BYKdb

Dataset for cluster tadcd of phylum firmicutes

[Download (right click)] [Alignment] [Repertoires]

251 sequence(s)

>gnl|bykdb|A0A069RC75 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Peptoclostridium litorale DSM 5388] (length=442 residues).
MNGKKYIGIFKRRKWLFFMVLAVSVAVSAVMTFYVSEPEYSSYTTLMVNKARGDNENYIDYESYIISQKLVDTYAVVAKS
ETVMERTIKNLNLRVSPQKLLKKVKIDQVDETEVLKISASSTDPALAAAIANEIAQVFKEEIFRIMNDENVRVIDYAKIP
AVPSKPDKILNMAAGVFFGIMGGLLVVYVLEYFDNAVRSAEDIQNGIGISVIGSVPKLKMSGEKGAELVIKTSPKSPGAE
AFRSIRTNMQFANIDQNIKTILFTSSIPGEGKTLVSANMATALCGIGKKVMLFDCDFRKPRLAKVFGLSNTVGITDALMS
KRDYREFVKETHIENLHIMTAGNSVQNPAELLQSERIRELIRKIENDYDYIIVDTPPATAVTDASIVSTFSDAAVIVCSS
GIVDIDELKRAKAQLEGVNARIMGAIFNRASEASSYYSYYGK
>gnl|bykdb|A0A0A5GPA9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pontibacillus halophilus JSM 076056 = DSM 19796] (length=455 residues).
MGQAFGLKEVYQVIRRRVVLLSVVTLLVVIIGIAISLLLPRTYEGEGALLVNFTSVKSDEDEISSSEIETNLRLIETYKS
ILISPRIMDKVKAQYGSDLEMEELVQRFTIGTNAESQIITVQAVGPSKEAASELVNVTLDTFQQEVESLMNLNNVQILTR
SNPDAHETPIKPNLLMNTILSLLLGLFLALLLVFLKEVIFTRADSEEKVEKVFRLSSLGVVPIISDEWNQKKEDLMQNDR
YFKLLPRLGTYSPITEAYRSIRTNLQYTLNQKSAKTVLFTSTHSSEGKSITAANIAYSMAMDHVNTVFVDLDLRKGVGNH
LFNNPVRKGATNYLEGYASIDEVVSRTDIPHLSYVAKGPMPKNPAEVLSSDKINTMLAELKEHFDLVIIDTPPLVVADAV
ALSTRVDGCVFVVNAQKTNTEQVSKSLQRLNKVKATIFGVVLNRGVKETNAHYYY
>gnl|bykdb|A0A0F2P7X6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Peptococcaceae bacterium BRH_c8a] (length=503 residues).
MEHQGLNNGVDRTEENEISLGEIISALFKWWWLVVLCTVLAALGAYFYTISTYVPVYTASASMVVNSKQLKIVGQEAVLT
NDVNLSAKLVNTYTAVLTSNRVMELVAGELDLPASAISPYVSVAPVRDTEVLRIFVSNPDPLLAAKICNSIMHVAPTAIS
STVEVGSINVLDNAKVPEFPNAPATFRNVGVGAVLGLMLGLGIVFMLMFFDRTIKSGDDVKNKLGLTLLGSIPYLSPKAR
KGQGQSQGQGQGQGAPLVTSDQVGFGFVESYKAAGTNLRFASAVTSAKKLLVTSILTGEGKSTVAVNLAITIARTGKSVL
LVDCDLRKSNMHGVLELDLEDHQGLAAVLNGACAAEEGIVFAAEQGIYVMPNGYIVPNPSELLGSEKMAALLAALEKQYD
YIILDTPPSYLLTDAVALSVYADGVILVVKQGCAKVDVINSAQAAFENAGVRIIGCILNGIKYNQLGAFYQSQNYERFLG
DYYKDYALTNKPAQEAAAASDKN
>gnl|bykdb|A0A0H5SF45 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Herbinix hemicellulosilytica] (length=471 residues).
MELSIKDVLGIIYKRLIFIIACTFFCAIMSYVYNKFIKDPVYTASVQFCVNTNDNSSGNINELNYAQKVVSTYVNLLRTN
TFYRQVLEATGLNYSVQQLKAMTQISSVNDTEIFQITLSSNSADDAYTLVEAMQKIAPQLIANIKENSKISVVDPVVYPA
GPSGPNIYLNTILGAVAGLVLAIAISFFWELIDVKIKSKEDLTKRYQIPILGVIPDFGVKMPKRYLLMQKLPFKNRLNEI
IKDKVEFNQVKNQEANFLVNEAYKALRTNLLYTIRKNGCKKILVNSPNPRDGKSTTCTNIAIALAKTGARVLLIDCDLRK
GRLHVPFNLNSTPGVTNLLSGMNTEKETIQYTSYNNLQIIPCGSIAPNPTELLSSIQMEELIKKLEQNYDYIIIDTAPVN
LVADALSLAKMVDGVLMVVREKSTTYPHVETALNKYELIGGNILGFVLNGSALTQENKSKSSYYYYQRNND
>gnl|bykdb|A0A0K8J554 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Herbinix luporum] (length=468 residues).
MELSLKEIIELIYKRLKLIIIFVLIGAGLLFVVNRFIRRPIYTASVQLYVNPNDTTPAANLNELNYAQKVVATYVNLLRT
QKFYKKVLEETGLNYSESQLKNMTNIQSVGDTEIFKISVNSHSASDSYELVKAMEYIAPQIISEVKNNAKITVIDPVVFP
TGPSGPNILLNTMIGALAGFFLAFTFAFLWELIDVKVKSKDDLMEKYQIPILGAIPSFNDMIPRKNVLLQKMSFLNRKKK
KSNLNQMINEQANFIITEAYKALRINLLYTIRKQGCKKILINSPNPEEGKSTTCLNIGIALANAGAKVLLIDCDLRKGRL
HKPLNVKSTPGLSNVLSVMKTDEEVVQDTDYENLQLIACGTIAPNPTELLSSIQMEELLLRLEKRYDYIILDSAPVNLVA
DALSLAKLVDGILMVVRENGTTYPNIDSALNKYELIDGKLLGFVINGITFKQGEKSKSKYYYNVNQDD
>gnl|bykdb|A0A0L6JLG6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pseudobacteroides cellulosolvens ATCC 35603 = DSM 2933] (length=464 residues).
MQDKDFVEVDIRELILILLRKWYILLICLVVATGAAYTVTAFYLKPVYRAETTLFLGKEKDKIGALSLLDLQINSQLVVD
YREILKSRLVAEKIQSQLGVEAKAFQNNVDVMTIKDSRIFKISYEDYDPKLAAKVVNELGTIIMQLASDIIEVKNVKVID
TAKDPKDPVKPNKKMNVGLAGFLGILLGVSLIYLLEFIDHTFKKPEDVEHHLGLNVIGTVPAFEGGKRGNKKAKDEKQLE
EEYLKNLITANDPKAAASEAYRELRTNLQYKSVDKDMKVILLTSPSLGDGKTVTTVNLAITLAQSGKKVLVIDADLRKPK
VHHYFGVKNTEGLTNILATEKELKKSMIQNKEGIENLFIIPSGPIPPNPSEILSSDKMRQLVEKLKSEYDVIFIDTPPVG
QVTDAAILTGIADGSIVVVAGGQTRIDMAKRAKKALTAINANIIGIVMTKIDSRSAYYHYYKYE
>gnl|bykdb|A0A0M6WXE3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Eubacterium] rectale] (length=484 residues).
MENNRENASAQTETEFEPISLVCDILKNWWVILLGALAGAMLFYVASSMIYVPNYRTQATFVITSRENANAYNNLSSANS
MAETFQKILESTIMKKTICEKLDMDKLDADISANVVKGTNMLTLSVTAHSPKDSIDIIKTVMDNYTSISYYTVGTTVLDV
LEDPKIPYAPVNPPQNGEMAKKGFFLGMAVCILLFAIWSYMHNTVKQEREVEKKLDARSLGAISYEWKYKTIKEWIKHRK
KAVLVDNPLASFRFVESFKMLAARVEYHMSKINGKVLVVTSVCENEGKSSVAGNLAITLAKKGKRIILIDGDIRCPAQYL
LLGMSPKKENELGEFLNGRTGANNILLNTERKRLGFIGGKVSYSASTEMLGNRQLPVLIEACSKIVDYVIIDTPPSGMIG
DAQIFAQHADAVMVVARQNVTLAEDINEMMDDFRDNHTKVLGVVLNGVMTFQSIADSPVGDHYSRYSRYGRYGRYGKYTN
NKEV
>gnl|bykdb|A0A0M6WYQ8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Eubacterium] rectale] (length=518 residues).
MDEMREKSGKEQQGEIEKIDLIEFLRSFQYGIKKMWWLVLVLALIFGLNSYIKARKNYTPVYTASATVAVTTIDGSPAYQ
NNASAQQMADVFPYILTSGVLKDVVAKDMKLDSVPGSISVKAEEGTNMLTISVSGTNAELSYKTLKSVIKNYPEVAQFVL
GNTTLKILDETGVPDDTTNQGVISSSWKRGALKGAIIGLVILSLYVLTRRTVKTGKEIKTHLNLVDLGTLPEVHVKKRNK
ESFYNSVNVLNKRIPQGYLEAFRKVGIKVMKQMEEEEFKTLLVTSSVPEEGKTAFSVNLAIIEAKLGKNVILVDCDMRRP
SVAKAMNQEGEFPGLQAVLQGKVKISEAMTTVELEKCPGSLQILYGKTTEGSSSDLLESKQMERLISILKKKADLVIFDT
APSEMLADAPVLARYLDAAVYVIRYDYAKMRQIRMGVENISMSGIHMLGYVLNRDRSTGGGYGYGYGYYGRYRYGRYGRY
GRYGGYRHYSRYEKQFDEPEEETGAVNQKEVFTETKEN
>gnl|bykdb|A0A0T8KPS6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=738 residues).
MTTMPRPIYETKEDKDIDLAHLFDTFINNRMLILGITGFFAALGIAYALLATPVYLASAMIQIEPKSGLPSLTDVVNNNP
PVSPAQTEIALLKSRSVVGGAVSNLNLDIIIKPHHFPIIGGFMARRFEPTEEGELGWYPTGLGAYAWGGEVLKVTQMEVP
DKVHGKELTLEAAENKGFILRDEDGEVVVQGVTGEPVENEGYRVTVAELNARPGTTFTVIKNRTYNTTESYQQRLSAAER
GKQSGIVNVTLEDPDPQHAIRVLEEVANRYVDQNVARNAAEATQSLEFLNEQVPAVRRNLEAAQTALNKYQTGSRSVDIT
AETQSVLDRIVDLEKQISEQNLKRTEMERRFTRQHPNFQALMNQINQLQMQKDQLEKQIDTLPSTQQELLRLTRDVEVSS
ETYSMLLNKTQELDIIRAGTVGNVRIIDHAAADLENPVKPNKPLVVIVATLLGALLATAFVYVREALKRGVENPEDIERT
GTPVYASIPFTEKQATLEKRLANFKRDKSTASYLLTINDPADLATEAMRSLRTSLHFAMIEAKNNVLMITGPSPAVGKSF
VTTNLAAVVAQSGKRVLLIDADMRKGYLHKVMRCDGDKGLSDILSGRITLFDAIQKTQLNNLHVITHGQLPPNPSELLMH
ENFSRFVKEISHMYDLVIFDTPPILAVTDAALVGSQAGTTLMVTRYGLNGLKEIEAAKRRLEQNGLLVKGVIFNAVVRKA
STYGEYGYYQYEYASTNK
>gnl|bykdb|A0A0T8LA03 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=736 residues).
MTALTRSSLEYDADNRIDLAGIMRTAYDHKALIIAITGLFTVLGVLYALIATPIYQATAMIQIEPKKAAITGIPEISPRP
DSVSQAVTEISLLKSRAVLGKAVEELKLYIVAKPRQFPLIGGYMARQHDPATDGALAKPLFGLTAFAWGGEKLDVFQLDV
PEAYLGMDLTLVAGTAGNYSLYDDEEQLILRGQVNQAVETQGFKVQIAELEARPGTEFRLVRNRPQTTALDYQDRLKVGE
AGKDSGIIYMSLEDPDPQLASRVLDEISRLYVSQNIQRSSAEAAQRLDFLRSQLPQVRKELEKAEAALHDYQTSSKSVDI
SIETKGVLDQIVQLETQLSELTLKRVDYDRLYTREHPTYRTLITQMNELQAQKAQLLKKVDALPMTQQELLRLQRDMEVT
TQTYTLLMNQAQEQDILRAGTIGNVRIIDNAYSMIEKPSKPVKPLVVAIAIFVGLLVSAAVILLRQAFYRGVESPDVIEK
LGVPVYAGLPYSASQDQLNRSRKSRDGKTRLLSLTEPTDLAVESLRSLRTSLKFAMLEARNKVLMITSPTPSVGKSFVSS
NLAAVIAQTGQRVLLIDADMRRGYLHTLFGMAPRHGLSDALASGLNLAEITNRTEQKNLHFISAGFSAPNPSELLMHDNF
SRLLREAEKLYDFIIIDTPPVLAVTDAVLVAQQSGTNLLVARFGLSTSSQIDASKRRLAQNGVLLKGVILNAVKRKASTS
PYDSGAYGYYTYTQQA
>gnl|bykdb|A0A0X9GDD0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Streptococcus pneumoniae] (length=467 residues).
MTIVDFFRLLRANLLLLLAAALVGGLLGWGYSALQPRIYASESQGLLAARSTDQSLIAGNGPAESRAQAYVALINSQAVR
ERVAQDTGQDDDDSLSAALVPGSSMIKVTATSTDPETAAQLANSALQATADVAAEVDKNSPLEVVPLSDARVPSAPVSPD
TRRNVLVGVVAGLGAGLAIAVLRRLLDVKVRSRADVKEITGAGVIGAVPENASLTRTGEEAMDLDPRAGEAIRALRTNLK
FVSVDEPPRVVSFTSADPSEGKSTVASNLARALALAGERVLVVDADLRRPRQHDLFQVAGDVGLSEVLAGEVQPDDALAA
TGIPNLTLLPAGRTPPNPSELLGSKRMRALLKLASEDFFVIVDSPPLLPVTDGSLLATAVDGTVLVVRQGRTRKDHLEAA
VENLAAVDAHLLGVVMNGVARSQRGGGYSYGYGYESTYHKSHEKYLSSVGSSAKKGRRSRRRARTRS
>gnl|bykdb|A0A143WVN6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridiales bacterium CHKCI006] (length=468 residues).
MEFQIDDIDFRSIVLDLIKNIWVIILAVLAVRMGISGYYELTYEPQYTSTATLAVTARGSSNGSYSSLTTAMNMADVFSE
VFQSDALKKMIEADIGESNIQGTINSSIISQTNLITLTVTSDTPAHAYQMIQSALDNYSSVSDYLFSNASLQMVREPNVP
YGPSNYVNYLRIQRMATLAAGGLTAAVIVLVSILRPTVKRKSSARRQLDGRILATIPYERKYKSIHEYLHKPKKSVLISS
RLLSMSFTESNRKLATLIERHMTRHQQKVLLVCSVAENEGKSSVASNIALALADRHKKVLLVDGDLRKPALHRIFDLHDQ
VKYSLSEYLLGQCSFEQVITEVPNGLQIICQTRGLNNSTKYIMSKNMLDFILKCRENYDLIVLDTPPIGAGVDVEAILNY
GDTSIMTVRQDWSEIGAINDFSDLLKQNDKEFMGFVLNAFHENILIEKSYGQYPYQNYQSRSVRKAEE
>gnl|bykdb|A0A143XN92 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridiales bacterium CHKCI001] (length=466 residues).
MQKYRDTNEMELKIDIRTMIKDVLRYSWLIVIMAISFSLIAYMIIDSSYKPKYTSSTTFIVTGKGLNNSIYDNLLTAQDM
TNRFKNIIDSNILKEKIAEVLSMDSFDAEAEAEIVPETNLMVLRVTADTSKKAFQILRAIMENYTVVSDYVVSNVILEVL
EEPQIPMAASNANQAEDIAKKAFWMSGTAVLALILFFSMKKDTIKSEEEFRKKLDIRYLGTIYHERKHKTIRSAIKRESV
NMLITNPILSRKYINSIEITAAKVRNRMDAKRIKTVMITSMMENEGKSTVAANLALEFAKMGKNVLLIDLDLRKPAQHDI
FGRKGEQFVGIAEWLENKIDLKEKIVRINNSNLFILFNSQPLQNSLELMDYSSWKDWIKKMEQEMDYILIDTSPVALTSD
GESLAHIIKDTILVVRYDTMLAADLNEVADTLNEAGSRVIGGIFNNAYSNILERIGMEQYGRKTSY
>gnl|bykdb|A0A143XPI5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridiales bacterium CHKCI001] (length=491 residues).
MKEEYSREPQRSEESIDIFYLFNNVWKGIRQFYWIFLIIISISTAAGYYYAKESYRPNYEAYASFAVDAGVSSYSSSYYN
STTIKQLSATFPYILTSGALRQIVMNDLGLEEMNVNITASAVEETNLFRIETSGRDPELVYEVLESVIKNYPEVAEYIIG
STKLVIVDDSGVPKEPSNQPNLKRMALNGCLAGIVLSGILLAVYALTRNTICGDEDVKKIMQIKSLGTLPTVKMKKRRKD
KNMEVSLLNQKLSPSFMEGIRTLRIRVDAALQEVSAKTILVNSAIQGEGKTTIAVNLALVRALRGEKVLLIDADLRNPSV
SQVLHLDTNKKEIADVLEGKLSWKSALISEQETGLQLLAGTYRRDNSAKLMESTYMEQLLEEAKEQFDCVIVDAPPCTIL
SDAIILAKKLDSVIMVIRYDYARVNQILRGSESLADTGISMIGYVLNAVESGIMSYGYYAYRYGYYHKGYRYYSINNKDM
ELHNKSTSQEK
>gnl|bykdb|A0A143ZUX1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Eubacteriaceae bacterium CHKCI005] (length=495 residues).
MYEQNTSATPSPTTLRYFRQLKKSWWIPTILLVIFAVAGFLFAQLTYKPTYSSIGSFWLQIYSTNENDQTKLVMSDIQAA
TGLAQTYQYFLTGADTIDYVLEESGLDLNPSQVKKMVSISQATGSVLELKVTASDPETAYRLAVAYMGAIDIVVNPKDDS
SGSGTAFVNSVQKIQPRMPQGPNTDYKKILYPAAGALLGLAVGLFLVWVLTRVSHTIQSEDDVYDFLPVKLFASIPTIGS
RSRSRKGNSSLLISPRSDFSYVEAYKSLRVRVESLAAERGYKKFIVTSTLADEGKSTVAANLAIALAQKGKKVLLIDVDL
RRPTQHNLFQQTTYRNKGLSDILTGSVYPMDAIHHNEKYGVYILYSGKPTDQASELLGNDLMNEFFKIVEPNFDFIIIDT
PPAHVVSDAMTIRRFVDATILVVRQDFTPASTIRHTLEDLDSEETPVIGCVFNGVARPNRLLGYGRYSSYYYDYRESDSS
QSQSSKKKQRITRNG
>gnl|bykdb|A0A173QTL1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerostipes hadrus] (length=522 residues).
MSSDKRNISVNDYEMNIDLYSILRDIWKYAIVILLLAASMSLLSYVYVGRSYHKQYESTSTFIVSSKGSNNSVYSDLSAT
SEMATKFSEILNSSILQKKVAKEMDMDYFPGSASAEVVNETNLLVLKVQADSPEMAFRLNKAIMNNYSVVTDQLIGNVVL
DVLQKPTVPSGPVNKFQPTALMKKTFFTTIVALCGLIAILSFLKDTVRKPKEVSRKLDAKLLQTLYHEKIYKTWKARIHR
KKSPVLLTNPGTSFQYVEDMKKLARKVSSKMKEKNAKTLLVASVEENEGKSTVAANLALALAEESEKVLLIDADLRKPSQ
YKIFGLDQEEIQQFGEVLNGNEQIDNLVTDLPKSELLLIAGSMIYPNSTEMIASPIFQKIVEFFKTKLDYIIIDTPPMSQ
AADAEELVDLADASILVVRQHTALVKDINETIGILNSAEGTMLGCVYNDVFHGVAQTARNYGYKYAYGSGYGYGSKYGYG
NHGYGYGYGYGYGYGYGSRTKKGNEDKTQESKTERQVKKDHE
>gnl|bykdb|A0A173SMI2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Dorea longicatena] (length=482 residues).
