIRTNIEFTSIQTRLKSILVTSSLPKEGKSFAAANLAAVFAQQKKRVLLM
DADLRKPAVHEYFDLSHHTGLTNVLLNNCSLEEAVLPTPIEHLELLPSGTIPPNPAELLSSSVMKQLFYEIEQQYDMVIV
DSAPLLPVADAKILANRTDGSILVVLSGKTKIAAVKKSKEVLEGTTGKLLGAMLNGKKEKKGRLYMY
>gnl|bykdb|A0A2G9VDC9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pediococcus damnosus] (length=247 residues).
MPLFRKKHKLDNESLKRGVGLVTVTDPNSVVSEQFRTIRTNIQFSSADKKLRSLVVSSAEPSEGKSTVSSNLAVVWAKQN
QKVVLVDADLRRPTAHLTFNLLNAAGLSSLLTNNAVYEEVVQTTNIPNLSVISSGPVPPNPAELLNSRNLGSLLERLITE
FDVVIIDAPPVNTVTDAQLLASKADGTILVVPQGRAKKGSVTHAVEQLKTVHANLLGTVMNRFKADKTAGYYGGYYGGYY
GVDDKND
>gnl|bykdb|A0A2H3LYG8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. AFS094228] (length=225 residues).
MRSKDEKQVNLIAQTNPKSPITEQYRLIRTNIQFSSVDKEIKTIVVTSSEPNDGKSTTAANLAIVLAQEEKKVLLVDADL
RKPSVHYAFNLSNIHGLTSVLTKKMDLRKTILNSNVSNLDILTSGPIPPNPSELLNSKAIETAIDELKGMYDYIILDTPP
VLVVPDSQIVSNKCDGVIIVVASGKTNKQSAVKAKELLVKANTSLLGVVLNGVETDNSNYYYYQS
>gnl|bykdb|A0A2H3MYN5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. AFS017336] (length=231 residues).
MSRQTTKETFKRFLITLTNPKSPFAEQYRTVRTNIQFSSIDKKVKSILVTSSEPSEGKTTTIANLAVTYAQQGKRVLLVD
ADLRKPQLHSDFKLENFKGLTTAIAQEKPLKDFIQKSQIENLSILTSGPIPPNPSELLSSEKMKNLIEQMYEQYDMVLFD
APPLLAVTDAQIISQVCDGTILVVRRGYTSKEKIKKAKELLTLVNSNILGVVLNRAELDKDGYYDYYGNEK
>gnl|bykdb|A0A2H3Q6Q6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. AFS019443] (length=234 residues).
MVLKSLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLQSLIVTSANSGEGKTITAANMAVVFAQQGKK
VLLIDADMRKPALHQMFQVDNIFGLTNVLTQSKHLETCIQKTSVDNLHFLSCGPIPPNPAELLGSKSMQELLTQAYSMYD
LVIIDMPPILAVTDAQIMANQCDASVLVVRSESTEKGAAVKAKGLLESAKGKLLGVVLNDCEREQSLYYYHGAN
>gnl|bykdb|A0A2H3QGN9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. AFS012607] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTLVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREEGLYYYYGAN
>gnl|bykdb|A0A2H4H6C4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus suis] (length=228 residues).
MATLEIARTKKELVNKTEEYFNAIRTNIQLSGADIKVVGITSVQSNEGKSTTAASLAIAYARSGYKTVLVDADIRNSVMS
GFFKPITKITGLTDYLAGTTDLSQGLCDTDIPNLTVIESGKVSPNPTALLQSKNFENLLATLRRYYDYVIVDCPPLGLVI
DAAIIAQKCDAMVLIAEAGNVKRSSLKKVKEQLDQTGTPFLGVILNKYDIATEKYGEYGNYGNYGKKA
>gnl|bykdb|A0A2H6CI98 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Tetragenococcus halophilus subsp. flandriensis] (length=233 residues).
MKRKNERKGTQTHAVSLVSLIDPSSPVAEQYRTIRTNIQFASSADQQVKTIVVTSSGPSEGKSLSSANLAAVFAQTGQRV
LLVDADFRKPTIHKTFQLNNEAGLSTVLSTGIKAGETAQKTAVENLSILTSGPKPPNPSELLGSAKMNQIMEEARNIFDI
VIFDMPPVVAVTDAQIMSSKADGTLLVVRENWTRKDALSKAKELLDLVQARVLGVIYNGSEQGKDKAYYYYSD
>gnl|bykdb|A0A2H6CLQ2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Tetragenococcus halophilus subsp. halophilus] (length=233 residues).