MESNNRNDMPAFMDTDLDPYTLVHDIVSNWWVIILGAIAGALLTYVVVSSRYVPEYTTQATFVVASRGDANAYSNLSSAN
TMAKTFEKILKSNIMEKKICEKLKVEELDADIHAKVLEGTNMLVLSVTADTPKDSIDIIRTVMDNYSSVSLYTVGSAVMD
VLEEPKVPYTPDNPLDAGGQAKKGGLVAGALVLILLGLFSYMKNTIKQENEIEKKLDARSLGAISYEWKYKTIRDIFRRK
KKAILVDDPVASFRFVESYKKLAAKVEYRMAKNEQKVLVVTSVSENEGKSTVAANLAITLAEQSKRVLLVDGDIRRPSQF
LIFGMEPKEENELGEYLRGNGSLADVMVPCTRKHMLFMGGKNCYSSSTEMLNSESFFKLMAASRKFVDYVIIDTPPAGII
GDAQIFAHCADAVMIVAKQNYMLAEDINEVMDAFRDKEGKVLGVVLNGVRSFSGLVDSPVGHYYGKYSKYGRYGNYGRSK
GM
>gnl|bykdb|A0A173T644 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia hydrogenotrophica] (length=486 residues).
MDERLEDREELEIDLGILLWNFLQGLARFWWLVILLAALGSAAYYVKNSQFYTPMYQSVASFTVMTGGNSENGQEEGSYN
FYYDTTTAGQLAKTFPYILGSSLLTDAIKEDLGVDSINGSISAQAVSDSNLITMTVTSSDPQDAKAILESAIKVYPEVSR
FVIGETKFNMIDVPTAPKEPYNQPNFVKKAVKGALLGAAAGIFLIVLYAFFRKTVQTPDELKNVMSLPCLGNLPEMKQKA
RKKKRRRDISILNKEFSQRFKESLLSIELKAERELQDKNGKILLVTSTISGEGKSTVALNMAYAAALHEKKVLFIDADLR
KQTDRRCLTETEGKGLYGVVTGKCSLEKAVEKDGRSGISFLCGSLPVRNVPAVLNRPEFQETLRRVRGEYDLVILDSPPA
EMFEDASLMAEFSDGICYVIRHDFVQKRRILESLAGLESSGTTILGYAFNGVPLHKGRYGYYGYGRYGYGYYGKYGYGEQ
DEETQS
>gnl|bykdb|A0A173TM61 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Ruminococcus] torques] (length=518 residues).
MDEMREKSGKEQQGEIEKIDLIEFLRSFQYGIKKMWWLVLVLALIFGLNSYIKARKNYTPVYTASATVAVTTIDGSPAYQ
NNASAQQMADVFPYILTSGVLKDVVAKDMKLDSVPGSISVKAEEGTNMLTISVTGTNAELSYKTLKSVIKNYPEVAQFVL
GNTTLKILDETGVPDDTTKQGVISSSWKRGALKGAIIGLVILSLYVLTRRTVKTGKEIKTHLNLVDLGTLPEVHVKKRNK
ESFYNSVNVLNKRIPQGYLEAFRKVGIKVMKQMEEEEFKTLLVTSSVPEEGKTAFSVNLAIIEAKLGKNVILVDCDMRRP
SVAKAMNQEGEFPGLQAVLQGKVKISEAMTTIELEKCPGSLQILYGKTTEGSSSDLLESKQMERLISILKKKADLVIFDT
APSEMLADAPVLARYLDAAVYVIRYDYAKMRQIRMGVENISMSGIHMLGYVLNRDRSTGGGYGYGYGYYGRYRYGRYGRY
GRYGGYRHYSRYEKQLDEPVAETGAVNQKEVFTETKEN
>gnl|bykdb|A0A173UY96 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerostipes hadrus] (length=522 residues).
MSSDKRNISVNDYEMNIDLYSILRDIWKYALVILLLAASMSLLSYVYVGRNYHKQYESTSTFIVSSKGSNNSVYSDLSAT
SEMATKFSEILNSSILQKKVAKEMDMDYFPGSASAEVVNETNLLVLKVQADSPEMAFRLNKAIMNNYSVVTDQLIGNVVL
DVLQKPTVPSGPVNKFQPTALMKKTFFTTIVALCGLIAILSFLKDTVRKPKEVSRKLDAKLLQTLYHEKIYKTWKARIHR
KKSPVLLTNPGTSFQYVEDMKKLARKVSSKMKEKNAKTLLVASVEENEGKSTVAANLALALAEESEKVLLIDADLRKPSQ
YKIFGLDQEEIQQFGEVLNGNEQIDNLVTDLPKSELLLIAGSMIYPNSTEMIASPIFQKIVEFFKTKLDYIIIDTPPMSQ
AADAEELVELADASILVVRQHTALVKDINETIGILNSAEGTMLGCVYNDVFHGVAQTARNYGYKYAYGSGYGYGSKYGYG
NHGYGYGYGYGYGYGYGSRTKKGNEDKTQESKTERQVKKDHE
>gnl|bykdb|A0A173Y645 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerostipes hadrus] (length=526 residues).
MSNEKHNISVNDYEMNIDLYSILRDISKYIVVILLLAASMSLLAYVYVGRSYHKQYESTSTFIVSSKGSNNSVYSDLSTT
TEMATKFSEILNSSILQKKVAKEMNMDYFPGTASAEVVNETNLLVLKVQADSPEMAFSLNKAIMNNYSVVTNRLIGTVVL
DVLQNPTVPSGPVNEFQPAALMKKTFVMTIVALCGLIAIISFLKDTVRKPKEVSKKLDGTLLQTLYHERLYKSWKARIHR
KKSSVLLTNPGTSFQYVEDMKKLARKVSSKMKDKQAKTLLVASVEENEGKSTVAANLALALAEESEKVLLIDADLRKPSQ
YKIFGLAPEEVQEFGEVLNGNEKSDHLVHALAKSELLLVTGTMIYPNSTEMIASDMFYKIVDFFKERLDYVIIDTPPMSQ
AADAEELVDYADASILVVRQHTALVKDINEAISILNSGEGTMLGCVYNDVFHGIAQTARNYGYRYAYGSGSSYGYGYGYG
NKYGYGGKYGYGYGYGRSSRQSKQEEQKEQHNKDSVTERQVKKEDE
>gnl|bykdb|A0A173ZYY6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Dorea longicatena] (length=482 residues).
MESSNRNDMPVFMDNDLDPYTLVHDIVSNWWVIILGAIAGALLTYVVVSSRYVPEYTTQATFVVSSRGDANAYSNLSSAN
TMAKTFEKILKSNIMEKKICEKLKVEELDADIHAKVLEGTNMLVLSVTADTPKDSIDIIRTVMDNYSSVSLYTVGSAVMD
VLEEPKVPYTPDNPLDAGGQAKKGGLVAGALVIILLGLFSYMKNTIKQENEIEKKLDARSLGAISYEWKYKTIRDIFRRK
KKAILVDDPVASFRFVESYKKLAAKVEYRMAKNEQKVLVVTSVSENEGKSTVAANLAITLAEQSKRVLLVDGDIRRPSQF
LIFGMEPKEENELGEYLRGNGSLADVMVPCTRKHMLFMGGKNCYSSSTEMLNSESFFKLMAACRKFVDYVIIDTPPAGII
GDAQIFAHCADAVMIVSKQNYMLAEDINEVMDDFRDKEGKVLGVVLNGVRSFSGLVDSPVGHYYGKYSKYGRYGNYGRSK
GM
>gnl|bykdb|A0A174A3T7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerostipes hadrus] (length=522 residues).
MSSDKRNISVNDYEMNIDLYSILRDIWKYAIVILLLAASMSLLSYVYVGRNYHKQYESTSTFIVSSKGSNNSVYSDLSAT
SEMATKFSEILNSSILQKKVAKEMDMDYFPGSASAEVVNETNLLVLKVQADSPEMAFRLNKAIMNNYSVVTDQLIGNVVL
DVLQKPTVPSGPVNKFQPTALMKKTFFTTIVALCGLIAILSFLKDTVRKPKEVSRKLDAKLLQTLYHEKIYKTWKARIHR
KKSPVLLTNPGTSFQYVEDMKKLARKVSSKMKEKNAKTLLVASVEENEGKSTVAANLALALAEESEKVLLIDADLRKPSQ
YKIFGLDQEEIQQFGEVLNGNEQIDNLVTDLPKSELLLIAGSMIYPNSTEMIASPIFQKIVEFFKTKLDYIIIDTPPMSQ
AADAEELVDLADASILVVRQHTALVKDINETISILNSAEGTMLGCVYNDVFHGVAQTARNYGYKYAYGSGYGYGNKYGYG
NHGYGYGYGYGYGYGYGSRTKKGNEDKTQESKTERQVKKDHE
>gnl|bykdb|A0A174ASH7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Dorea longicatena] (length=482 residues).
MESNNRNDMPAFMDTDLDPYTLVHDIVSNWWVIILGAIAGALLTYVVVSSRYVPEYTTQATFVVSSRGDANAYSNLSSAN
TMAKTFEKILKSNIMEKKICEKLKVEELDADIHAKVLEGTNMLVLSVTADTPKESIDIIRTVMDNYSSVSLYTVGSAVMD
VLEEPKIPYTPDNPLDAGGQAKKGGLVAGALVLILLGLFSYMKNTIKQENEIEKKLDARSLGAISYEWKYKTIRDIFRRK
KKAILVDDPVASFRFVESYKKLAAKVEYRMAKNEQKVLVVTSVSENEGKSTVAANLAITLAEQSKRVLLVDGDIRRPSQF
LIFGMEPKEENELGEYLRGNGSLADVMVPCTRKHMLFMGGKNCYSSSTEMLNSDSFYKLMTACRKFVDYVIIDTPPAGII
GDAQIFAHCADAVMIVAKQNYMLAEDINEVMDAFRDKEGKVLGVVLNGVRSFSGLVDSPVGHYYGKYSKYGRYGNYGRSK
GM
>gnl|bykdb|A0A174CJF8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia obeum] (length=467 residues).
MEERIDNETVQQIDLISMLKDIGREWLTILLLAIAAALFADIWICATYQPEYRTSTTFVVTAKGMNNNIYQNLNSTKELA
SQFTEILGSNVLKKKVAQDLGMNNLNVKTSVDLVPETNLITFSVKAGTAAESYRVLQSVMENYNTVSDYAIKNVIIETIQ
QPSVAMAPINPLDEKRTVMKVFVVAAGCLIALLAGISYIRDTIKNPGEVSTKLDTRLLGTIAYEKKSKALSMKRKKDYLS
MLIQNPLRSFAYVESSKMAASRVRSYMDKEDAKVLLVTSVMENEGKSTVAANLALSLAQGGSRVMLIDCDFRKPAQYKIF
NVRDNEETDLGDVLINHASTEKIIRNWNNSGLYMILNKTSSNAIETLLKSMTLKQIIAFCREKMDYVVIDTSPLALVADT
EELAQMTDASVLVVRQDTVLTKDINDAIDILNNTRGKVLGCILNGVTSQNMAGSGHYGYGGHYGKRA
>gnl|bykdb|A0A174DL89 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium disporicum] (length=446 residues).
MNKFKYFKLIKEKLSIIILITISSIIISTIATLFFIEPTYESKISVIIGPNQSTSGDYSSSQSSYDVVMYQKMVKTYSEL
LTSKIVLQDVIENTGLDLNLESLESMIKIKTTTESEFINITVEGKVPEVTTLVANQLTLSLKNISSEIRGVDNVILVDSA
SIPEKPTKPNIIINISLSFILGLIFSISLVVLINYLDQRIKDKDELKELITFPILGEIPDFSSVNINNKGNYLFVNESPK
SLPSEAINILRTNLQFCNVNYNLKKILITSSSPSEGKSTIISNLGISMALTNKKVIIIDCDMRKPKIHRIFSLSNIIGLS
HILSNQAELEECLQSSGINNLSILTAGVIPPNPSELISSNGMKILLDRLTSNFDFILIDSPPLPLVADSQALSTFVDGTI
IITKLGYTTKSALLNTKEILDGLKTNVIGVVLNNSPLDSSVNYYYQ
>gnl|bykdb|A0A174F2W5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Fusicatenibacter saccharivorans] (length=467 residues).
MGEYDRTGNGQNGEADWDLRSILCDMAKNWWIILLIACSAAMITYTVLTAVHRDQYTVKTTFAVMGRGENANAASSLSST
YEMTQKFQAILENNILKKKVMEELGCSSFPADMSASIVPESNLMELSVTADSPETAFRVLRSVLKNYTTISDYIIPNVVL
ETLQQPQVSGNPSNRIPTEKYAAMAFLAAALGTAALVGFFSFLRDTVKNETEFGRKIDADLLGTVYHEKKRKNSSMLITN
PARSFPYVESLKRIASRVRGRLDRRGGKVLLVTSVAENEGKSTLAANLALALSEEQNRVLLLDCDFRQPALYKIFELPQK
AGKDFGQVAAGKEPASSVFEKYKDTNVYMGICRERLEEPSEAVGGEIFRRILDMCRTNMDYIILDTPPMGAAADAEELVE
LADGAVLAVRQDGVLTRDINDAIDALNQKEEKVIGCVFGNVYPGFGERIGGSYGYGYGYGAYSRAER
>gnl|bykdb|A0A174GP12 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Dorea longicatena] (length=482 residues).
MESNNRNDMPAFMDTDLDPYTLVHDIVSNWWVIILGAIAGALLTYVVVSSRYVPEYTTQATFVVASRGDANAYSNLSSAN
TMAKTFEKILKSNIMEKKICEKLKVEELDADIHAKVLEGTNMLVLSVTADTPKDSIDIIRTVMDNYSSVSLYTVGSAVMD
VLEEPKVPYTPDNPLDAGGQAKKGGLVAGALVLILLGLFSYMKNTIKQENEIEKKLDARSLGAISYEWKYKTIRDIFRRK
KKAILVDDPVASFRFVESYKKLAAKVEYRMAKNEQKVLVVTSVSENEGKSTVAANLAITLAEQSKRVLLVDGDIRRPSQF
LIFGMEPKEENELGEYLRGNGSLADVMVPCTRKHMLFMGGKNCYSSSTEMLNSDSFYKLMTACRKFVDYVIIDTPPAGII
GDAQIFAHCADAVMIVAKQNYMLAEDINEVMDAFRDKEGKVLGVVLNGVRSFSGLVDSPVGHYYGKYSKYGRYGNYGRSK
GM
>gnl|bykdb|A0A174J359 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerostipes hadrus] (length=520 residues).
MSSDKRNISVNDYEMNIDLYSILRDIWKYAILILLLAASMSLLSYVYVGRNYHKQYESTSTFIVSSKGSNNSVYSDLSAT
SEMATKFSEILNSSILQKKVAKEMDMDYFPGSASAEVVNETNLLVLKVQADSPEMAFRLNKAIMNNYSVVTDQLIGNVVL
DVLQKPTVPSGPVNKFQPTALMKKTFSMTIVALCGLIAILSFLKDTVRKPKEVSRKLDAKLLQTLYHEKIYKTWKARIHR
KKSPVLLTNPGTSFQYVEDMKKLARKVSSKMKEKNAKTLLVASVEENEGKSTVAANLALALAEESEKVLLIDADLRKPSQ
YKIFGLDQEEIQQFGEVLNGNEQIDNLVTDLPKSELLLIAGSMIYPNSTEMIASPIFQKIVEFFKTKLDYIIIDTPPMSQ
AADAEELVDLADASILVVRQHTALVKDINETISILNSAEGTMLGCVYNDVFHGVAQTARNYGYKYAYGSGYGYGSKYGYG
NHGYGYGYGYGYGYGSRTKKGNEDKTQESKTERQVKKDHE
>gnl|bykdb|A0A174LSK1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Fusicatenibacter saccharivorans] (length=467 residues).
MGEYDRTGNGQSSKTDWDLRSILCDIAKNWWVILLIACSAAMITYTVMATVHKDRYTVKTTFAVMGRGVDANAASSLSAT
YEMAQKFEAILENTILKKKVMEELSLSSFPAKMNASIVPESNLMELSVTADSPEMAFRILKSVLNNYTSISDYIIPNVVL
ETLQQPQVSGVPSNQIPTKKYAATAFLAAALAMAALIGLFSFLRDTVKNEAEFTRKIDADLLGVVYHEKKKKNSSMLITN
PARSFLYVESLKRIASRVRGRLDRKGGKVLLVTSVAENEGKSTLAANLALALAEEQNRVLLLDCDFRQPALHKIFEIPEK
DGKDFGKVVLGKESASGVFEKHKDTNVYTGICRNRLEEPSLAIGGEIFHRILETCRTNMDYIILDTPPMGMTADAEELAE
YADAAVLSVRQDGVLTRDINDAIDALNQKEEKVIGCVFGNVYPGFGERIGNSYGYGYGYGTYSRAER
>gnl|bykdb|A0A174R7V0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia obeum] (length=467 residues).
MEERIDNETVQQIDLISMLKDIGREWLTILLLAIAAALFADIWICATYQPEYRTSTTFVVTAKGMNNNIYQNLNSTKELA
SQFTEILGSNVLKKKVAQDLGMNNLNVKTSVDLVPETNLITFSVKAETAAESYRVLQSVMENYNTVSDYAIKNVIIETIQ
QPSVAMAPINPLDEKRTVMKVFVVAAGCLIALLAGISYIRDTIKNPGEVSTKLDTRLLGTIAYEKKSKALSMKRKKDYLS
MLIQNPLRSFAYVESSKMAASRVRSYMDKEDAKVLLVTSVMENEGKSTVAANLALSLAQGGSRVMLIDCDFRKPAQYKIF
NVRDNEEKDLGDVLINHASTEKIIRNWNNSGLYMILNKTSSNAIETLLKSMTLKQIIAFCREKMDYVVIDTSPLALVADT
EELAQMTDASVLVVRQDTVLTKDINDAIDILNNTRGKVLGCILNGVTSQNMAGSGHYGYGGHYGKRA
>gnl|bykdb|A0A174S8E9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Fusicatenibacter saccharivorans] (length=467 residues).
MREYDRTGNGQNGEADWDLRSILCDMAKNWWIILLIACSAAMITYTVLTAVHRDQYTVKTTFAVMGRGENANAASSLSAT
YEMTQKFQAILENNILKKKVMEELGCSSFPADMSASIVPESNLMELSVTADSPETAFRVLRSVLKNYTTISDYIIPNVVL
ETLQQPQVSGNPSNRIPTEKYAAMAFLAAALGTAALVGFFSFLRDTVKNETEFGRKIDADLLGTVYHEKKRKNSSMLITN
PARSFPYVESLKRIASRVRGRLDRRGGKVLLVTSVAENEGKSTLAANLALALSEEQNRVLLLDCDFRQPALYKIFELPQK
AGKDFGQVAVGKESASSVFEKYKDTNVYMGICRERLEEPSEAVGGEIFRRILDTCRTNMDYIILDTPPMGAAADAEELVE
LADGAVLAVRQDGVLTRDINDAIDALNQKEEKVIGCVFGNVYPGFGERIGGSYGYGYGYGAYSRAER
>gnl|bykdb|A0A176JBT8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. SJS] (length=457 residues).
MEKTFEIKDLLNILRKNKILITSIPFVCLLIGFIYTYFIASPIYESKTDLLVNTTPTANTAEPVSPLEIDASLKLIETYQ
YILKSQRMADLVIKDLDGLLTEDEFLDNVKAESNGNSQIISIIVENKNPDDAALIANKTAVIFQSEIKKLMKIENVNILT
IATPYSSTSKPILLFNLLLSFAAGLILATIFVLIKELKNKKFESKKGITDLLGIPYLGEIPAIIPQGPTNKYLDERYNKL
VAHTEPHSSSSEAYRSVRANLDILRQSKQPVTILVTSTSAGDGKSLTCGNLAVTLAKDNKKVVFVDSDMRKPNGHSLFNL
HNRCGLTNYLTGFSSSDEIIQSTAIPKLSFISAGPISPNPHELIISKKMDLLIDRLKQKFDVILFDSSPLLVSDSILLSG
KMDGCIYVLNARKTNRDDANEKIELLKRSSNELIGAILNEKKTHKSNPHYYYGGYMG
>gnl|bykdb|A0A176U8D6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridiales bacterium KLE1615] (length=472 residues).
MVFMNSDEVMIVNEDEDEVTIDFFGIFHAIAKRWYIVLLAAVACGVALGVYGRFVVKDAYESEASMCIIDSNKEVSMSDL
QVGSALTNDYEGIIKSRVVLTKAIANLKLDIEYKDLYNAVSIENPDGTRIIKINVVSQDQKEAVDIANEILQISIEEIPN
VLGSSVPTVLDKAELSFTENTRHSILFYSVIGVVVGLFLACGIIALMVITNVSVKTDEDVQKCTGLSVLGAIPDYKGKKQ
KKIMWPENLPFNASEAIYQLRTGILYSSKDVKTIAVTSAFENQGKSFISFHLAYSLSQVGKRVLLVDTDMRKSVLQRRMG
LDGVKLGLSEYLSGNAELGQVIYDVGLPNMHVLFSGKLVPNASALLSAKWLENLCAEVRDSYDYVIFDTPPICVVGDAAI
VASFCDGALLVIENGVTKKKTLAQMKSEMDKVGANVIGVVQNMVGSKKDSSYYGKGNYGYYYGNYGNNQNKK
>gnl|bykdb|A0A1C5MS04 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Clostridium sp] (length=467 residues).
MLETILNNFHLEKILWILQKRIAYIMILGVLGGMAGGAYAYLTNSTLYRAEVSFYVYSDPDYVYDSSVNISNSEFTQAKN
LVQSYILILKSNTILQKVLEEAGLDYGTEALSGRIGTSVVENTAVFYVYTYDSDPYRAMELANAIGRVAPKEIGRIVKSG
GIEVIDYATLPEAPYSSTSLVKYALVGFAGCFGASFVLFLLAGLMDTTIRRRYELKLAFRIPVLGDIPQIQAPDRKSKPV
LVLGENSSFAVKESYNTIRANLLFTGKGERCPVYAVTSADKDEGKTLNSVNIAISYAQLGKKVLLIDGDMRNMAVASLLK
LRGRLGLSQYLAGLRETPQIVEYRQNLDVLVGGENPPNPSELLGGERMKELLTTLRSRYDCIIIDLPPVGIVTDALLLSH
EVTAYLLVVRAGVSHMSREKSAVTLLEQVDADICGILFNGLPPKSKDCNYRLQQYWQEYKQQNGEAV
>gnl|bykdb|A0A1C5P379 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Ruminococcus sp] (length=497 residues).
MKKNYTIKDLLVLLLGKVWYIVAASIVCAILALFVSKFVMSKQYQSHVSMYVKSADNQSTGQDKTNVDLQDINASKSLVQ
TYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTVTSGRVSNDGLRNAYSMTAVNQTEVLQITATTTNAKLSSDLCNIMAD
VAPSFLIRVIGAGSVEKIGDAEVYNTPVSPNTTKNVALGFVGGLMVAVLVILVIDFFDNTVKNSDELGDIYQKPIVGEIM
NIGGKTSKKDEGSSADRKKQLLFNNKDIPFNIVENYKTMRTNLMFTLSTTRNKIVVVSSPNPSEGKSVTVANLAASMAET
ENKVLLIDADMRRPVQHRNFKLKNNVGLSTILSGESTFDKCVHETKNGNFAVLTSGVLPPNPSELLASEKMRELLEYVQH
KYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKLEIGDCNLLGFVLNDISAKNGSHYRYKYSYKY
KYDYSYKYGGKDTSAES
>gnl|bykdb|A0A1C5PY68 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Ruminococcus sp] (length=467 residues).
MEERIDNETVQQIDLISMLKDIGREWLTILLLAIAAALFADIWICATYQPEYRTSTTFVVTAKGMNNNIYQNLNSTKELA
SQFTEILGSNVLKKKVAQDLGMNNLNVKTSVDLVPETNLITLSVKAGTAAESYRVLQSVMENYNTVSDYAIKNVIIETIQ
QPSVAMAPINPLDEKRTVMKVFVVTAGCLIVLLAGISYIRDTIKNPGEVSTKLDTRLLGTIAYEKKSKALSMKRKKDYLS
MLIQNPLRSFAYVESSKMAASRVRSYMDKEDAKVLLVTSVMENEGKSTVAANLALSLAQGGSRVMLIDCDFRKPAQYKIF
NVRDNEETDLGDVLINHASTEKIIRNWNNSGLYMILNKTSSNAIETLLKSMTLKQIIAFCREKMDYVVIDTSPLALVADT
EELAQMTDASVLVVRQDTVLTKDINDAIDILNNTRGKVLGCILNGVTSQNMAGSGHYGYGGHYGKRA
>gnl|bykdb|A0A1C5TSB8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Blautia sp] (length=486 residues).
MDERLEDREELEIDLGILLWNFLQGLARFWWLVILLAALGSAAYYVKNSQFYTPMYQSVASFTVMTGGNSENGQEEGSYN
FYYDTTTAGQLAKTFPYILGSSLLTDAIKEDLGVDSINGSISAQAVSDSNLITMTVTSSDPQDAKAILESAIKVYPEVSR
FVIGETKFNMIDVPTAPKEPYNQPNFVKKAVKGALLGAAAGIFLIVLYAFFRKTVQTPDELKNVMSLPCLGNLPEMKQKA
RKKKRRRDISILNKEFSQRFKESLLSIELKAERELQDKNGKILLVTSTISGEGKSTVALNMAYAAALHEKKVLFIDADLR
KQTDRRCLTETEGKGLYGVVTGKCSLEKAVEKDGRSGISFLCGSLPVRNVPAVLNRPEFQETLRRVRGEYDLVILDSPPA
EMFEDASLMAEFSDGICYVIRHDFVQKRRILESLAGLESSGTTILGYAFNGVPLHKGRYGYYGYGRYGYGYYGKYGYGEQ
DEETQS
>gnl|bykdb|A0A1C5X6X7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Ruminococcus sp] (length=497 residues).
MKKNYTIKDLLVLLLGKVWYIVAASIVCAILALFVSKFVMSKQYQSHVSMYVKSADNQSTGQDKTNVDLQDINASKSLVQ
TYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTVTSGRVSNDGLRNAYSMTAVNQTEVLQITATTTNAKLSSDLCNIMAD
VAPSFLIRVIGAGSVEKIGDAEVYNTPVSPNTTKNVALGFVGGLMVAVLVILVIDFFDNTVKNSDELGEIYQKPIVGEIM
NIGGKTSKKDEGSSADRKKQLLFNNKDIPFNIVENYKTMRTNLMFTLSTTRNKIVVVSSPNPSEGKSVTVANLAASMAET
ENKVLLIDADMRRPVQHRNFKLKNNVGLSTILSGESTFDKCVHETKNGNFAVLTSGVLPPNPSELLASEKMRELLEYVQH
KYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKLEIGDCNLLGFVLNDISAKNGSHYGYKYSYKY
KYDYSYKYGGKDTSAES
>gnl|bykdb|A0A1C6B4L6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Ruminococcus sp] (length=493 residues).
MENSYTIKELIGLFLNKIWIIIIVTIAGGILSFGFSKMFLPFEYSSHVSMYVQSYTGISDQMADQNNISNSKQLVNTYME
VLKDDAVMAAIGELLLEQFDEVILSENFTFNMSGEIETESLRKCIELSTVTDTSAVKVIATAKNPEIAASICNNLTSIAP
EYVAKAVGVGSINTIDKAKVYETPVAPNVIKNTLLGMAAALLIVVTIILITDYFDNTVKDVALLEKKYKKAIIGEIQEFA
AERNDKSSKDNYSKLTDKDIPFYIVERYKSIRTNVNFSLATSDKKIFAVSSANPSEGKSIISANIAIALAQGGNKALLID
ADMRKAVQHKIFEIKNKKGLSTAISKMNKLDECIQKNVMENLDVMTSGPLPPNPSELLASENMLAILDELNKKYQIIIID
TPPVNVVTDAMELAKCVSGIVVVLCYGRTTTEDIEAVVKKMEFSKVNMLGFILNSIKNKRSGRYYSKYKYDYKRGYGYYG
EKTDKNETKNEKK
>gnl|bykdb|A0A1C6EUV9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Eubacterium sp] (length=546 residues).
MSNEKHNISVNDYEMNIDLYSILRDISKYIVVILLLAASMSLLAYVYVGRSYHKQYESTSTFIVSSKGSNNSVYSDLGTT
TEMATKFSEILNSSILQKKVAKEMNMDYFPGTASAEVVNETNLLVLKVQADSPEMAFRLNKAIMNNYSVVTNQLIGTVVL
DVLQNPTVPSGPVNEFQPAALMKKTFVMTIIALCGLIAIVSFLKDTVRKPKEVSKKLDGTLLQTLYHERIYKSWKARIHR
KKSSVLLTNPGTSFQYVEDMKKLARKVSSKMKDKQAKTLLVASVEENEGKSTVAANLALALAEESEKVLLIDADLRKPSQ
YKIFGLAPEEVQEFGEVLNGNEKADHLVHALAKSELLLVTGTMIYPNSTEMIASDMFYKIVDFFKDRLDYVIIDTPPMSQ
AADAEELVDYADASILVVRQHTALVKDINEAISVLNSGDGTMLGCVYNDVFHGIAQTARNYGYRYAYGSGSSYGYGYGYG
SKYGYGGKYGYGYGYGYGRSSRQSQKEDQKEEHQKEQYKKEDHNKEQKEQHNKDSVTERQVKKEDE
>gnl|bykdb|A0A1C6G0U3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Clostridium sp] (length=440 residues).
MKEKLDFIEVLKIINKRKIIVISILSIFIIVTAIFNFYIIEPTYVADTTIIVSKSVTNTNDTISSEELSVTKNLAITYAN
IIKSRAVLEKVINSMNLENSYEEVYSSINVQSIEDTQIIKISVQNKSPEIARDIANSIPEIFKEEVKRLTNTNKVEIIDK
AIVNEKPIKPRKLINIAIASIIGILISIAFAFILDYLDSKIKNKGDVEKYLDLPIIGGIPMDKMLKKEVTNTLISNEGPI
LEAYRSIRTNIEFFNIDKTIKVIMVTSSQPGEGKSTFISNISKVFATLDDKKILLIDCDFRRPKIHKIFKISNTQGLTNI
LVKNIHISECINTVSGLNIITSGTKPINPSDILASKKMINFIKQIRNEYDYIFIDSPPVNIVSDSEVLSRIVDGVIVVIG
CNEVDRNSVKQCKEKLNNLNANILGCIVNKENIKKGNYYY
>gnl|bykdb|A0A1C6G8M0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Lachnospira sp] (length=474 residues).
MGGVCDFMENKKAVAVENAAEDTIDLLEIFRALYRRWVWIVFTALVFGIALGMYGKFVVKDVFQAEASMCIIDSNKEVSI
SDLQIGSALTNDYEGIIKSRVVLTKVISNLNLDIAYKSLYNAVSVDNPEATRIIRIRVVSGNKEEAVDIANEILSVSIEE
IPHVLGSNTPTVLDKADEFFAENTRRSVVSYILIGLMAGIVVSCGVIAISVITNTSIKNEEDIQKCSGLSVLGTIPDYKG
GKKRKEKIIWPDELPFSAAEAIYQLRTAILYSSKDVKMIAVTSAFENQGKSFISFHLAYSLSQVGKRVLLVDTDMRKSVL
QRRMGLEGVKLGLSEYLSGNAEVGQVIYDVGIPNMHVLFSGKLVTNASALLSAKWLRTLCDSVKDSYDYIIFDTPPVGVV
GDAAIVSSVCDGTLLVIENGVTKKKTLCQIAAELEKIDTNILGVVQNMVGSKKDSSYYGKGNYGYYYGNNQNKK
>gnl|bykdb|A0A1C6ITD7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Clostridium sp] (length=448 residues).
MKNILYYLDIIKKHLTLIIIITLISTILTAITTIFFIEPTYQANISIIIGQNQSTVDEGTSYPGSYDVVMYQKMVKTYSE
MITSRVVLEDVIENTGLDLNLADLESMIKIRTTTESEFISISIEGKIAKDTATIANQLVLSLKNISSELRGVDNVIMVDT
ASIPEKPSKPNIILNIGLSFLLGLMLSICLVILIDYLDQRIKDKSELKELIHLPILGEIPNFSSININNEDNYLFANVSP
KSLPSEAINILRTNLQFCNVNSNLKKILITSSSPSEGKSTIISNLGISIALTNKKVVIIDCDMRKPRIHRLFSLSNIIGL
SHILSNQAELEECLQSSGIENLSILTAGVIPPNPSELISSNGMKMLLDRLSSNFDFILIDSPPLPLVADSQVLSTFVDGT
IIVTKFGYTTKSALINTKEILDGLNTNVIGVLLNNSPINSSSNYYYKE
>gnl|bykdb|A0A1C6JIH3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][uncultured Ruminococcus sp] (length=497 residues).
MKKNYTIKDLLVLLLGKVWYIVAASIVCAILALFVSKFVMSKQYQSHVSMYVKSADNQSTGQDKTNVDLQDINASKSLVQ
TYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTVTSGRVSNDGLRNAYSMTAVNQTEVLQITATTTNAKLSSDLCNIMAD
VAPSFLIRVIGAGSVEKIGDAEVYNTPVSPNTTKNVALGFVGGLMVAVLVILVIDFFDNTVKNSDELGEIYQKPIVGEIM
NIGGKTSKKDEGSSADRKKQLLFNNKDIPFNIVENYKTMRTNLMFTLSTTRNKIVVVSSPNPSEGKSVTVANLAASMAET
ENKVLLIDADMRRPVQHRNFKLKNNVGLSTILSGESTFDKCVHETKNGNFAVLTSGVLPPNPSELLASEKMRELLEYVQH
KYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKLEIGDCNLLGFVLNDISAKNGSHYGYKYSYKY
KYDYSYKYGGKDASAES
>gnl|bykdb|A0A1E3BVC3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. Bc-iso-3] (length=463 residues).
MEKDDILEIDIREMVYLLLKKWYLIVLCFVLAAGSAFVVTQFYIKPIYKAETTLFLGKEKDQVSLSFADIQVNNQLVVDY
REILQSRRVAEIINQKFGVGISEFQNNVNVKTVKDSRLFSISYEDTDPKRAADVVNELASVIQKMADEIIQVKNIKVIDT
AKIPENPIKPNKKMNVGAAGLFGLVLGVGLIFLLELIDHTFKKPEEVERTLGINVIGTIPEFEGGKRGKKKAKDEKELQE
QYLKNLIVHNNPKATSAEAFRELRTNLYYSSVDREIKTIVVTSPTLGDGKTVTAVNLAVTLARSGKKVLVIDADLRKPKV
HHYFGVKNKEGLTNILTDSKEDIKVKPTEKSDISNLYIITSGPIPPNPAEMLNSNRMKKLLEKMKEEYDIIIIDTPPVGQ
VTDAAIVAGITDGVMLVLASGQTRIEMAKRATKSLESVKARFVGAVLTKLDTERTGYYSYKYE
>gnl|bykdb|A0A1G6BLB6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Eubacterium oxidoreducens] (length=485 residues).
MQFEERNEEPVQLFRFNGYTVGRDIIKHMKMIIMISVAAMLLMYAYLAYTYAETYTMTTTFTVVSASTENDAYTNIQSAS
TTATSFQTILSNSVVQEAVAKAAGMDSIPGTVTTSLVENTNLMTLSVTESSPKMTYAVMNAILDNYSSVSDKVLGSVIMT
ILDQSDIPTQPDAAFAPANAMVKMFIIVFCLMLVIVAFGSTFQDAIRAENEVEKKIDTKRLGTLYHEKKYKTFTRRSKKK
KRSILITDPTVSFSYSEAVRRMVSRVRNKMNHRNSKVLMVTSVLENEGKSTVAVNLALELVEEEQKVLLIDGDFRKPALY
KVLQIDPKEVTDLGEVLNHKISPKNMIYQKENSNLHLLLNTVIYPNSTELLSQGLLERIIGELKREYDYIIIDCSPMALV
ADAEEMLNMVDNTLLVVRQHYANVRDINDAIDIINSRKEKLIGCVFNNVGGNRVSLTHGGQGYGEYGNYGYGRYHQYDHS
EREGE
>gnl|bykdb|A0A1G6BLF1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Eubacterium oxidoreducens] (length=500 residues).
MAEYSSRQGTAPSAIDLGTIVDDVWKGFWRIWWLLLVIISICATLFYTHVKMVYEPKYTAEATYLVTAASYYGYTESYYN
ETTASGLATSLEYVLNSTVMQKTVAEALDMESVPGTIAVAVVEETNMITIKATADSAQMAYNILQAVIESYPIVAESVIG
STTLEVMSESGVPTAPSNEDWSHGAAKTGILIGFVIDILVLFVYSMTKRTIRKEKDFAKILNVKCIAAIPHVRFKKRGKN
ASKNVELVLMDNFRVPPGFVEAMRSVRRRIENHSLDTKKNIYLVTSALPEEGKSTVAANIALSLALKGEKVVIVDMDLRN
PSLADSFALESVKCGTIDVLKGRKEIQDALVQYKDTSLEILPGGKAISKTSRVLSSEKVGNLIRTLQKEYDYVILDTPPC
ALLNDATMVASQAQAAIFVVRQDYARVDRIYEGIENLAETGVDIMGCLLNGAEVGLTGTGYSKSYSYARYGYGHGEKRYG
YGYGGYGIKEDEEKKSENNK
>gnl|bykdb|A0A1G9H5B9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Sarcina sp. DSM 11001] (length=525 residues).
MKKKANQIDLVKMLFFILKHLWLLVLCAELGFGAFYMYMTRRMPETYTATGTMYVSSYNPEYIDDEYTRPGDLSSASQLI
KTLLVVVKRDSVMSKVADRVSETHPGIDAGMVSSSLSMESVSETGVVAVKSTTLEAQLSADIANAVMEIAPEEIVRVVGV
GNVDIMDYAVVPVLPNEKKAVFSSLKYGAAAGAAFAVVLLALLYILNQKITDLRELKENYKLPILAEIKRLDSAKKDPEA
FLLTNRSPLEVSENYAKLRMNLFYTLVDKEQKIVVITSSVSGEGKSTISANLAISCAMSGNKVILVDSDMRRSSQSEIFK
YETDKEGLSDVLAGRCQWQNVIMKDVAQKVDLLPAGHLPPNPAELLESARMQQLLLELNDAYDLVLLDMPPVDIVADPLA
VSAHVAGCILMVRQHFTTHQDLRKALNAAEMTDMNVLGFVFYGEHMHESGYYSRKYYRKYYKNYYSKRTTRGSTLGSNLE
TARGSTLQTNQGSTQGSNLETTRGSTHINTQETENESADHRSVDK
>gnl|bykdb|A0A1G9IUT4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Romboutsia lituseburensis DSM 797] (length=442 residues).
MEEIINLRQCFQIIKKNISLIIIITCITMFTSAGLSFFVIDPVYEANTTLIVNKVKEVNTQDITNDDVLANQKLALTYGE
IIKSRTVLDKVIKNLNIDTDVKKLSNDIRVTTLTDTQIINVSVREDNPKLANNIANEIASVFTSELSRIMKTNNVEIIDK
STIPDKPVKPNKIMNTMIGAIIGLILGLIVTFVREYIDTKVKSSKDVEEKLNLQIIGNIPNENNLDSKNMKSILDENYKN
IRTNIEFSNVDKNIKSIVITSSQKNEGKTTIVSSLGSSFAQLDKKILIIDCDFRNPSIHKVFDISNKQGIADVLLNKVNL
KDCVHEISSENLNVLTCGSIPSNPSELLSSHKMQKLLEELKNEYDYIFIDSPPIGRVTDAGVISNYVDSTIIVIAENEVN
IDDVKVAKKKLQQVNANILGSIFNKSSLYKSECYYGYYYENE
>gnl|bykdb|A0A1G9WHW8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lachnospira pectinoschiza] (length=475 residues).
MFKIIVANFHLEKILWIIKKNLTYMVFCGLVAALLFGGYAYATRSSVYQAKISFYAYSDPDYASDTSVNITYSEVNQAKN
LISSYTQILKSNTFLEALKEETGLNYSTSTFKNIISTSAVEDTAVFYVYVVDSNPLNAQKIANAIGELAPDMIVTLVKAG
GVQVLDSAELPTSPYQQTNVPFTAILGFFFGAILAFIFFILKGLLNTTIRKKYEIEDMFTIPILGDVPEIETEEAKGVIK
NSSYNPKVLNEDSTFTITEAYNSIRTKLLYTAKDQKCPIYGITSADSGEGKSLNSMNLAISYSFLGKKVLLIDGDLRKSG
ISRVLKTTSRQGLSQYLAGINKDYELFNYNNNLDILFAGEIPPNPMELLSSEKCKNLLESLKETYDVIFIDFPPVGEVAD
ALALADSVTSFVLVVRENHTKFDKEENVIRTIEPLGADICGFIYNGIAVNSREYKYNTKKYGKEYGYGLKYSASK
>gnl|bykdb|A0A1H5VAA0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lachnospira multipara] (length=475 residues).
MFKIIVANFHLEKILWIIKKNLTYMVFCGLVAALLFGGYAYATRSSVYQAKISFYAYSDPDYASDTSVNITYSEVNQAKN
LISSYTQILKSNTFLEALKEETGLNYSTSTFKNIISTSAVEDTAVFYVYVVDSNPLNAQKIANAIGELAPDMIVTLVKAG
GVQVLDSAELPTSPYQQTNVPFTAILGFFFGAILAFIFFILKGLLNTTIRKKYEIEDMFTIPILGDVPEIETEETKGVIK
NSSYNPKVLNEDSTFTITEAYNSIRTKLLYTAKDQKCPIYGITSADSGEGKSLNSMNLAISYSFLGKKVLLIDGDLRKSG
ISRVLKTTSRQGLSQYLAGINKDYDLFNYNNNLDILFAGEIPPNPMELLSSEKCKNLLESLKETYDVIFIDFPPVGEVAD
ALALADSVTSFVLVVRENHTKFDKEENVIRTIEPLGADICGFIYNGIAVNSREYKYNTKKYGKEYGYGLKYSASK
>gnl|bykdb|A0A1H6IUB1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus flavefaciens] (length=535 residues).