MKRKNERKGTQTHAVSLVSLIDPSSPVAEQYRTIRTNIQFASSADQQVKTIVVTSSGPSEGKSLSSANLAAVFAQTGQKV
LLVDADLRKPTIHKTFQLNNEAGLSTVLSTGVKAGETAQKTAVENLSILTSGPKPPNPSELLGSAKMNQIMEEARNIFDI
VIFDMSPVVAVTDAQIMSSKADGTLLVVRENWTRKDALSKAKELLDLVQARVLGVIYNGSEQGKDKAYYYYSD
>gnl|bykdb|A0A2H6DYH3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Tetragenococcus halophilus subsp. halophilus] (length=233 residues).
MKRKNERKGTQTHAVSLVSLIDPSSPVAEQYRTIRTNIQFASSADQQVKTIVVTSSGPSEGKSLSSANLAAVFAQTGQKV
LLVDADLRKPTIHKTFQLNNEAGLSTVLSTGVKAGETAQKTAVENLSILTSGPKPPNPSELLGSAKMNQIMEEARNIFDI
VIFDMPPVVAVTDAQIMSSKADGTLLVVRENWTRKDALSKAKELLDLVQARVLGVIYNGSEQGKDKAYYYYSD
>gnl|bykdb|A0A2I0ERE0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planococcus sp. Urea-3u-39] (length=233 residues).
MAKKKQLQETARKVVTHTTPRSVVSEQFRTLRTNVNFASPDMELRSIVVTSAAPGEGKSTTSANLATVFAQEGKTVLLVD
GDMRKPTTHYTFHMPNTIGLSNVLTRQATVEDAIRPTTIERLDLMTCGPIPPNPAELLASNAMGMLISDLKKRYDVVIFD
APPVLSVTDGQVLANKCDGAILVVNSGSTEKEMAAKAKEAIEASNSKLIGAVLNNFELAKDSYYYQYYGNAEE
>gnl|bykdb|A0A2I0EY74 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planococcus sp. Urea-3u-39] (length=232 residues).
MRMLNQTASKRPLARKLVARIKPNSVISEQYRTIRTTINFSLPGNEMKTLLFTSASKEEGKSTTSANMAVVFAESGKKVL
LVDADMRKPTLHHTFNLNNHIGLSNLLVGKGELEQSVRDSGIRGLELLTSGQIPHNPAELLDSPMLDQLVAEMKERYDLI
IFDSPPILSVTDSKILANKCDGTVLVVNTGKTEKQSAIKARDSLATSRAYIVGVVMNNYKLSKDHYYSHEYN
>gnl|bykdb|A0A2I0FG19 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planomicrobium sp. MB-3u-38] (length=233 residues).
MARKKKVLQQTARKLIAHTTPRSYVAEQFRTLRTNITFSSPDADIRTMVVTSAAPSEGKSTTSANLAVVFAQEGKKVLLV
DGDMRKPTTHYTFHTGNTTGLSSVLTRQTTAEEAIRPTAVERLDLLTCGPIPPNPAELLSSKSMDALIRQLTGMYDLVIF
DAPPVLSVTDGQILSNKCEGTILVINSGGTEKEMALKAKEAIESSNSRIIGAVLNNFELPKDSSYYQYYGATE
>gnl|bykdb|A0A2I0FJ84 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Planomicrobium sp. MB-3u-38] (length=231 residues).
MSNKKKSSRLTARKLVVRTNPHSISTEQYRTIRTNILFSMPADDMKTILFTSPSKEEGKSTTCSNMAVVFAESGKRVLMI
DADMRRPTLHHTFHMSNKSGLSNLLLGKGRLSDTIKMSGVKNLDLLLCGQIPGNPAELLQSAEMDILLKDLREMYDLILI
DSPPLLAVADSKILANKCDGSVLVVNTGKTEKASVVKARDALVTAKAFVLGVVLNNFDLAKNHLYYQNYGS
>gnl|bykdb|A0A2I0QTY5 [Bacteria] Bacterial tyrosine kinase [Firmicu