MDNGYSIKDIISLLLSKLWLLIIVTIIGGAAAFCYSKFVMPLKYSSHISMYVQSYTGITENANQQNNISNSKQLVNTYME
VLKDDAVMNAVGDKLLTQFDADTLSKNFGMSDGKIAPASIRNCLSISSVTDTSAVKIVSTTKNAEVAAALCNDLTEVAPS
YVEEAVGVGSINTIDRAKVYNSPVAPNMKKNAVLGAMAALMLTCMIIFLIDFFDNTVKDTDSVADKFKKPIIGEIAAFGV
EKKKKDSDEDEHVKLTDKSVPFNVVESYKSIRTNISFALSTVDKKIFAVSSANPREGKSTTSSNIAIALAQGGNKILLID
ADMRKAVQHKVFGLKNKKGLSSAISKMCSLEECIHKNVMENLDVMTAGPVPPNPSELLASDNMGAILEKLSEEYSMILID
TPPVNVVTDAMELAKYVSGIVLVLRYGVTTNEDAEDAIKKIEFAKMNMLGFIMNDIKMKKSGYYSSKYKGKYYYKKGYGY
GGYGGYYGSKPETDDDTAEEVKEETAKKETVKKESPSTKTNKNSKNKNAKKKGKK
>gnl|bykdb|A0A1H9EPU3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lachnospiraceae bacterium RM5] (length=549 residues).
MSNQTDEKFFQDDIGQTPGKILENAPVTPRKPAIINNNNIAKKTQDEETIDLRQIFGLLWVNKILIILLGLCVAVIAFVY
SKFVITPLYSASTQILVMNENSGTGNTTTDGKSVSVSDLQSSTFLVKDYTYMITSKPVMKSVIDEYGLDLTYSGLASKVS
VTSPTDTRILTITVTDPDPVMSKNLADSIRDAAIKHIQGIIGVDTVKAIDGDIGAVTPTSPSSPNVSRNTLLGMLIGIFI
ACAIVVLRFMLDDSIKTQEDVENKIGLSVLANMPYKENIEEGLYENDPEKKEKNKLKLRQNGQVIPTNKDIRISKNISEA
YKKLRSNIQFSGRHVRVIGITSTVPNEGKSVLSLNLAISLAELGKRVIFIDADLRKSVLVGRYKISKQVKGLTHYLSGVN
SFDEVVCETNVKNLHMVFSGIVPPNPAELLESVYFRELVKQLRQAYDYVVIDTPPVGTVIDGAIIGKECDGVVMVVGSGD
ISYKLVERAKEQLETSGSRILGVALNKVPMDKGKGYYGKYYGGYYGGYYGYGNYSYGSYENEEASKDKK
>gnl|bykdb|A0A1I0RG99 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Clostridium] fimetarium] (length=462 residues).
MEFSFKEILEILAKRFVFIAICTFVGICSFFINSKYIIKPTYVASVQMYVNPNETTYSADLNELNYAQKVVTTYINFLQT
KVFYKQVIDESKLNYTPMQLKAMTHIKAINNTEIFEISVTTTNPNDAYKLVDAMKKIAPVLIKSIKETSQITVVDPPTLP
TSPSSPNILKNTLVGGMFGFVLSIAVSLLLVLFDLNVKNQDELLKRYQLPILGTIPNFNVNIKRKFVLKKTILTDLLHKK
VKRNNISKNKDTEFVIAEAYKSLRSNLNFTLRFNGCKKIIISSPVPQDGKSTTITNVGISIAQTGAKVLLMDCDLRKGRL
HRLFNIQLIPGVSDALSSTMDVKKSIYKTSYDNLYVMPMGTIPPNPSELLASIQMEELLSQLNNEYEYILIDTPPVKVVS
DALNLVKMVDGVLIVVREGVTSHPCVSSVITKFQFLNANILGFVLNGISLNQQERSKYRYYN
>gnl|bykdb|A0A1I4C3N6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lachnospiraceae bacterium KH1T2] (length=476 residues).
MFKIFFANLHLEKILWIIKSKILYIIMFALVGGAVGGAYALFMGQDLYRSEITMTAFSNPDYANDSGININVSDVQSAQQ
LITSYSSVLTSSIFLNDVLEASGLQDQYSVLALQRRISARQITNTSMFVIYVVDPNPMNAQLIANTIGEIAPTRLVGLVK
SGGLQVLDEAKLPTEPYESTSTILFALIGAVGFGVMSAVGFLFFGLQDTRIRRKYEVEDMFNIPIIGTVPLVESTDKVKK
SPILGENSSFEMREAYNEIRTFLTFSKRDEKCPVYGILSADKGEGKTVSALNIASSLANTGKKILFIDADLRESRTAEVL
GMSGTGLSEYLGSDEAELNIQRSGRGFDVILAGAKPSNAADLLAGGKIRELINAQKENYDMIIVDLAPAGRVIDGLELAD
CLTSYVLVVREMVTKFEREEMIIRNIEELKGDICGFIYNGISTKSEDYNYKKAAEKYGFVDTSAKVVSAKKKVAAR
>gnl|bykdb|A0A1I5G322 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerocolumna aminovalerica] (length=480 residues).
MEFTLKEIFEIFMKRIVFITVCTIGGLCVSFLYSKYIIKPTYIASVQMYVNSNDSTSSADLNELNYAQKVVTTYISFLQT
KKFYEQVIEESNLRLSREQLKNMTNIESINNTEIFEISVSSMNPNHSFLLVKSMEKIAPELIKSIKDTAQISIVDPPALP
TSPSSPNIFKNTLIGGMITFIITILISLLGEVMDVNVKNQDDLLRKYQVPILGVIPNYKNNKKKKVLLIKLTSIAKRLNK
KIDSKENKKAGKSENIKENAEKDTQFIITEAYNSLRTNLKFTLRHQGCKKIVISSSLPEDGKSTITTNLGIVIGQTGSKV
LLVDCDLRKGRLHNFFNIKSSPGVTNVLSNMIDIENAIQKTTYDNLYVLPLGTIPPNPSELMASSQMEELLKKLEREYDY
IIIDTPPVRVVSDALILMKAADGVLIVVREEVTSHSDITNFLSKCKYMEIKVLGFILNGISLNQEKKSKYHYYYYNNYND
>gnl|bykdb|A0A1I5HIC6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerocolumna aminovalerica] (length=472 residues).
MPNNNDIEIDIGDLFFLLLHKMWFILLWGILSAAAAIFISKVFITPVYTSSTKLYIINRQNKDTITSSDLQTGSQLTQDY
KILVLSRPVTEQVLSKLNLDMTHEELVSNITVKVPENTRILEISVQNPNPETAKQLADSIAEESAERMVSILEMEKVNIV
EEGDIPSFPTSPSIIKNAILGSLAGAFISTFIIILIHIIDDTVKDVEQIEKYLGLTVLGTIPLETKYAGKIKNKKKAIKK
RKKEENIYPEGISIEKASLEFSVNEAYKTLRTNIQFCGKDIKTICITSSLPDEGKTVVAFRLATALSESGKKVLFIDADL
RKSVIVNRLKISNGANGLSQYLSGMSTLEEVIHKTNVENVDIIFTGILPPHPSEMLGNEEFKDLVRSQREIYDYIIIDTP
PLGVVIDSANVAEICDGTILVIESGKISYRLIQRVLKQLITGKSRVLGAVLNKANIYGKGYKKNYYGKYYGR
>gnl|bykdb|A0A1K1WYK8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus flavefaciens] (length=506 residues).
MKNTYTIKDLLSLLWNHLMLIIAITIIGGIAAFSFSKFVLPVKYSSHITMYVQSYTGISENAANDVNNISNSKQLVNTYM
EVLKDDEVMNAVSAKLLEQYDEQDLRRVFSFDEDNKIDPASIRSCLTISSVTDTSAVTITATTVNPNLAADICNDITQVA
PKYVEEAVGVGSINTIGKAKVYKKPVAPNNTKNGILGMAAAFLIVVMVILIIDYFDNTIKESEKIAKKYDKAIIGEIQQF
GEGKKKKKGKHRTEPRGLLTDKDVPFNIVESYKTIRANILFTAADSDKKVIAVSSPNPGEGKSTSAANLAIALAQTGSAV
LLIDADMRKPVQHRTFKIKNDEGLSTLIIKKSSMAKSVKSNVINNLDLLPSGPLPPNPSELLASENFKKLLEQFATNYDY
VIIDTPPVNVVSDAMVMKDSISGIMLVIRYAMTTYEELANCMKQIELAKVNMLGFVLNDVHHNHGANYYNYKYKYKKYGY
GYGSYGYGYTYGNNPTEETKENENAD
>gnl|bykdb|A0A1M5UYN6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium grantii DSM 8605] (length=467 residues).
MQKDDRLDLRDYLHIIKKKIMVIITITFLTTLIGGIYSFYVLKPTYYSSMSVIIGKTVSVDGNISMDINDVTMYVKALET
YIQIAKSEDVAEGARGILGDRYSSGQLMGMLSVGAQSNTQIMNITVQAGNEEEAKEIVLAITQSFKENAEKLIPNGNIKI
FQNPRSFQDSVNKIKIILYSFILGLLISITLVFLLDFLDNTIKTKEEVEKFIGLPVIGLIPKITEKVYLIVKSNPSSIAA
EGFRTLRTNIQYSSIDKKIRTIVVTSAGQGEGKTQVSGNLALTMANLEKKTIIIDCDMRRPNVHRKFRISNEIGLSDILS
EQAEFEEVVHSYDKHLCVIPSGPMPPNPAEMLNSIKMKFFIEKLKNDFDYIILDTPPVIPVTDAQVIANEADGVILVVAS
NEADKDAVVRAKELLLKVRANILGVVLNKIEFSKGKGYWYNYEYYYSYGSSNKHKNTKSKRLKQKSI
>gnl|bykdb|A0A1M6E8I2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Dethiosulfatibacter aminovorans DSM 17477] (length=455 residues).
MGEEWNLLELVQIVLKRKWIVVATTIFAAILAILVTMVAITPVYESNTTLMVNSSKTSSLGDIASGFDIGSINLSQKLVV
TYSEIVKSRIVLEAVIDKIELDMTYNELLEDITSSPVGSTEILKISVKNTDPAMASEIANTIADVFIKEVMRILKVDNVE
IIDEAIPIDHPVNINLKFNGAIGFIVGIMTGLSIILMLEMLDGTIKTSDDIEKHIGLPVIGSIFEFNSESEGIIVHENPK
SPISEAYRSLRTNINFANLDNNMKTILITSATPGEGKTQTVMNLAVAMAQNDKKVIVVDCDMRKPRIHKILNISNTSGIA
EYLMDGRNIDDYINRMYNLDIDVMTSGKLPGNPSELLQSNVMKKMVEFLEKKYDYVLFDSPPVVPVTDAVVMTRYIEGAI
LVVASGNVGVDMVKKAKKSLEFSGVKLIGSVLNIIPTNHSKGYNSYYYYYEESET
>gnl|bykdb|A0A1M6JRJ5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerocolumna jejuensis DSM 15929] (length=474 residues).
MEFTVTDILHLLKKRFILIAACTLGGLLLSFLYTSYFVDKTYTASTQFYVSTADSTAANLSELDYAQKIAETYINFLNTR
QFYAQVLELSRLPYSMPDLKKMTEIKTVQNTEIFSITLTSKNPDDSYRLVKSMETIAPKLIEKIKSDAVINVVDPVVYQP
SPSGPNTILNTLLGGIICGFMAFFLSMVKEVLNLKVVSQEDLLKHYNIPLLGAIPDFAAEDNSRDKSIPARLKKLIRKGY
GEDLNQGLITQDSFLVTESYKALRTNLRFSIRKEECKKILITSPSPEDGKSTTSINLSIAISQAGYKVLLIDCDLRKGRL
HHYFKAKSQPGLSDLLSHINSLKECLYITPYENLHMMPMGSTPPNPSELLGSKQMELLIKELETEYDYIVLDTPPVNVVA
DSLSFIKSTDGAILVTRENKTTYSDIDNALMKYHYAKANILGFVLNGISEKELGGHKSKYYYSTKKNKNNGIVH
>gnl|bykdb|A0A1M6RWV2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerobranca californiensis DSM 14826] (length=447 residues).
MEAYEYEIDLRELFEIILNKLWLIILIVLITTITTSVVSFFFLDKVYEASTKLVLVKGGDSDIQYNDVLLNQRLVKTYSE
IASSRTIAEEVINNLKLNMSYGEFSNKVRVNSVRDTEVIEIKVQDTNPQLAARIANELSEVFIDRIHEFIKMENVRILDY
AVVPSNPIKPRPMLNIAIALVLGLMIGIGLVFLLEYLDNSFKGPDDVEKRLNLPVLGAVPAVENENSLRLITMKDPKSPI
SEAYRILRTNIQFSNLDNKLKTILVTSSGPAEGKSTTISNLAVTMVNMGHKVLLIDADFRKPQIHKIFNLSNDVGMTNIL
MGEKLEDVIHTVGGLKLDIITTGPIPPNPSEILGSNAMKKFIEQCKEYYDIILIDSPPAGIVTDAAVLSKITDGTLFVVA
AGQTTIELAQKAKDMLDKVQAKVIGVLVNKVNIEKRRYQYYYYYLED
>gnl|bykdb|A0A1M7L1F9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus flavefaciens] (length=533 residues).
MNNSYSIKDIINLLLSKLWLLILVTIIGGTAAFCYSKFVMPLKYSSHISMYVQSYTGISENANQQNNISNSKQLVNTYME
VLKDDAVMNSVGELLKKQFDEDTLIKNFGMSEGRISPSAIRDCYSISSVTDTSAVKIVATTKNAEVAAALCNDLTEVAPD
YVEEAVGVGSINTIDVAKVYNNPVAPNMKKNAVLGAMAALMLTCMIIFLVDFFDNTVRDTDAVGKEFKKPIIGEIASFGI
EKKKKDQDEDAHVKLTDKNVPFTVVESYKSIRTNVSFALSTVDKKIFAVSSSNPREGKSTTSANIAIALAQGGNKILLID
ADMRKAVQHKIFGLKNKKGLSSAISKMSKLEECIQKDVMENLDVMTAGPVPPNPSELLASDNMGAILEQLSSEYSMILID
TPPVNVVTDAMELAKYISGIIVVLRYGVTTNEDVDAAIKKVEFAQMNMLGFIMNDVKIKKAGYYSKYKNKYYYKKGYGYG
GYGYYGSKPETSDDDTDVEEKEETVKKEAAPKKTNNNSNNKSKKSNGKKKGKK
>gnl|bykdb|A0A1M7Y1S2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerocolumna xylanovorans DSM 12503] (length=469 residues).
MEFTVRDILYLIKKRFILIAACTFAGLLLSFLYTRYFVDKTYTASSQFYVSTIESTSANLSELDYAQKIAETYINFLNTR
QFYSQVLELSGLPYSVTDLRNMTEIKAIQNTEIFSITLTSNNPNDSYRLVKSMEMIVPKLIEKIKTNSMIYVVDPVVCPT
SPSGPNILLNTLLGGIVCGFLAFFLFVLKEILNLKVINQEDLLKHYDTPLLGCIPDFSPVNSSRKNKILLELKGILIKGE
NFMKPEKIQNRQNSFLVAESYKTLRTNLRFSIRKEGCKKILITSPSPEDGKSTISINLSIAIAHAGYKVLLIDCDLRKGR
IHHHFKGKSQPGLSDFLSNINSLKECLYITPYDNLHIMPMGSIPPNPSELLGSRQMELLIKELEAEYDYIILDTPPINIV
ADSLSFIKSTDGAILVVRENKTTYTDIDNALMKYRYARANILGVVLNGISERDLGGYKSKYYYYNPDNK
>gnl|bykdb|A0A1Q6K0H6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridiales bacterium 45_37] (length=520 residues).
MSSDKRNISVNDYEMNIDLYSILRDIWKYAIVILLLAASMSLLSYVYVGRNYHKQYESTSTFIVSSKGSNNSVYSDLSAT
SEMATKFSEILNSSILQKKVAKEMDMDYFPGSASAEVVNETNLLVLKVQADSPEMAFRLNKAIMNNYSVVTDQLIGNVVL
DVLQKPTVPSGPVNKFQPTALMKKTFFTTIVALCGLIAILSFLKDTVRKPKEVSRKLDAKLLQTLYHEKIYKTWKARIHR
KKSPVLLTNPGTSFQYVEDMKKLARKVSSKMKEKNAKTLLVASVEENEGKSTVAANLALALAEESEKVLLIDADLRKPSQ
YKIFGLNQEEIQQFGEVLNGNEQIDNLVTDLPKSELLLIAGSMIYPNSTEMIASPIFQKIVEFFKTKLDYIIIDTPPMSQ
AADAEELVDLADASILVVRQHTALVKDINETISILNSAEGTMLGCVYNDVFHGVAQTARNYGYKYAYGSGYGYGSKYGYG
NHGYGYGYGYGYGYGSRTKKGNEDKTQESKTERQVKKDHE
>gnl|bykdb|A0A1Q6KSQ5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridiales bacterium 41_12_two_minus] (length=475 residues).
MLGGVCDFMENKKAVAVENAAEDTIDLLEIFRALYRRWVWIVFAALVFGIALGMYGKFVVKDVFQAEASMCIIDSNKEVS
ISDLQIGSALTNDYEGIIKSRVVLTKVISNLNLNIAYKSLYNAVSVDNPEATRIIRIRVVSGNKEEAVDIANEILSVSIE
EIPHVLGSNTPTVLDKADEFFAENTRRSVVSYILIGLMAGIVVSCGVIAISVITNTSIKNEEDIQKCSGLSVLGTIPDYK
GGKKRKEKIIWPDELPFSAAEAIYQLRTAILYSSKDVKMIAVTSAFENQGKSFISFHLAYSLSQVGKRVLLVDTDMRKSV
LQRRMGLEGVKLGLSEYLSGNAEVGQVIYDVGIPNMHVLFSGKLVTNASALLSAKWLRTLCDSVKDSYDYIIFDTPPVGV
VGDAAIVSSVCDGTLLVIENGVTKKKTLCQIAAELEKIDTNILGVVQNMVGSKKDSSYYGKGNYGYYYGNNQNKK
>gnl|bykdb|A0A1Q6REE0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Firmicutes bacterium CAG:110_56_8] (length=480 residues).
MEIEKTEQQGRDTFVLLDDFLHQAKRMWLLGLALVLICAAGLTFVQRRAYRPVYEASASFTVRVANPLYASVSSYNEKTA
QVMADTFPSILTSGLLQRRVMEELGIDEVPAMSVSATAHSSILTLKVRDTDPQRAYDVMSAVIACYPEVAEFVVGSTVLV
LLDESGMPTAPVAEFNYRYYITCGAVVGAAVWCVILAFLVLMKNTVHNEDELRETLNAPCLGQIPAVKISRKRPYPLLHR
YRSESGFSESVRLLRLRVEKAMQENGQKILLVSSAIPGEGKTTVSVNLAVSLAQKGRRVLLIDCDFRNPSVAKTLSSKSH
PLDEGRNLTNFTGSGEAAGALAQATDVEGLFVIVGNADGKADYFDAPTQARLTKLIRYARDKYDYVILDTPPCSLLTDAA
EAAEAAEAGLMVIRQDYASRDQILDGAQRLSDSRLPIIGCALNNVRRGLSGSKEYGYGYGYGYGYGYGYGYGSKSRQEKK
>gnl|bykdb|A0A1Q6S448 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Oscillibacter sp. CAG:241_62_21] (length=499 residues).
MDENNQGLQWSHIEPLCILRALARQLWMLLLAALTCSMAAWIVLTCFVTQQYTSSTTFSVTTRTSNLYYTNITAAADVAA
SYSQLLQSRVLRQTMEQNLGMPLNGTVSAQQLGETNLIRVTVTADTPRQALVLLQAVSDNYGSLSAHVSSSAVLTQLNAP
SLSVSAARSYNVPRTCLIAAAAGAALTAAAVVWAAVFSGTVQTLEGARSGLDARIISSVPHEGRRTRKLLGWFDDRRRER
RARRGGKRLRRNLNISSPAISFAFTESIHRIAEKFQHEHAKGRRVFLFSSVSAAEGKSTLAANTAISLASRGVSVLFIDL
DLRRPVQSEMLGLSVKQKNELGTLLTESAAPEKILAAAVTDPATGLHSLLSTKSYTDVIELLASDQLAKVVALARERYDY
VIIDSPPLGFFSDSELLSDLSDASVLVVRQDTVPAPEINDAIDALRAGKAEFLGCILNDMAHLTAYSAGYGYGCGYYGYG
YGKKYDKYGCGHRSGQKQQ
>gnl|bykdb|A0A1Q6T9P4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus sp. 37_24] (length=493 residues).
MKNSYTIKELIGLFLNKIWIIIIVTIAGGILSFGFSKMFLPFEYSSHVSMYVQSYTGISDQMADQNNISNSKQLVNTYME
VLKDDAVMAAIGELLLEQFDEVILSENFTFNMSGEIETESLRKCIELSTVTDTSAVKVIATAKNPEIAASICNNLTSIAP
EYVAKAVGVGSINTIDKAKVYETPVAPNVIKNTLLGMAAALLIVVTIILITDYFDNTVKDVALLEKKYKKAIIGEIQEFA
AERNDKSSKDNYSKLTDKDIPFYIVERYKSIRTNVNFSLATSDKKIFAVSSANPSEGKSIISANIAIALAQGGNKALLID
ADMRKAVQHKIFEIKNKKGLSTAISKMNKLDECIQKNVMENLDVMTSGPLPPNPSELLASENMLAILDELNKKYQIIIID
TPPVNVVTDAMELAKCVSGIVVVLRYGRTTTEDIEAVVKKMDFSKVNMLGFILNGIKNKRSGRYYSKYKYDYKRGYGYYG
EKTDTNETKNEKK
>gnl|bykdb|A0A1Q9JSI0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerostipes sp. 494a] (length=511 residues).
MSENKNTSINDYEMNIDLYSICKDIWKYALVILLLAASMSLLAYVKVGRSYHKMYESTSTFIVSGKGSNNNVYSNLNTTA
QMATKFSEILNSSILQKKVAKEMNMDYFPGTASSEVINETNLLVLKVQADSPELAFRLNKAIMNNYSVVSDELMGNVVLD
VLQNPTVPSGPVNKFQPTALMKKTFVYTLIFLCGLIGIISFLKDTVRKPKEVSRKLDGKLLETLYHEKRYKTWKARLHRK
KNPVLLTNPGTSFRYVENMKKLARRVSSQMQDHNAKTLMVTSAVENEGKSTVAANLALAMAEESAKVLLIDADLRKPSQY
KIFGIDKEEIKQFGEVLNGNENAENLVLPIANSDLLLVADSMIYPNSTEMIARPLFQKVLDFFKERLDYIIIDTPPMSQA
ADAEEMVDLVDASILVVKQHTALVKDINEAIAILKSGEGTMLGCVYNDVFPGFAETAKAYGYKYGYGYGYGYGYGYGSYG
YGGKYGYGYGKRDQKKSERSKLKTDKSKSDF
>gnl|bykdb|A0A1S8TRD2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. BL-8] (length=459 residues).
MDSETTSIEEIFQILKKKWKLVIILPLITTAISIFYSFYIVKPQYEACTKVFVGKETADKEKYDNNDVEMYQKLLKTYSE
LAKTNTLVSKALKEHNIDLQSSAVLNTLTTIPTANTQILEIRYINLNKSLAKDTVSAITDEFIKETQELIPDSTVKVIED
VVISETLTSSKKRMYVAIGFIIGLMLSLGIIFLIEFLDYTFKDKEKLERIVQLPTFGIIPDDTKVRKIKNHIALIVEKKP
KSIVAEAYRTLITNILYSESEKTIKTILVTSSKLQEGKSTVAGNLALSFAENDKKVIIVDCDLRKPSLHEKFNISNTSGL
SDVILKRDSLDNVIQKHNKNLYVISSGKFTEKPASMLASQTMDDILTELKQKYDIILLDSPPAQAVTDAQILSSKVDCTL
IVIRSGLTNAKSVLETKNLLIKVNGLVIGTVLHRTEYNKDTYYYRSHGSSNKITRSLLG
>gnl|bykdb|A0A1V4IQ10 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium chromiireducens] (length=459 residues).
MDSETISIEEIFQILKKKWKLVIILPLITTAISILYSFYIVKPQYEASTKVFVGKETGIEEKYNNNDVEMYQKLLKTYSE
LIKTNTLVSRALNRYDLDSQSSAVLSSLTTVPMANTQILEIKYKNLNKSLAKDTVSAITNEFIKETQELIPNGIVKVIED
VVISETLTSSKKKMYVAIGFMLGLMISIGIIFLIELLDYTFKNKEKLERIVQLPTFGLIPDDTKIRKTKNHITLIVEQKP
KSIVAEAYRTLITNILYSESEKNIKTILITSSKLQEGKSTVAGNLALSFAENDNKVIIVDCDLRKPSLHQKFNIPNTSGL
SDVILKKESLDKVIQKHNENLYLMSSGKFTGKPASMLASQEMDNILTELKKNFDIILLDSPPVQAVTDAQILSTKVDCTL
VVIRSGVTNAKSVLETKSLLTKINGLVIGTVLHRTEYNKDTYYYSSHSSSSNTIKSLLG
>gnl|bykdb|A0A1V5GLC0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Firmicutes bacterium ADurb.BinA205] (length=514 residues).
MENTYSIKDLINLFLSKLWLIILLAVIGGAAGFCYTKFCMPLQYSSHMSMYVQCYTSTSGPTDYNDISKSKQLINTYIEV
LKDDAVMNAVGGKLMNEFDEAVLAETFGSYQNRISPSSIRNCMRITSVTDTSVLTVSATTRSPEVAAAICNDVAEVAPKF
LDDAIGVGQINYIDTAKVYPNPVGPNIKKNTALGAIAGAMLMALIILVIDFFDNTFKDPEALREKYKKAVVGEIQDFTIG
RKKKGEDDHFKLTDGNIPFYITESYKSLRTNITFALATSDKKIFAISSANPSEGKSTVSANTAIALAQGGNKVLLVDADM
RKSVQHKIFDLKNKKGLSTAVSKMNSVEECIIRNVEDNLDVMCAGPIPPNPSELLASENMSQMLEKLSAEYSAIVIDTPP
INVVTDAMELARNISGIILVTSYGKTTVDDMDSAMKKIEFANMNLLGFILNGIKIKKNGKYYSNYKYRSVYGYGNDPEQD
DDDSSDSDKNNKSDSKENDKKDSKNNKKGKKGGK
>gnl|bykdb|A0A1V5LU59 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Firmicutes bacterium ADurb.Bin419] (length=471 residues).
MEKGIGRMENNDFVEIDLREIFFTILRKWYLIAICFILAVGLSFVVSQYYLKPIYKANATLFLGKESDKIASLSFADIQL
NNQLVSDYRELLKSDLVAESVKEKLGVDIKKFKSNVNVQTVKDTRIFSISYEDTDPELAANVVNELSVVIKQMATDIIQV
KNVKVIDIAKVPETPISPNKKKNVALAGIIGLALGAGLIYLLEMIDYTFKKPEQVEKQLGLNLIGVVPKFEGGKRGKSKN
KDQKQLEQDYLKNLITKNDPKAPASEAFREIRTNLHYTSVDKELKTIVVTSPTLGDGKTVTAVNMAVTIAKSGKKVLIID
TDLRKPKVHLYFGIKNAEGVTNMLSSDKGNNKVKPTKIEGISNLDIIPSGPIPPNPAELLSSKRMNQLLEELKNEYDVII
IDTPPVGQVTDAAIIAGITDGVLLVFASSQTRIDIAKRAKKALESVNSNIIGAILTKLNTGRGSYYSYKYK
>gnl|bykdb|A0A1V5S3C0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Firmicutes bacterium ADurb.Bin300] (length=506 residues).
MSGSDYNASVRDEEYGVSFETILKLIRVIASKWWVILILVFIFASAGFVFSRVTYEERFSSKILFNASNKSSDIAGEAAK
YTTASDVQASVTFATSFKFILTETDYIYSLVKQAVKAQSGQEYSISQLKSCVSANVVTDTTMISVSVSTHDPDMSYQIAK
ALTSVYSQVMEGSFPNAKYTVVNDATEPNSPDADYSGFLYTFIGAVSGAIVAFAIILISNRIKNLVQTSDDIRKRYNLNI
IAVVSKLDLKRRKNSPKKGLLIIDKTVGLPFIETFKLIRTKIENASFKKGYKVFAVTSSAENEGKTTVAVNTALSLAKSG
KSVLLIDCDIRKPAVYKVLGVPVGGDKGIYDIVRGKSTFEEAIKYVEKYNMYLLISGEPVSDPSEVLASSITQETINEAK
KNFDFVIIDCAPAGVVADATIVSNYCDAVLFVVAENKTSLREIEYAVSDLSTTKAEVFGCIYNNARRGILSMAGDTRGGY
FSRSYSYSYSKSYGADYGQESNTRRK
>gnl|bykdb|A0A1W1Z4C3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridiales bacterium] (length=509 residues).
MNKQSGSIDLARLAVYILKRIWLVIICAAIGFGFMYWRASKAIDTYTASGTMFVTNSNPNLVNYGYTSTSDISSAVQLVN
IYSEVVKSETVMQKVLEYAIEPAGENGNENDLLLSQKYPGLSTDFIRNVISMNSVHETPMVRVSCTTPYPELSADICNSV
LQVAPTAIKDVVAAGEAKAQDYATIPMFANGRNDMKKGIIGALIGAVIACALLTLLFLMNHRVEKPAELTDNYTPPILSY
IRRAKGEEKDAGVFLLNDKTDMDMVESYAKLRMNLLYTMSEKMRRTVLVTSAISGEGKSTIAANLAVSLALSGKKVLLVD
GDMRRACQSEMFYYDPNSPGLSDILTSNIKVEQAILNSTWDNLDVLPAGAVPTNPCELLESPAMQELLKELEEKYDLILM
DVPPINIVSDPLALSGQCAGALFVVRQNFSDHREIRRALISAEMTGLEVLGFVFYGENIHQGRYYSKRSQRGYQYYNKYD
TRIQASSQKLSQNDNRNQETRNNRRGNKE
>gnl|bykdb|A0A1W2CEA6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridiales bacterium] (length=519 residues).
MKNKEKITGLTEEMTGISVRNTAPAAEGPAQEYYSGIDWVSVLFRLLEKIHWIVLAALIGALIAWFYVTRLVTPVYQATS
KIYIAGSDTTISLSDLQLGSTLATDYQEVFKIWHVHEMVDERLDLDYSYSQLEKMVSVSNPSGSHLLYIYVKSSVPEEAK
LLADTYAEVVQDYIANKMELRKPQILEKARTPIKPIYPNVNATIAKGAVLGGLGIMLIFLFIILLDDRIRSGEDITKAVD
LPVFGAVTRQNMERNAAELGADMPRNPAFADGKHQAVFRGNLKLDYAGEEAINAVCSSMSFTGKNLKRVLVSSCGANEGK
TFATIQIAIGMTRRGARVLLIDADLRLSVMKEKYDIHFGGQPTGLAHLLSGQCALEDAIYHTNIPGLDLLPDGASIKTPL
ALLTSAEFDSLMATVGRDYDFVIVDTPPLGVVVDAAEISRRCDGSLLVLEYNRTHGKALKEAVRLLRRTGTPVLGCILNK
TAVSRIGKSGYSYYYGGKNGYGKQETKAGRHPVRIKKGN
>gnl|bykdb|A0A1Y0IQP5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Tumebacillus avium] (length=453 residues).
MEMGLAEMGRVIRQRVLLIVLVTLLAVGLTGAGSFLVLEPEYEATTTLLVQSKQAGNVIAYNDLLTDQKLVTTYGEIFQS
RMIAEAVIDRLSLNSTEQELLEKIRVTTSGESLLTSVTVTDHDPKQAVAIANAMAAVFMENLSRIMQVDNISILDTAKLT
SDVQQPVRPKPFLNMAAALVLGAMAGAGLAFLLEFLNNTVKTEGEIEQLLQLPALGAITAYDNKGRAGHRLAVRQDPRSA
EAEAFRTLRTNIQYDEAGQHVKVLMVTSTAAGEGKTTVIANLAVTMAQAGKKVLLIDGDLRKPTLHHVFHLGGQKGLTEV
LCEETPLEDVIVPSAAGPDVITAGAIPSNPSELLGSPKLRAALADVRTRYDLVLIDSPPLLPVTDGQVLSTLCDGVLLVV
RSGAVTRDHLQQAKALLDRVGAQVIGAVLNGKKRKGKEQTYSYYASPAGDRDD
>gnl|bykdb|A0A1Y3T163 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia sp. An81] (length=536 residues).
MLFTETGFPRVPDMDMIMETMGKTSGEETKEDKSMEDQRKEIENREDDEMEIDLVLLFGAFWKSFTRLWWLVLILILAGA
GGFYAFQNLSYEPLYASSATFTVATGDGENGTYNFYYNRNTADQMSRTFPYILDSSFFRSALLERLGTDTLNGTITSETV
ENSNMVTMRVESPDPEDAREILDTALEIYPETARFVLGDIQFNYLNEPETPTEPFNHIGLRRTLALGGGAGALAGILILG
LTALFRRTARNPEEMQKITSLRCLAMIPQVRFKARKKQKKKKISVLDKRLSFGYRESLRALEIRLENMMAKEGGKVLLIS
STASGEGKSTLAVNLSELLASRGKRVLLIDGDLRKQDDAGIIGIRDGAGLADIVKGEKTIREGLRKLKKSGIWFLGSRRI
VKQPASVLSSPRTGELIQALKKEMDYIIIDTPPCEMFQDAGMLSDYADGILYVVKYDFIPQRRIWEGLSFLGGRSARILG
YVFNSYPESVSEYGYGRYGYGRYGRYGYGKYGYGGGSYRQPYGQKNAYEEEEAENG
>gnl|bykdb|A0A1Y3T1N0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia sp. An81] (length=468 residues).
MNRELFRLDEISIRGLCLELLQSLWMILVIGVSLWLGITGVHTLIYEPAYTSTATLVVTVKGESSAYSSLSVTSQMADVF
GEVFQSSALRSRIIEDVGEEITGDITCTPITDTNLLTLSVSSPDPRQAYLFINSALENYEQVAQDVFSNASLQILQEPQV
PSSPSNTSWIMARRNLLTAAGMLAMAAVICLFYLLRFTVKSPSSASRLLDGTVRGIIPFESKGILGRKNTKKALLLNSPL
VSMDFAEASRRAEAKVEYHMRRNDQKILLVTSISENEGKSTVAANIALALAEKHQKVLLVDGDLRQPAQYKVFEEKSAGR
TSVEQVFTGKASWKENLYYNKAAGIWELFQFSGAKDPAAVFAEAPMKTLAREWKQEMDYIIIDCPPTAVSTDAEVWMEAA
DTVLLVVREDWSDVRIVNDTVDMIWQSGCDFSGFILNAFHRDWISQSSGYGYDYGNYGKNIRRGDQRG
>gnl|bykdb|A0A1Y3TC51 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lachnoclostridium sp. An76] (length=484 residues).
MNGERFSLAEISVRGLCMDLFRNAWMILLAAAAVWLAATGWHNLTYQPEYTSSATLVVTVKGSSSTYSSLSLTTQMADVF
GQVFQSDALAEKIAEETGEEIAGKISCTPIQETNLLVLSVTCRHPRDAYLFINAALEHYGEVAGDVFSNASLRTVQEPEV
PSAPSNTSAAMRYRYPLMAAGAAGMAALICLLYVMRFTVKNPLCAQRQLDGKVRGVIPFEQKGTALRQKKNPKEALLLDS
PVVSMGFAEAGRRTAARVEYHMRRHRQKMLLVSSIAENEGKSTVAANLALALAEKHKKVLLVDGDLRRPAQHKVFEEKGK
ERFSFSQVLKGEADWKDAAFYNKRSDIWELFQFRAVREPARILREEKLEGLAEEWKREMDYIIIDCSPVAVSADAEVWVS
VADSVLLVVREDWADVRVINDAVDMISQNGTDFTGFVLNAFHREWSRPAGRQEYSYGRAYRSQDMPGEGLTGRSGEHTAR
GERG
>gnl|bykdb|A0A1Y3TC98 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lachnoclostridium sp. An76] (length=507 residues).
MQDQRNRIDEREDEMEIDLGLLFAGMWKNIRRFWWLALLLTVAGAAGVTVYQRVFHQPMYECSATFTVATGNSENGSYSF
YYNSSTADQMSLTFPYILESNFFQSALMEELGTDTLNGEISSETITDSNVVTMRVESPDPEDARAILEAALAIYPETARF
VLGDIQFNMLDGPETPAAPFNQMSVRRCLLLGGAGGAAVSLLIFLLMSLFWKAVCSPEDMKKITSLRCLAFIPHVRFKAR
KKLDDTRLSLLNEKLPFGYRESIRSLQKRVVKNLEHMDGKILMVTSSTAGEGKTTVAVNLAQMLAADGSRVLLIDGDLRK
HGSAGLLGVSGKYSLKDVAGMDTKKVKAGELLERIPGSTMWLLGNNEVVKQPAPVLSSRMVKLFIREMRRKMDYVIIDSP
PCTMFQDAGILADHADAVLYVVKYDELPLQKIQEGLSFLGSQRTPFTGYVFNNFPEGPGEYGYSRYGYGRYGYGKYGYGR
YGYGKYGYGRYGYGSDGDETETEEQED
>gnl|bykdb|A0A1Y3TUL5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Faecalibacterium sp. An77] (length=483 residues).
MNDEYITIRLSDFLHALIKNRGLIAATTIAGLAIGVVLSIASYMRGEMAKGYSITSSIAVTTQDAGGNFTTNTSNPDSSD
IQLAEDMVDAVIYVLKSDRTLKAAIQNIKLVGIVETDIYKNLYLTRYKETQIIEMDLTWRSAEEGVEILNAINEVAPEIL
IETLKIGSVSVINEPKATYRIGGNVNASMWLYMSLLGLAVGIGFSFLKFLLLPTVVNTKDIENTLGLEVLGEIPENVEYF
RRKKSLLVEDDDPIGAEVRESFVSAAHILHNRLGVGEHQCIYITSAEQDEGKTHVAANLAVQLSDLEHKVLLIDLDVRNP
SLGGLFLDKVDYAHSLNALYRGDASPEDVITHLTGYLDLLPSILEPKEIPLSDALLTLIKDLSQNYDYVLMDSAPVGRVA
ETLSLNRIAKSALFVIRFDYSNMNTIRDSLERLDKSGINPLGCIVNRVKTLGDKLNNNYNYESEGSASRRGRGSSSGKSS
SRH
>gnl|bykdb|A0A1Y3WEF6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Drancourtella sp. An57] (length=513 residues).
MAEQDRYGGNSQNLSRKIEEDDAIDLRTLFWNVIQGILKFWWLILLLAAVGAGAFYLRATRLFYTPMYQSSATFTVLTGG
TMDTENSTYNFYYDTNTVGQLAKTFPYILSSSLLTEAIEEDLGVDAVNGRISAQAVSDSNMITMTVTSNSPEDARAILES
TIKVYPDVVRFVIGDTRFSMIDEPTTPTEPYNRPSYLDQILKGALFGAGSGFLLICLCALFKKTVQKPEELNSVMSLSCI
ANIPEVSKKLRKKQDTRWIQMQDSRTPQAFRENIQSLQIRISRELEEKGGKVLVLTSTLPGEGKSTLAYNLAIAAASHGV
KVLFVDADLRKKADRKHLTEEKGRGLASVVTGKCSLQEAVYREEETGVDFLGGSKPVKGVQQILNHSSFHEVIKEMKAQW
DLILLDAPPTEMFEDASILAEQADGILYVIRYDQVQKRRILDSISGLEDSSAPLLGYVFNGVPVHRGGYGYYGYGRYGYG
YYGYGSYGYGERKNRERISAEEDRGRNRRAKDD
>gnl|bykdb|A0A1Y3Y8U8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia sp. An46] (length=468 residues).
MNRELFRLDEISIRGLCLELLQSLWMILVIGVSLWLGITGVHTLIYEPVYTSTATLVVTVKGQTSAYSSLSVTSQMADVF
GEVFQSSALRSRIIEDVGEEIAGDITCTPITDTNLLTLSVSSPDPRQAYLFINSALENYEQVAQDVFSNASLQILQEPQV
PSSPSNTSWIMARRNLLAAAGMLAMAAVICLFYLLRFTVKSPSSASRLLDGTVRGIIPFESKGILGRKNAKKALLLNSPL
VSMDFAEASRRAEAKVEYHMRRNDQKILLVTSISENEGKSTVAANIALALAEKHQKVLLVDGDLRQPAQYKVFEEKSAGR
TSVEQVFRGKASWKENLYYNKAAGIWELFQFSGAKDPAAVFAEAPMKTLAREWKQEMDYIIIDCPPTAVSTDAEVWMEAA
DTVLLVVREDWSDVRIVNDTVDMIWQSGCDFSGFILNAFHRDWISQSSGYGYDYGDYGKNIRRGDQRG
>gnl|bykdb|A0A1Y3YCA2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia sp. An46] (length=535 residues).
MLFTETGFPRVPDMDMIMETMGKTSGEETKEDKSMEDQRKEIENREDDEMEIDLVLLFGAFWKSFTRLWWLVLILILAGA
GGFYAFQNLSYEPLYASSATFTVATGDGENGTYNFYYNSNTADQMSRTFPYILDSSFFRSALLERLGTDTLNGTITSETV
ENSNMVTMRVESPDPEDARKILDTALEIYPETARFVLGDIQFNYLNEPETPTEPFNHIGLRRTLALGGGAGALAGILILG
LTALFRRTARNPEEMQKITSLRCLAMIPQVRFKARKKQKKKKISVLDKRLSFGYRESLRALEIRLENMMAKEGGKVLLIS
STASGEGKSTLAVNLSELLASRGKRVLLIDGDLRKQDDAGIIGIRDSAGLADIVKGEKTIREGLRKLKKSGIWFLGSRRT
VKQPASVLSSPRTGELIQALKKEMDYIIIDTPPCETFQDAGMLSDYADGILYVVKYDFIPQRRIWEGLSFLGGRSARILG
YVFNSYPESVSEYGYGRYGYGRYGRYGYGKYGYGGGSYRQPYGQKNAYEEEAGNG
>gnl|bykdb|A0A1Y4H8L0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerofilum sp. An201] (length=488 residues).
MNKDENFNEILQTSRLEPFTLVRDILVNWWVILLGALAAAMLAATVLSLRWQPAYTTSATFAVSSRVGASSYADLNSASE
MAGTFQKILQSSALNKILCEELEVDSIDAAITSNVIPNTNLLELSVSSSSPREAFDTIHAVMDNYAQVSYFSLGNAVLEP
LDEPEIPLYPSNPLNTSRAMKLAFLAAAAALAALFGLLSFFRDTVKQEDDVEAKLDTRSLGALVYEPKAKNLRELFQKQK
KALLVSQPLAGFGFVESYRKFVSKLEYQMEKHHSKVLVVSSVSENEGKSTVAANIAISLVQRGKKVLLIDGDLRRPSQFL
ILGIETQDKNELGEYLKSGRFSDEIITKTDIGGLYFMGGRNCYSMSTDMLQSGNIEKLLKTCRRLVDYVVIDTPPAGPLG
DAELFARYADEVLLVVRQNYMLAEDINDVLDHFREVGCHVVGVVLNRVQSFENLTAQTVGRYAGRYGYGYGYGYGAYAQY
ANDRGEQQ
>gnl|bykdb|A0A1Y4JAX2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Faecalibacterium sp. An192] (length=483 residues).
MNDEYITIRLSDFLHALIKNRGLIAATTIAGLAIGVVLSIASYMRGEMAKGYSITSSIAVTTQDAGGNFTTNTSNPDSSD
IQLAEDMVDAVIYVLKSDRTLKAAIQNIKLVGIAETDIYKNLYLTRYKETQIIEMDLTWRSAEEGVEILNAINEVAPEIL
IETLKIGSVSVINEPKATYRIGGNVNASMWLYMSLLGLAVGIGFSFLKFLLLPTVVNTKDIENTLGLEVLGEIPENVEYF
RRKKSLLVEDDDPMGAEVRESFVSAAHILHNRLGVGEHQCIYITSAEQDEGKTHVAANLAVQLSDLEHKVLLIDLDVRNP
SLGGLFLDKVDYAHSLNALYRGDASPEDVITHLTGYLDLLPSILEPKEIPLSDALLTLIKDLSQNYDYVLMDSAPVGRVA
ETLSLNRIAKSALFVIRFDYSNMNTIRDSLERLDKSGINPLGCIVNRVKTLGDKLNNNYNYESEGSASRRGRGSSSGKSS
SRH
>gnl|bykdb|A0A1Y4L6N9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lachnoclostridium sp. An181] (length=491 residues).
MSELNHAETEEMEIDIVSLIQNFISGIFRWWWLIVLLALIGGSIFYLRASRFYTPMYRAEAVFTVMTSTQSNSENSGSYN
FYYDSTTAGQLAKTFPYILSSNLLNEAIKEDLGISSINGSITASVVPDSNLITMSVVSMNASEAKTILESAIRVYPNISR
FVIGNTKFNMIDVPTEPTEPFNKPNYVRTTVKGAFLGVLAGLLLVVLYAFLKRTVQKPEELKKVSNLKCLAKIPNVRQKA
RKKRIESRITVFDSRVGAGFRENIKGLQMRVKREMERIDGKVLLVTSTVAEEGKTTVAVNLAFSLAEYGYKVLLLDGDMR
KQTDWKYIEGVKGKGLYEVLRKECTVKDAIFHDEESGVYFLGGKEPIKEVTQTLNSSNLLDVMESLRKEMDYVIIDAPPS
EMFEDAAVLSEYADGILYVVRYDFVQRRRVLDGLAELDGVHTRLLGYVFNGIKVGHSGYGYGYGYGYGYNYGYGYRRDGE
YGDEKYANREK
>gnl|bykdb|A0A1Y4MW77 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Erysipelatoclostridium sp. An173] (length=486 residues).
MEEKNIEQDEITIDLTVLFRDFIRGCIKFWWLILALMVAGGAIMFVTNIQTYTPMYQASATFTVTTNTTTDQNNQSDYNY
YYDSSTAEQLSLTFPYILSSQILNDAIEADLGVEAINGSISASIIPNSNMITMTVISSDPDDAKEILESTIRVYPSVARF
VIGMTKFNMIENPSVSNVPYNQLNYFNTVAKGALIGLAVGLVIIAIYAFFRKTVHKTQELEEVTNIKCLATVPYLKQKKR
SRGKTIMPSILNLQTNPLFLENIESLHIRLAKELADINGKTLIFTSTVAKEGKSTIATNVAYALAKNNKKVLLIDADLRK
QDLSKQMNLTTNGVGLSSIKYGSDVVEDAIVYLEKQNLYFLGGNSTIDDLTAVLTNPNMEQFMNDMRQKMDYIIFDAPPC
EAFEDVFLLEKYGDAFVYVIKQDFVQRPRIVDCIGTLADSELPLLGYVFNGDSFTFRDYSRYGYRYYNKYGYRHYSYYNN
EKKAAK
>gnl|bykdb|A0A1Y4N105 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Erysipelatoclostridium sp. An173] (length=465 residues).
MMEFRINDIDLRSIIVDMVRNCWMIILVMLATYFAIAGVYRLTYSPHYTTTATMAVTARGSQSGTYSSLTTAMNMAEVFS
EVFQSDTLKEKIEADLEVDNLDYQISASVISETNLMTLTVTSNTPKMTYQIMQSALDNYTSVSDYLFSNASLQMVQDASV
PMSASNPLNYSRIQKLGTLASGVVMIGIIALLSIFRQTVKRSKQAKYQLDGRIITTIPYERKYHSLQELKKKPKKSVLIN
SPLLSMPYSEANRKLGALIERHMRRRNQQVLLVTSVAENEGKSSTAGNIALSMVDRGKKVVIIDCDFRKPALYKVFELKE
LKNGLSDYLDGNCKYEDIITYQNNLAIISQKDSKKNSSNYFLTAQFTQFIKKCRSNFDYIIIDTPPMGACVDVEAIINHS
DSSVMVVREDWSEIGAINDLCDVLKQNDQDFIGFILNAFHRSIFSNDSYSHYGDYQRRTTSNLHK
>gnl|bykdb|A0A1Y4QK93 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Clostridium] spiroforme] (length=465 residues).
MNQDEINLDSINYRGIIRDLLKNWWVIVLIVISLWLAATGIGKLVYVPEYTVSTTLVVSAKGTSDTYTSLAMASEMADII
KEVFQSDVLLELVENEIGKTNQGTITCNQIQETNLLVLNVTSKDPQNAYQFMNSALKHYNEVSDYVFTNATLQVLQEPSI
PTTPSNSSRLINYRNYIALLGGIAVTGIIACLYLFRHTLKSSKNAGKLLDGRVVGIIPYEKKKRNKHLKKSKQSLLITSP
IASMNFVEANGRMSSRIEHHFDKHNFKVLLVTGIGENDGKSTVAANICLLFVEKNKKVLLIDGDFRKPAQYKIFDKEVLD
TNPLQDVITEKKSLKDSIYFNKKSNIYELFLYHAIDDPSKLMNVVTLKKIMDQLKKHFDYIVIDCSPVAVSVDAEVWMEV
VDSTILLVRQDWTDIRMVNDTVDLIWQSGCDFTGFALNMFIDDEIRHNDYGYSYYDYKNHRHESR
>gnl|bykdb|A0A1Y4QKE6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Clostridium] spiroforme] (length=503 residues).
MMKFVIMIMVIVIMIIKTIGMKVGDIMDEQRLKESMLEDDNIEIDLSELIHGFLKILKDYWGLFLGTIVICTIAFSTFRY
LTYTPIYRCEATFTVATDSENTGSYSYYYSQNTADQLSKTFPYILDSSYFRSILLEELGVNSLNGTLSASTVSESNIVTM
SVESNSPQDAMSILTSAIEVYPDAARFVLGQIQFHMINNPQLPTSPYNKLTFTNTVIVGGIIGLVFGTVILGCMALFRKT
VKNPEDMKRITNLNCMATIPRVKIKARKIHKQTRISINDRRIPFAFKENMRSLQMRLERVFKKEEHKVIVVTSTAANEGK
TTLTINLAETFATNGKRVLLIDADLRRQSIASILHCKDNQGLIDVYLQKGDVLKNIRKLDDSKLWFIGNDNPVDNPVSVL
SHPDLKEFIEKMKKEFDYVIIDTPPCGIFQDVTLIQKYADALLYVVKYDFLPYQKIQNGLSILKEDCCFMGYVFNIYTKK
SSEYGHHSYGYNRYGYVKDEYKE
>gnl|bykdb|A0A1Y4QP75 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Erysipelatoclostridium sp. An15] (length=465 residues).
MMEFRINDIDLRSIIVDVIRNCWMIILVMLATYFAIAGVYRLTYSPQYTTTATMAVTARGSQSGTYSSLTTAMNMAEVFS
EVFQSDTLKEKIKADLEVDNLDYQISASVISETNLMTLTVTSNTPKMTYQIMQSALDNYTSVSDYLFSNASLQMVQDASV
PMSASNPLNYSRIQKLGTLASGVVMIGIIALLSIFRQTVKRSKQAKYQLDGRIITTIPYERKYHSLQELKKKPKKSVLIN
SPLLSMPYSEANRKLGALIERHMRRRNQQVLLVTSVAENEGKSSIAGNIALSMVDRGKKVVIIDCDFRKPALYKVFELKE
LKNCLSDYLDGNCKYEDIITYQNNLAIISQKDSKKNSSNYFLTTQFAQFIKKCRSNFDYIIIDTPPMGACVDVEAIINHS
DSSVMVVREDWSEIGAINDLCDVLKQNDQDFIGFILNAFHRSIFSNDSYSHYGDYQRRTTSNLHK
>gnl|bykdb|A0A1Y4T590 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Faecalibacterium sp. An122] (length=484 residues).
MNDEYITIRLSDFLHALIKNRGLIAATTIAGLAIGVVLSIASYMRGEMAKGYSITSSIAVTTQDAGGNFTTNTSNPDSSD
IQLAEDMVDAVIYVLKSDRTLKAAIQNIELVGIAETDIYKNLLLTRYKETQIIEMDLTWRSAEEGVEILNAINEVAPEIL
IETLKIGSVSVINEPKATYRIGGNVNASMWLYMSLLGLAVGIGFSFLKFLLLPTVVNTKDIENTLGLEVLGEIPENVEYF
RRKKSLLVEDDDPMGAEVRESFVSAAHILHNRLGVGEHQCIYITSAEQDEGKTHVAANLAVQLSDLEHKVLLIDLDVRNP
SLGGLFLDKVDYAHSLNALYRGDASPEDVITHLTGYLDLLPSILEPKEIPLSDALLTLIKDLSQNYDYVLMDSAPVGRVA
ETLSLNRIAKSALFVIRFDYSNMNTIRDSLERLDKSGINPLGCIVNRVKTLGDKLNNNNYNYESEGSASRRGRGSSSGKS
SSRH
>gnl|bykdb|A0A239QN83 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridiales bacterium] (length=498 residues).
MNKQGGSIDLARLAVYILKRIWLVILCAAIGFGVMYYRASKAPDTYTASGTMFVTNSNPNLVNYGYTSTSDISSAVQLVN
IYSEVVKSETVMQRVLEYAIEPAGENGNEEDILLSQKYPGLTTDDIRKVISMNSIHETPMVQVSCTTTDPKLSADICNSV
LQVAPTAIKDVVTAGEAKAQDYAVVPLLANGRADMKKGFIGGLAGAILACAFLTLLFMMNHQVEKPGEITDHYTPPILSY
IRRAKGSEKDAGAYLLNEKSDMDLVEGYAKLRMNLLYTLSEKMHRTVLVTSAISGEGKSTIAANLAVSLAMSGKKILLVD
ADMRRACQSEIFYYDPNASGLADILTGSTTAKKAIVSTVWENLDILPAGSMPSNPCELLESPTMAKLIQELEEQYDLVLM
DVPPINIVSDPLALSSQAAGTLFVVRQEFSDHREIRRALVSCEMTGLEVLGFVFYGEKLHQGKYYSKRSQRGYEYYNKYD
TRSRVIGDPDNPKKKQKQ
>gnl|bykdb|A0A252F281 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Butyricicoccus porcorum] (length=479 residues).
MEEKRWSLASINLHTMLRDVWKNLWMIVLVAASAVMLTRVASETIYKPEYTSSVTMSVTSKSGSNAVADLNTTRQMASAF
QGVLESDLLHETVAAAMGETSLPAQLESSIIEGTNLLTISATADNARTAFLTVKAVMENYNTVSDQVLSGAVFTVVREPQ
IARAPSNAMSLRSRLILAGALGALAMLAVVILMSCLRDTVKREEEVKEKLDTHLIASVPHEKRPDGKNKKEKHSFLITHT
VISFAFEESIRQIRTRLEYAAKQDGAKVFLISSFGENEGKSTISANSALSLAEKGYHVLLIDADFRKPAQYKVLNRDVDE
ANCLGEYLRGTCSVDKIIQTNAEVNLYEMFGKNYYSDSVELLGSARMKKLLEVSRQKMDFIIIDSPPMSALSDTEVLAEL
VDATVLVVREDTSAVPDLNESIMILNESKSRLLGCVYNDKHTSPLSRLPIYGKYADYYGYRGYYGNYGKYGKSSRKREG
>gnl|bykdb|A0A271M6M4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillaceae bacterium SAOS 7] (length=455 residues).
MNEAVGLREIFNIIKKEYLIIIIITTFMVFLGAAISYFMPPVYQAKTDLLVNFKAEGVESKDISTVEIETNLRLIETYKY
ILNSTRIMEKVAEKTGSKEKPEQLAKKIEVISNSDSQVITLKVEASSQKQAVKLANSTAEIFKTEIKSLMKIDNVDILTG
AKIVNKGRPVKPDPVIYMVIFLCIGVFLSFIIIFLKETIFTKFDSQEKIEQAFKLPSLGVIPVISDKPKRSNGLFDREDR
FNKMLPQLNPYSAVTEAYRAVRTNVQYTISQEDAQTILITSSHPGEGKSLTAANLAICLAMDHMETIFVDLDLRKGVGRQ
LFHIPLRKGVTTYLEGMATIEEIIVKTNVSNLSFIGTGPLSANPAELLSSEKIDIMLETLQESYDLVIIDTPPLVVSDAV
VLSTKVDGCIFIVNAQKTKVDQTVKSIQKLKKVEANILGVVLNSGKESKRTSYYY
>gnl|bykdb|A0A2K9E6R0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Hungateiclostridium saccincola] (length=468 residues).
MERNNFEEIDVREIFFLLLRKWYVVAACFIFVTVSTFLITSYYLTPIYRSEATLFLGKESGNVGGLSIGDIQLNNQLIAD
YRELLKSRTVAERVGEKLNVSPSKLLSNVDVRTVKDSRIFKISYEDSNPTLARDVVNELSNEIQELAADIIEVKNVMVVD
EANMPNSPVKPNKKMNVAVAGLLGIVLGVGLILVLEFVDHTFKKPDEVERYLSLNVVGTIPKFKGGKRGKSKAKNRRELE
KEYLKNLITKNDPKAAATEAFRELRTNLHYINIDKEVKTMVVTSPSMGDGKSVTAANLAVILAKSGKRVLIVDADLRKPK
VHHYFGVKNNIGLTSILTDTKEDIKAKAIEKTEISNLDIITSGPVPPNPYEMLSSNKMQSFVEKVKGEYDIVIFDTPPVG
QVTDAAILAGLADGTILVLACAGTRIDMAKRACKALEGVNANMIGAVLTKIDFRKTSYYGYSYSYQYD
>gnl|bykdb|A0A2S4GG02 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia producta] (length=462 residues).
MFKIILTNFNLEKIFWIMKSRIKYMILAALLLAAGGGILAAWKQNTTYMAKISFYVYSSPDYVTDTGVNISSNEMTQAKG
LLDSYMQIIGSNRFLKAVMEETGLKEYSIGRLRGEIGATAVENTAVFHVSVYDSSPENAMNIANTIGKLAPDEIISVVKS
GGIEVLDEAELPTVPYASTSVVKYALLGGAAGFFLAAVCFLIKGMLNTTIRRLYEIENLFTIPILGTVPQILSEKEGEKA
DVYLNEKSSFHLKEAYSNIRANLLFTRRGEKCPVYAVTSADVNEGKTLNAFNVAKSYSNLGKKVLLIDADMRKSVMGQIL
KVNTETGLSQYLAGIVERLEIVSVDANMDLILAGSIPPNPAELLAGDQWYQLLQECKKKYDVIFIDTPPIGIVSDALSMA
KAATAFILIVREMMTKFDREEKVVRKLEALDANIGGFIYNGISAKSPDYEYRHYNNEYEKKK
>gnl|bykdb|A0A2S8RBI0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Hungateiclostridium saccincola] (length=468 residues).
MERNNFEEIDVREIFFLLLRKWYVVAACFIFVTVSTFLITSYYLTPIYRSEATLFLGKESGNVGGLSIGDIQLNNQLIAD
YRELLKSRTVAERVGEKLNVSPSKLLSNVDVRTVKDSRIFKISYEDSNPTLARDVVNELSNEIQELAADIIEVKNVMVVD
EANMPNSPVKPNKKMNVAVAGLLGIVLGVGLILVLEFVDHTFKKPDEVERYLSLNVVGTIPKFKGGKRGKSKAKNRRELE
KEYLKNLITKNDPKAAATEAFRELRTNLHYINIDKEVKTMVVTSPSMGDGKSVTAANLAVTLAKSGKRVLIVDADLRKPK
VHHYFGVKNNIGLTSILTDTKEDIKAKAIEKTEISNLDIITSGPVPPNPYEMLSSNKMQSFVEKVKGEYDIVIFDTPPVG
QVTDAAILAGLADGTILVLACAGTRIDMAKRACKALEGVNANMIGAVLTKIDFRKTSYYGYSYSYQYD
>gnl|bykdb|A0A2T5IYJ6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Agitococcus lubricus] (length=662 residues).
MEILDKNLSPQQEDSIDLRHYWNVVARFKWGIIGLAIAITVATAFVVSTVRPVYRATATLMIEQKQGKTLTSLDDVYGTD
GGKEYYLQTQFEILKSRELATRVVTELNIANHPDYLPRSEAEKSWWQQIDWRQLLPRGHQSNPIPSDEEKLTLLVDRFMA
NLSIEPIRQTQLVKISFESHDRSLTAAVANAMAKTYINSQMEARITLTQQAAEWLSSRLGVLKSNVEVSEKKLQAYREEN
NLVDSGNNFGVLGLSAGQLQQTNQRLIEAQFKVAEISKRYGSKHPTLIQAELELNEAKKALEIAKADSLELSKKEFKFKE
LQREVETNRNLYDTFFARIKQANDSLELDTANARVIDKAVVPNAPTKPRKTLIIGISLVLSLLFGAALAFLLDYLDSTFK
NAEDVEDKLGISMLGMVPLIKKRKKDTSAIYFLDSKQNGYAEAMRTVRTSVVLSGIDKPHKVVMLTSSVPSEGKSTSAIN
LAVALAQMERVLLIDGDMRKPTIAKVLGLPPNSPGLSNVVAGTSVLDDCILHVEDANIDVLTAGLVPPNPLELLSSQKFM
DLIAKLSETYDRIVIDSPPTLLVSDSLVMSKAVDAVLYVIRSDTTAQNAARTGVNRLRAAKAPLIGVILNKVNMKRAAQY
YGTYSSYYAYGDYVYGSSKKKD
>gnl|bykdb|A0A2T6KJ75 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Paenisporosarcina sp. OV554] (length=436 residues).
MNRTMEIRDFIRLFKKKKKVILLVTFYITLIGGFSSFAIPPKFEAKTDVLVNFTTANVVSSGEIDANLRLIETYKYLMKS
NRILTKVNGSLDETYKKGEISQKVEIQSSINSQILTILAEEKTPEKAAALANTLATTFQEEIKTLMNLENVHILSQATVN
EDTKSVKPITALFFIISAIIGFLASYSFILIQEMFFTLVDSSEKAEKALALPVIGLVPPGEGKLIHDLPTFDVFTEMFRS
IRANLLYVLSKNNAKTLLVTSAESGDGKSFVSANLSIVFAMDQKKTVFIDADLRRGTGRNLFHLPKRIGITSYLAGQCTL
HEIIQSTEVPNLSFISAGPVPPNPTELLSSTKFVQLLEELKNQFDIIIVDTPPLLVADTLHISANVDGCLYVVNAESSKV
EQAIYSIELLKQVQAPLIGTIINKSKGSVRSYSYYN
>gnl|bykdb|A0A2V3W8U6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Pseudogracilibacillus auburnensis] (length=458 residues).
MDQTFQIRDFLQIFKKRIKFIITVPLLFALLAVIVNSFIIKPVYEARSDLLVNNTVPMTEETLTALDIETNLRLIETYHF
IIQSDRIIDLVVEELDEPFTNNELQKKLRVETNDNSQIISLYVKENDLDTAVEIANLFATKSKEEISQLMNLENVNILTE
AKVEKHKTPISPKLFFNTVISFIIGFLFACTYAFLSAYFNTKISSKEDIEKYLGLSFLGEVGIISKNRKNRLNSNKKEDL
HSILTSRKGPMSTPVLEAYRSIRTNLQFQLMDKSLKTILVTSTSKNEGKTITCSNLAMMMAIDNKKTVVIDADLRKEKMG
MSNGQIGLTHYLAGNRSVQDILLDTFTPNLQSITCGPIPPNPAELLSSERMDQLLQELKEHFDRIIIDSPPLFFSDAAIL
ATKVDGCLLVVQSDTTKVTHIQQGLGQLTNVNATILGAIINKKKERKNDINYYHYGTR
>gnl|bykdb|A0A2X2LGT4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Staphylococcus aureus] (length=450 residues).
MGESRVSLRVIASSLRKFWWMVVLFGVVGAAGSYVYASLQTPLFQATTSLYFALNQGTSASDLNQGSVYTQSQMLSFAQL
ATSSRVLDPVIEELGLDTTPRALARDIEVTIPQSTVTLRITGITDDAKAAAELADAVAEQLIIVVKDVAPKDPQGESTIT
AQVIDDAVVPVFQFTPSKPRDALLGGFLGAVLGLAIAALIGVLDTRMRTEETLTEAGGDPVLGVVSKSPLLAMRGIAVAQ
EPLGHTSEEFRRIRSALAYANVSSRVKVLLVTSGMPSEGKSTVSVNLAMTLAGLRNSVLLIDADMRRPRAHEHAGIDGSI
GLTSVLLDEVEFEVAKHSVADSTLDILPAGTVPPNPAELLTSARMAQLLDFAAAEYDYVVIDSPPILSVADANLFATQTD
GVILVVDATKTRRAALAKSIKSLESGGARILGTVLNRARPDRHRSEYYSD
>gnl|bykdb|A0A315Y4F9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus flavefaciens] (length=495 residues).
MNQSYSIKDIIRLLLSHIWLIIVITVLGAGAAFGISKFLLPLQYSSHITMYVQSYTGITENANSANNISNSKQLVNTYME
VLKDDAVMNAVAEKLSKQFEENVLSQNFTINDSGKITPASIRSCLAISSVTDTSAVKVNATAKNAEVAAAICNDLTQVAP
QYVEEAVGVGSINTIDTAKVYNTPVAPNIMKNTMIGAVAGFMLIVLIIFLIDFFDNTIKDTDALGKKYNKAIIGDIQAFG
DSKKKRDADDVHLKLTDKDAPFYIIESYKSIRTNLSFALSTVEKKTFVVSSANPGEGKSTTSANIAIAIAQSGSHVLLID
ADMRKSVQHKIFELVNKKGLSTAVSKMHTPDECIQKNVMENLDVMTAGPIPPNPSELLASEMMEQMLNELSEKYDAILID
TPPVNVVTDAMELAKSVSGIVLVVRYGRTTDEDVDNVFKRVELANMNLLGFILNGVKSKHAGYYSKYGKGKYYGYYGAKP
ELDTVEAKAETQGKD
>gnl|bykdb|A0A328M4V1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. SRB_336] (length=735 residues).
MTTRQTFSPRDDDVDLRALIGTLLDNKWLIGITTAVFFALAVIYSVLATPIYQSSAIVQVENTVPSLPGLEDLAQTLGTS
TSQAVTEIALLTSRTVVGGAIDNLKLEIESEPERFPVIGNFMARRYTPPVPGAVAPPFAGLSSYDWGGSSLDIYQLDVPR
SLLDQQLYLDAGQNGTYTLSDDDDGVLLTGRVGDKVTAKGITIQVKSMLANPGTRFDVTRHGRLALITSLQQALVATEQG
KDSGIIELDYRNADPVLATQLVDQISALYVRQNVDRNSAEAANSLAFVKQQLPKVRLELEQATQAMNAFQTRAHSVDISM
QTKALLDQIVAIDASLQQLRMQMSDMQRHFTPAHPSYKALQSQIGQMEGQKAALQKQVGQLPDIQQQMLRLARDVQVSNT
TYTSLLNQAQQLNIARAGTVGNVRVIDRAATDTAKPVWPRKLLLVFGATVFGGLLAVGFVFLRQLLNRGVEDPAAIERLG
LPVYVSIPRSELQRERTLLRVRHRRTVGRQNLLAAGAPTDLAVEALRSLRTSLHFARLEAKNNLLLISSSSPGVGKSFVA
SNLAAVIAQAGQRVLLIDADMRKGTLHKIVGGNPERGLSELISGQAELPEVLRNVDGISKLFFISRGKIPPNPSELLMHA
RFTSLLEGLKSRFDLIIIDTPPILAVTDAAVIGHHVGTSLLVVQFGLNQPREIALAKQRFEQNGVPIKGAIFNLVEKRSA
GYYAYAYYTYAAAKS
>gnl|bykdb|A0A348P5V4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcaceae bacterium] (length=482 residues).
MNYNSEPKKDYEEGLSLDTALMYAKKLMDKWFVILLSAILCAGVGFGVAVARYTEHYSSQIMFIASNRSSAITVAGQSSS
DINASVSLAESFKYVFTTTELATKVANSCGYANPDGSPITASQIKRYVSVQSIEETQIIYLTVTTTNPDVSYGIAQAYVD
NYNEAIATAFPNTALTVIDPPLKAEAPNGDNTKLLYPMLGFVLGFFAACLCIIVAVVFKDTIKNSDEVTNKLGMKLLGVI
GRVYRKNKKGESKQGILITDKKSGFGFIESYKLIRTKIEHAASRQDYKAIIVTSTMENEGKTTSATNIALSLAQNGKSVL
LIDADLRKPSVAKTLGFSASDDEGICGIVSGKKTLKESIKYSEKYQLFVLVSGVAVENSTEILSSPKMEEIVEAAKKEFD
YVIIDTAPCGIIADASILAGYADTIVLVVKQDYASARRIKRAVDNFENSGTEIIGCIFNNSENGMSNSKIYGRKYGYGYG
YG
>gnl|bykdb|A0A348SAK1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Eubacterium sp] (length=518 residues).
MDEMREKSGKEQQGEIEKIDLIEFLRSFQYGIKKMWWLVLVLALIFGLNSYIKARKNYTPVYTASATVAVTTIDGSPAYQ
NNASAQQMADVFPYILTSGVLKDVVAKDMKLDSVPGSISVKAEEGTNMLTISVSGTNAELSYKTLKSVIKNYPEVAQFVL
GNTTLKILDETGVPDDTTKQGVISSSWKRGALKGAIIGLVILSLYVLTRRTVKTGKEIKTHLNLVDLGTLPEVHVKKRNK
ESFYNSVNVLNKRIPQGYLEAFRKVGIKVMKQMEEEEFKTLLVTSSVPEEGKTAFSVNLAIIEAKLGKNVILVDCDMRRP
SVSKAMNQEGEFPGLQAVLQGKVKISEAMTTVELEKCPGSLQILYGGTKEGSSSDLLESKQMERLISILKKKADLVIFDT
APSEMLADAPVLARYLDAAVYVIRYDYAKMRQIRMGVENLSMSGIHMLGYVLNRDRSTGGGYGYGYGYYGRYRYGRYGRY
GRYGGYRHYSRYEKQLDEPVAETGAVNQKEVFTETKET
>gnl|bykdb|A0A348SAK2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Eubacterium sp] (length=486 residues).
MKMENNRENASAQTETEFEPISLVCDILKNWWVILFGALAGAMLFYVASSMIYVPNYRTQATFVITSRENANAYNNLSSA
NSMAETFQKILESTIMKKTICEKLDMDKLDADISANVVKGTNMLTLSVTAHSPKDSIDIIKTVMDNYTSISYYTVGTTVL
DVLEDPKIPYAPVNPPQNGEMAKKGFFLGMAVCILLFAIWSYMHNTVKQEREVEKKLDARSLGAISYEWKYKTIKEWIKH
RKKAVLVDNPLASFRFVESFKMLAARVEYHMSKINGKVLVVTSVCENEGKSSVAGNLAITLAKKGKRIILIDGDIRCPAQ
YLLLGMSPKKENELGEFLEGRIDANHILLNTERKRLGFIGGKVSYSASTEMLGNRQLPVLIEACSKIVDYVIIDTPPSGM
IGDAQIFAQHADAVMVVARQNVTLAEDINEMMDDFRDNHTKVLGVVLNGVMTFQSIADSPVGDHYSRYSRYGRYGRYGKY
ANNKEV
>gnl|bykdb|A0A349DEH5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcaceae bacterium] (length=480 residues).
MRSEKKNQKGLEINVLAFFKELSKKLWIVLIVALIGAIIGAVVSEATKKETYTSTASFVVNTSSDSEKASSNDIYVQINM
AGTFRYILSSRVMKNAIVEKCTPKVDFGTVDRSISVSVVSSTNIIVMSVTTGNPQTSYAIAQTACEVYGDIVAEKYPYAQ
LNLLDTPVLSTYPNSTKSAVSLAAIVGFIGAVATCIIMFIIFLVKDTAKTADELSDKLDVHILGSVQQITNKNKAAKGLL
VTDRKNGFSFIETYKSIRTKIENNSARTGNKVFLITSACENEGKTTSCVNIALSLAQNGKKVLIIDADLRKPSVSKLLSL
PDTDCGLSDVILGNATLNQAIKLVNNFNVCILADQKSVPNPSELLSTDKMEAIIDEVRKNFDYVLIDTAPASVVTDTSVI
AGFVDAAIIVVREDFSPYSRIRMSIEDIDANGAEIIGCIFNADTSNVSKTGRYGKRYGHYGKSGRYGYGSYGYGYGQSKK
>gnl|bykdb|A0A350XYC7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcaceae bacterium] (length=478 residues).
MKSYSDRKSSKGLEINIVAFFRELSKKIWIVLIIAVIGAAIGGVAGEATKKETYTSTVSFVVNSATENGQASSGEINAQI
NMAGTFNYILSSPRMKEAIVEKCSEKVTYGLVDRSISVRVVTSTNVIVMSVTTDNPKTSYAIANTVVDVYGDIVSEIYSN
AKLTLCDRPVLSTAPNSNRSVFSLALMVGFVAAVATCVVFFIMFLVKDTAKTADELSEKLDVHILGSVQQITNKNKTAKG
LLVTDRKNGFSFIETYKAIRTKIENNSTRTGNKVFLVTSACENEGKTTVCVNVALSLAQNGKNVLIIDADLRKPSVGKML
SLKENDRGLSDVILGKVELNKAIKSVNTFNVCVLADQNGVNNPSELLSTEKMEHIIEEVRNAFDYVLIDTAPASVVTDTA
VIAGFADAAIIVVREDFAPYSRIRMSIEDIDSNGAEIIGCVFNADTSNVSNSSRYGRHYGKKGTYGYGGYGGYGQSSK
>gnl|bykdb|A0A351MYR0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Oscillibacter sp] (length=498 residues).
MEEKNRGLQWSHIEPYCLLRTLLRQLWMLLMAGAACAMAAWIVLSCFVTQQYTSSTTFAVTARASTLYYTNITAAADMAS
SYTQLLQSRVLRQTMEQDLGMPLDGTVTAQQLGETNLIRVTVTADTPRQALVLLKAVSDNYGSLSAHVSSTAVLSQLNSP
SLSVAPSRSYNVPRICLIAAIAGAALTALGVAWASVSSGTVQTQEGARSDLDAKIISTVPHEGRRTRKLLGWMDDRRERQ
ARRGGKRLRRNLNISSPAISFAFTESIHRIAEKFQHEHARGRRVFLFSSVSAAEGKSTLAANTAISLASRGVSVLFIDLD
LRRPVQSEMLGLSVKQKNELGTLLTESAAPEKILSAVVTDPATGLHSLLSTKSYTDVIELLASAQLAKVVALARERYDYV
IIDSPPLGFFSDSELLSDLSDASVLVVRQDTVPAPEINDAIDALRAGKAEFLGCILNDMSHLTAYSAGYGYGYGYYGYGY
GKKYDKYGYGHRSGRKQQ
>gnl|bykdb|A0A351SRI8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Firmicutes bacterium] (length=449 residues).
MEEFNILEFLKYYWNKILIVAIVTLLGLILSIVYTAKIQVPVYEAKTSLVLVNNMGENTTITTTDITINKNLVSTYREII
QSKLILNKTIENLNLDISYEELKKNVKVGNVEDTEIILIYVYNEDARLSRKIANEIASVFESEIVGIFNIENISIIDEAT
VGEEPYNVHVLKQIVLGTGLGFVLSSIIIAICFYFDDTVKNESDAERELGVPILGAVPKYKEKVSSGKASDLIICKDSKS
GISEAIRTLRTNLQFSSIDRKIKTILVTSSVPGEGKSFVASNLAVALANSGQRVLLVDCDIRKGRQHRIFGSPNKKGLSN
LLLEDVAQVYRTYINESDVPNLYLMFKGVTPPNPSELLNSDKNKKLVSSLSNNFDIIIFDSAPINGLADSLVMSTLVDGV
IIVTACKETSKTLLKTVKKDLENVGANILGIVLNRTDTNKSKYYGHYYQ
>gnl|bykdb|A0A352MUJ1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridiales bacterium] (length=461 residues).
MEEIDLKELLKLFWKKKILIILTTLAFLFVGYIYNAFITTPEYKAATTLLLVKSSEGTSSVTQADVTLNQKLVYTYTELV
KSDTVLNEVANRIQLNRSVGQLRKNVTIESVKNTEILKISVLDSNKDDAATIANSIAEVFSEQVKEYYHMENIRVVDKAV
APSSPSNINPVKYAGIFAVVGFVISVGVILVLNLFDSTVKNDKDIEKTLNIKTLASFAKNQNARPGVIDLDPKSQIAEGF
KSLRTNLQFMKGSDGDLKSVLITSSLPGEGKSWVATNLAITFARGGYRTILVDADMRKGVQHKKFRLKQVPGLSDFLNSR
IEDYENELPKYVQPTELDNLCVLPCGSITYDSSELLLSNRIIKTVETLKKNCDIVIFDATPSNLVTDAVVLSRLVDTSFI
VTEHEKTQIDDIAKIKTQIEDVGGNIAGIVINKVQDDKASKGNYYYMNESDIKRRKTRSRR
>gnl|bykdb|A0A352TIU5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus sp] (length=534 residues).
MGTLNQKNKNKQDDETEIDLGKLFKALVRRLPIILLVTLCFSAIGFSYGKYYLPLEYTSSTYMYVKNGDASEEKTAINQQ
DLMASKSLVETYIVILKNDTVVKQVGMSLVSKFGVSEISKCFTVKNGVISTSELKDAISMSADGDTEVLKISAQTKDPHV
SAEICDIYAEVAPTFLIRIIGAGSVEVIGDAEVPQSPSAPDVKKITMMAAAAGFVLSAGVAVLIYMLDRTIKGEDDIQSF
SISYLGEVPEMVEARSGKRKRRKKKNSPSALRNMLLCAKDIPFPCSEAYRSIRTNLMFALAPQEHKIVAVTSPNAADGKS
LTAANIAMAMAMMNKKVLFIDADLRKPVQHQRLKLENKVGLSEVLGHMTTWQVARHLAPLPNMDVLTAGTCPPNPSELLA
SPAMKKLLEEAEQQYDYIIIDTPPVNVVSDALGLSDCIGGILMVARYYVTTTKELETALQAISVTGATVLGLVLTEVDFK
QGGYYKKYYKKGSYYTYGNENGNGSKKKSHSHSTQQSEPVSTTTDTDSDKQPVS
>gnl|bykdb|A0A354IGV3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridiales bacterium] (length=525 residues).
MEKKQSLGSAFLSSIDVSGALRAIVRNFWLVVLAALTGAMGAHVVLQTIYKPQYTCSATYIVSSKYSTVSYSNISATSDT
ASLFSKLLDSQVLRKHAAEAIGVENLPAQIKTEVAKDTNVLTLTSTADTAYDAFICLKAVTENYNLISDNVFSSIVLTVI
DGPYIPTQPSNQIDSRDLIRKTAGICALIMIVLIALLTLVRDTIQTPTCIERKLDIKRFGVIYHERKNRTLRDSLHKVNR
SVLLTNPVASFPFTETISKMCTRLEYAATRHGRKVILITSVGENEGKSTIAANLALGLAQRHSKVLLIDGDLRKPAVYKL
LQLRLQPEQALSHYLSDDSVRLSDFVSSAVMQEEKTGLYVIAGDHSVPMSSELVSSARMQALLAHFREEMDFILIDSPPM
ALFSDAEALANLSDASVMVIRQSRSLAQEINTAADTLESGHSELLGCILNDVYGMPFPLSLLDNDSYSYGYGDLHNYGRY
RKYGKYGKYGGYGRYGGYGRYGDYGAAAQAEAENVSATDKEPEVK
>gnl|bykdb|A0A354K620 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus sp] (length=499 residues).
MNESYSIKDILRLLLNHLWIIIIIAILGGAAGFSVSRFLLPLKYSSHITMYVQSYTGITENANNVNNISNSKQLVNTYME
VLKDDAVMNAVAEKLAKQFEKNVLSQNFSLSESGKIAPASIRSCLAISSVTDTSAVKVTATAENAEVAAAICNDLTQVAP
KYVEEAVGVGSINTIDTAKVYKHPVAPNTMKNTALGAAAGFMLIVLIIFLIDFFDTTIKDTDDLGKKYNKAIIGEIQAFG
DSKKKKDADDDYVKLTDKETPFHIIESYKSIRTNLSFALSTFDKKVFAVSSANPGEGKSTTSANIAVAIAQSGSHVLLID
ADMRRSVQHKIFELVNKKGLSTAVSKMHSPDKCIQKNVMENLDIMTAGPIPPNPSELLASDTMEQMLHDLSEKYDVILID
TPPVNVVTDAMELAKMISGIVLVVRYGKTTDEDVENVFKRIELAKMNLLGFIMNGINTKRAGYYAKGKYYYKKGYGYGYY
GEKPEPDTEESKAETQEKN
>gnl|bykdb|A0A355FYK5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcaceae bacterium] (length=535 residues).
MQEDQRNSVNALLGNGLFGNGGSGGGLDLFKLLRALLRRAWAIVMVGVVFAAAGYFFAKASYVPIYTVSATIEFTSTKYI
KVADATGKEELVTVVVPYENNDINRYSTLMKSDAMIYALADKLNNDYNVVELRNAVVLGETGVSGIFSLTVTNIYPEFCS
RTMDAVLDVFPDYMRTSASTINVRLINYPSSPAISNSDNSVKIAFLAFMAGALLIALIVVLVEIFSDTIKDIDDIRNKTN
VPIIGSIPYVGKSTGLINKKPLFTGGLLITDEDKVSFAFIECVKAIRTKLENLSANKGFKTFMVTSTYENEGKTTVAINI
ATSLAQKGKSVLLIDADLRKPAVLRTIGVKYDDKSGLIPIIKGESTYQESIKYVKSLGLFILPSGGITQKSSEVLDADKV
RHVIEQARKEFDFIIIDTPPSRVVSDSMVMSSLADSLVFVIRKDHAKIADINETLEEIAGTNIDIAGAVFTMNDEESRGR
ILNKGGSGSRYYKRYYRYGGKYGYGDGKYGYGSGGSGYGSGSGGYGYGYGSGGYG
>gnl|bykdb|A0A355G1X5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcaceae bacterium] (length=490 residues).
MNTNVNTTSAPKGLEINVLFLLKTVLKRWWILLITTVLCATIGWSVSFMTTDPTYTTNLSFTTYNKAAADVVSSSDINSS
IMMTNTFKYILEGRPMRETVAKSCSFNISADQLRHYVSVNTQADTNIIIVSVTTESPDKSYEIASGIASHYQDIVDYAYP
NATLQIYEKPFKPTAHDPQLSLMRFAAIGGAIGFALAFIVILIVNAARDTLMSSDDVQIKLDAKLLGTVYTVRNKSGKKN
QHPVLMITDRSLGFSFIESYKAIRTRVETLCTRKDYKTILVTSAGANEGKTTFSLNLALSLSQNGKSVLLIDADMRKPTL
YRFLNLNIPRGNDLASVICGKTDLSDAIKYVEKYKLFILSSIEPNSEPTEILASQQMNKIIKAAKKEFDYVIIDTAPAAV
VTDATILSNFADACIMVVRENFSDVSRIRSVISDLESYKAELIGCVYNNTANRDGLLGLYSKSSYGYKSYHSYGYGYGFE
DDEESAGNEE
>gnl|bykdb|A0A355G3J9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcaceae bacterium] (length=502 residues).
MRLTLKDIAMTVWRSIGLIIVSSLLGAMLLAGATWALIKPTYTATAKLYVYNEHSTDTYITSSDLAVSKSLVDTYLIIIK
SDPVLDKVQKDLAAKYPSLTAKQILAMLSGSAINETEAFYISAEHTNRQLATDVLTDIVKVAPQEIIRVVKAASVEIIEE
PKLPTEDESEWPIVGNIAIGFALGLVLSVAYVLLSNALDTTIYGRKEIENAFTLPIIATIPIQGEGKPNGKRNSFDNAVE
QQVILSEDTPFSVKEAYHKARSNILYLPSDEENGCKTLVITSALVSEGKSTFSVNLAITLAKSGNKVLLIDGDLRKPKVS
LYLDLYGKYGLSEYLANLTDELCPMNYSENLDVITSGKCTSYAADLLSTTRAKESISAFRKDYDYIIIDSPPINEVSDAM
TLVDVVNGYIMCSIAGYSDAEETKQAVLSLEQIGAKIFGFVVIGVDFKVEQYGRYKRYGKYGYRSYRYSKEYGYKKKYDR
SYESYDREKAQTKKRKHNKKKI
>gnl|bykdb|A0A355KUM5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcaceae bacterium] (length=460 residues).
MKSYSDRKNSKGIEINILAFFKELSKKLWIVAIIAVIGATIGGVIGEATKSETYTSTVSFVVNSATENGQVSSGEINAQI
NMAGTFSYILSSRALKEAIVEKCPEKVNFGTVDKSISVNVVSSTNVIVMSVTTGDPKISYAIASTVVDVYGDIVTERYPN
AKLTLCDTPVLPTYPNSNRSVVSLALMVGFIAAVASCVVFFIMFLVKDTAKTADELSEKLDVHILGSVQQITNKNKTAKG
LLVTDRKNGFSFIETYKAIRTKIENNSTRTGNKVFLVTSACENEGKTTSCVNIALSIAQNGKNVLIIDADLRKPSVSKML
SLPATEYGLSDVILGNVELNQAIKRVTSFNVCVLADQKGVNNPSELLSTEKMESIIEEARKEFDYVLIDTAPASVVTDTS
VIAGFVDAAIIVVREDFSPYSRIRMSIEDIDSNGAEIIGCIFNADTSNLSKTSRYGRRYG
>gnl|bykdb|A0A355W5Z7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lachnospiraceae bacterium] (length=467 residues).
MLETILNNFHLEKILWILQKRIAYIMILGVLGGMAGGAYAYLTNSTLYRAEVSFYVYSDPDYVYDSSVNISNSEFTQAKN
LVQSYILILKSNTILQKVLEEAGLDYGTEALSGRIGTSVVENTAVFYVYTYDSDPYRAMELANAIGRVAPKEIGRIVKSG
GIEVIDYATLPEAPYSSTSLVKYALVGFAGCFGASFVLFLLAGLMDTTIRRRYELKLAFRIPVLGDIPQIQAPDRKSKPV
LVLGENSSFAVKESYNTIRANLLFTGKGERCPVYAVTSADKDEGKTLNSVNIAISYAQLGKKVLLIDGDMRNMSVASLLK
LRGRLGLSQYLAGLRETPQIVEYRQNLDVLVGGENPPNPSELLGGERMKELLTTLRSRYDCIIIDLPPVGIVTDALLLSH
EVTAYLLVVRAGVSHMSREKAAVTLLEQVDADICGILFNGLPPKSKDCNYRLQQYWQEYKQQNGEAV
>gnl|bykdb|A0A356CW82 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus sp] (length=497 residues).
MKKNYTIKDLLVLLLGKVWYIVAASIVCAILALFVSKFVMSKQYQSHVSMYVKSADNQSTGQDKTNVDLQDINASKSLVQ
TYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTVTSGRVSNDGLRNAYSMTAVNQTEVLQITATTTNAKLSSDLCNIMAD
VAPSFLIRVIGAGSVEKIGDAEVYNTPVSPNTTKNVALGFVGGLMVAVLVILVIDFFDNTVKNSDELGDIYQKPIVGEIM
NIGGKTSKKDEGSSADRKKQLLFNNKDIPFNIVENYKTMRTNLMFTLSTTRNKIVVVSSPNPSEGKSVTVANLAASMAET
ENKVLLIDADMRRPVQHRNFKLKNNVGLSTILSGESTFDKCVHETKNGNFAVLTSGVLPPNPSELLASEKMRELLEYVQH
KYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKLEIGDCNLLGFVLNDISTKNGSHYGYKYNYKY
KYDYSYKYGGKDTSAES
>gnl|bykdb|A0A356PT74 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcaceae bacterium] (length=488 residues).
MAYSSSGKTHAEESVNLDSVVIYLKKILQHWKIVVISAVVLAVLGFAVAKLTYTPSYSSKITFIANNKSSALAVSGQTQS
DLNASATLAESFKYVFTTTELSKRVADNSGFKDISVADIKSWVSVEAVEDTAIINLTVTTPNADVSYGIANAYVNNYESA
INAAFPSTTLTVIDPPLLASAPNRDASARNYTIVGFAAGLVISIFAIVLAVIAKDTVKTADDVKDKLGVDVIGMVAHVNR
KKKKKGEDYKPLLISDRRSGFPFIETFKIIRTKIEHTAQREKYKTFVVTSTAENEGKTTSAVNIALALAQNGKSVLLVDG
DLRKPAVAKLLGINASEDGGVYGVINGEKTLAEAIKYSEKYNLFLLVSGKPVFDPSELLSTDAMSDIIKSAEKEFDYIII
DTAPCGVVADASILSSYADGILLVVRNDMVASRRIKRAVENLENSGTKLVGCIYNDTESGMPKRFMSSYNKKYGYGYGYG
YGYGSNQK
>gnl|bykdb|A0A357AQU0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lachnospiraceae bacterium] (length=535 residues).
MEQQKDEVEIDLLELFWALLRKWWMLTIAAVLCAAIGFSYAKFYLPETFTSSIRMYVKNLNSTETVSSVTTSDLNASKSL
VMTYIVILKDPVVVGEVAETLAENHERDYLNRYFALDENGCPTTGSILNYVSMGSVDNTEVLKVSATTPDAKLSAEISNI
FAEVAPDYLIRIVGAGSVEIIGAAVPATVKSGPSVSRYTIMGFLIGFILVAAAIVIRTITDNTFRDAEDINKKFGLSVLG
EVMDYGTKKDKKKRRNVDPSKKNNFSFETILNKEIPFSVVESFKSIRTNIMFAVATQGKKVIAVTSANPSEGKSSTTTNI
AIAMAMANEKVLLIDGDLRKPVQHKIYNIKNDSGLSNIVSKQKKFDAVVHKAVYKDKDCDGFVDLLTAGTIPPNPSEILA
SEALKNLITEASEQYTVILIDTPPVNMVSDVYGLSDSIAGIVLVAEFEGTTSYDIKHALEGAKLSNVNVLGVILNAVAGS
STGYGYKKYGYKYGYKYGYKYGYRYGYGYGNNNEKKAEEALAAKKEQEKATDKKS
>gnl|bykdb|A0A357GPJ7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lachnospiraceae bacterium] (length=472 residues).
MRRFQMGEYDRTGNGQNGEADWDLRSILCDMAKNWWIILLIACSAAMITYTVLTAVHRDQYTVKTTFAVMGRGENANAAS
SLSSTYEMTQKFQAILENNILKKKVMEELGCSSFPADMSASIVPESNLMELSVTADSPETAFRVLRSVLKNYTTISDYII
PNVVLETLQQPQVSDNPSNRIPTEKYAAMAFLAAALGTAALVGFFSFLRDTVKNETEFGRKIDADLLGTVYHEKKRKNSS
MLITNPARSFPYVESLKRIASRVRGRLDRRGGKVLLVTSVAENEGKSTLAANLALALSEEQNRVLLLDCDFRQPALYKIF
ELPQKAGKDFGQVAVGKESASSVFEKYKDTNVYMGICRERLEEPSEAVGGEIFRRILDTCRTNMDYIILDTPPMGAAADA
EELVELADGAVLAVRQDGVLTRDINDAIDALNQKEEKVIGCVFGNVYPGFGERIGGSYGYGYGYGAYSRAER
>gnl|bykdb|A0A358LJD0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcaceae bacterium] (length=511 residues).
MSKIVRKDTDSDGVEVNIMYVFGLLLRRLWLLILVALVVGASCAVVTKAVEEPTYTSSMTFIVNNKSEKDLSSSGDNSVS
YNDMSASAYMANTFVHLMTGRTMCNAIASECKSYPKTADQVSKMIAASRKTDSSIIDMTVTASSPEEAYELAQAVKDTYK
DVVQVYSGGSIHLCDEPELPTKPDKSVGTVRNTIIGALAGAVICALIIIIRDSARNTVRSQEDIQNKLQLNVIGEVSQVP
GGERFYKKSAHGGRELLITDKACGFAFVETYKAMRTKLELLNGRRGYKSFVVSSAGANEGKTTVAVNLSLALAQNGYSVL
LVDADLRKPSVLKNLGISNLSGNGIADVVNGAKNSSDAIKYIEKYKIFVLAGDESIADPTEVLSNAKTGEFLAAAREKFD
YIIIDTPPVGIVADAAICAKYTDSSIFVIREDVFPVPAILEAVSDLTQGGSDLAGCVYNISTDRSKGGYGNYSISRRRYG
YGYSYGKRYGYGYGYGYGGHSGSNDKNSRSK
>gnl|bykdb|A0A359B487 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Desulfotomaculum sp] (length=497 residues).
MEHQGLNNGVNRTEENEISLGEIISALFKWWWLVILCTVLAALGAYFYTIYTYVPVYTASASMVVNSKQLKIVGQEAVLT
NDVNLSAKLVNTYTAVLTSNRVMELVAGELDLPAAAISPYVSVAPVRDTEVLRIFVSNPDPLLAAKICNSIMHVAPTAIS
STVEVGSINVLDNAKVPEFPNAPATFRNVGVGAVLGLMLGLGIVFMLMFFDRTIKSGDDVKNKLGLTLLGSIPYLSPKAR
KDQGQGQGAPLVNSDQVGFGFVESYKAAGTNLRFASAVTNAKKLLVTSILTGEGKSTVAVNLAITIAHTGKSVLLVDCDL
RKSNMHGVLELDLEDNQGLAAVLNGACAAEECIVFATEQGIHVMPNGYIVPNPSELLGSEKMAALLAALEKQYDYIILDT
PPAYLLTDAVALSVYANGVILVVKQGCAKVDVINSAQAAFENAGVRIIGCILNGIKYNQLGAFYQSRNYERFLGDYYKNY
ALTNKPAQEAAAASDKN
>gnl|bykdb|A0A373GY92 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia sp. AM23-13AC] (length=467 residues).
MGEYDRTGNGQSSKTDWDLRSILCDIAKNWWVILLIACSAAMITYTVMATVHKDRYTVKTTFAVMGRGVDANAASSLSAT
YEMAQKFEAILENTILKKKVMEELSLSSFPAKMNASIVPESNLMELSVTADSPEMAFRILKSVLNNYTSISDYIIPNVVL
ETLQQPQVSGVPSNQIPTKKYAATAFLAAALAMAALIGLFSFLRDTVKNEAEFTRKIDADLLGVVYHEKKKKNSSMLITN
PARSFLYVESLKRIASRVRGRLDRKGGKVLLVTSVAENEGKSTLAANLALALAEEQNRVLLLDCDFRQPALHKIFEIPEK
DGKDFGKVVLGKESASGVFEKHKDTNVYTGICRNRLEEPSLAIGGEIFHRILETCRTNMDYIILDTPPMGMTADAEELAE
YADAAVLSVRQDGVLTRDINDAIDALNQKEEKVIGCVFGNVYPGFGERIGNSYGYGYGYGTYSRAER
>gnl|bykdb|A0A373K3P9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. AF46-9NS] (length=467 residues).
MLETILNNFHLEKILWILQKRIAYIMILGVLGGMAGGAYAYLTNSTLYRAEVSFYVYSDPDYVYDSSVNISNSEFTQAKN
LVQSYILILKSNTILQKVLEEAGLDYGTEALSGRIGTSVVENTAVFYVYTYDSDPYRALELANAIGRVAPKEIGRIVKSG
GIEVIDYATLPEAPYSSTSLVKYALVGFAGCFGASFVLFLLAGLMDTTIRRRYELKLAFRIPVLGDIPQIQAPDRKSKPV
LVLGENSSFAVKESYNTIRANLLFTGKGERCPVYAVTSADKDEGKTLNSVNIAISYAQLGKKVLLIDGDMRNMSVASLLK
LRGRLGLSQYLAGLRETPQIVEYRQNLDVLVGGENPPNPSELLGGERMKELLTTLRSRYDCIIIDLPPVGIVTDALLLSH
EVTAYLLVVRAGVSHMSREKSAVTLLEQVDADICGILFNGLPPKSKDCNYRLQQYWQEYKQQNGEAV
>gnl|bykdb|A0A373L519 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus sp. AF37-20] (length=497 residues).
MKKNYTIKDLLVLLLGKVWYIVAAAVVCAVLALFVSKFVMSKQYQSHVSMYVKSADNQSTGQDKTNVDLQDINASKSLVQ
TYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTVTSGRVSNDGLRNAYSMTAVNQTEVLQITATTTNAKLSSDLCNIMAD
VAPSFLIRVIGAGSVEKIGDAEVYNTPVSPNTTKNVALGFVGGLMVAVLVILVIDFFDNTVKNSDELGDIYQKPIVGEIM
NIGGKTSKKDEGSSADRKKQLLFNNKDIPFNIVENYKTMRTNLMFTLSTTRNKIVVVSSPNPSEGKSVTVANLAASMAET
ENRVLLIDADMRKPVQHRNFKLKNNVGLSTILSGESTFDKCVHETKNGNFAVLTSGVLPPNPSELLASEKMRELLEYVQH
KYDYVIVDGTPLLPVTDVMSLADEVAGVLLIARYGRTTYQEIEESMKKLEIGDCNLLGFVLNDISAKNGSHYGYKYSYKY
KYDYSYKYGGKDTSAES
>gnl|bykdb|A0A373MPB9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus sp. AF34-12] (length=497 residues).
MKKNYTIKDLLVLLLGKVWYIVAASIVCAILALFVSKFVMSKQYQSHVSMYVKSADNQSTGQDKTNVDLQDIDASKSLVQ
TYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTVTSGRVSNDDLRNAYSMIAVNQTEVLQITATTTNAKLSSDLCNIMAD
VAPSFLIRVIGAGSVEKIGDAEVYNTPVSPNTTKNVALGFVGGLMVAVLVILVIDFFDNTVKNSDELGDIYQKPIVGEIM
NIGGKTSKKDEGSSADRKKQLLFNNKDIPFNIVENYKTMRTNLMFTLSTTRNKIVVVSSPNPSEGKSVTVANLAASMAET
ENKVLLIDADMRKPVQHRNFKLKNNVGLSTILSGESTFDKCVHETKNGNFAVLTSGVLPPNPSELLASEKMRELLEYVQH
KYDYVIIDGTPLLPVTDVMSLADEVAGVLLIARYGRTTYQEIEESMKKLEIGDCNLLGFVLNDISAKNGSHYGYKYSYKY
KYDYSYKYGGKDTSAES
>gnl|bykdb|A0A373MWV2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia sp. AF32-4BH] (length=472 residues).
MRRFQMGEYDRTGNGQNGEADWDLRSILCDMAKNWWIILLIACSAAMITYTVLTAVHRDQYTVKTTFAVMGRGENANAAS
SLSSTYEMTQKFQAILENNILKKKVMEELGCSSFPADMSASIVPESNLMELSVTADSPETAFRVLRSVLKNYTTISDYII
PNVVLETLQQPQVSDNPSNRIPTEKYAAMAFLAAALGTAALVGFFSFLRDTVKNETEFGRKIDADLLGTVYHEKKRKNSS
MLITNPARSFPYVESLKRIASRVRGRLDRRGGKVLLVTSVAENEGKSTLAANLALALSEEQNRVLLLDCDFRQPALYKIF
ELPQKAGKDFGQVAAGKEPASSVFEKYKDTNVYMGICRERLEEPSEAVGGEIFRRILDMCRTNMDYIILDTPPMGAAADA
EELVELADGAVLAVRQDGVLTRDINDAIDALNQKEEKVIGCVFGNVYPGFGERIGGSYGYGYGYGAYSRAER
>gnl|bykdb|A0A373NZQ6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia sp. OF03-13] (length=467 residues).
MGEYDRTGNGQSSKTDWDLRSILCDIAKNWWVILLIACSAAMITYTVMATVHKDRYTVKTTFAVMGRGVDANAASSLSAT
YEMAQKFEAILENTILKKKVMEELSLSSFPAKMNASIVPESNLMELSVTADSPEMAFRILKSVLNNYTSISDYIIPNVVL
ETLQQPQVSGVPSNQIPTKKYAATAFLAAALAMAALIGLFSFLRDTVKNEAEFTRKIDADLLGVVYHEKKKKNSSMLITN
PARSFLYVESLKRIASRVRGRLDRKGGKVLLVTSVAENEGKSTLAANLALALAEEQNRVLLLDCDFRQPALHKIFEIPEK
DGKDFGKVVLGKESASGVFEKHKDTNVYTGICRNRLEEPSLAIGGEIFHRILETCRTNMDYIILDTPPMGMTADAEELAE
YADAAVLSVRQDGVLTRDINDAIDALNQKEEKVIGCVFGNVYPGFGERIGNSYGYGYGYGTYSRAER
>gnl|bykdb|A0A373PSC3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus sp. AM54-1NS] (length=497 residues).
MKKNYTIKDLLVLLLGKVWYIVAASIVCAILALFVSKFVMSKQYQSHVSMYVKSADNQSTGQDKTNVDLQDINASKSLVQ
TYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTVTSGRVSNDGLRNAYSMTAVNQTEVLQITATTTNAKLSSDLCNIMAD
VAPSFLIRVIGAGSVEKIGDAEVYNTPVSPNTTKNVALGFVGGLMVAVLVILVIDFFDNTVKNSDELGEIYQKPIVGEIM
NIGGKTSKKDEGSSADRKKQLLFNNKDIPFNIVENYKTMRTNLMFTLSTTRNKIVVVSSPNPSEGKSVTVANLAASMAET
ENKVLLIDADMRRPVQHRNFKLKNNVGLSTILSGESTFDKCVHETKNGNFAVLTSGVLPPNPSELLASEKMRELLEYVQH
KYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKLEIGDCNLLGFVLNDISAKNGSHYGYKYNYKY
KYDYSYKYGGKDASAES
>gnl|bykdb|A0A373RZ83 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia sp. AF26-2] (length=467 residues).
MGEYDRTGNGQSSKTDWDLRSILCDIAKNWWVILLIACSAAMITYTVMATVHKDRYTVKTTFAVMGRGVDANAASSLSAT
YEMAQKFEAILENTILKKKVMEELSLSSFPAKMNDSIVPESNLMELSVTADSPEMAFRILKSVLNNYTSISDYIIPNVVL
ETLQQPQVSGVPSNQIPTKKYAATAFLAAALAMAALIGLFSFLRDTVKNEAEFTRKIDADLLGVVYHEKKKKNSSMLITN
PARSFLYVESLKRIASRVRGRLDRKGGKVLLVTSVAENEGKSTLAANLALALAEEQNRVLLLDCDFRQPALHKIFEIPEK
DGKDFGKVVLGKESASGVFEKHKDTNVYTGICRNRLEEPSLAIGGEIFHRILETCRTNMDYIILDTPPMGMTADAEELAE
YADAAVLSVRQDGALTRDINDAIDALNQKEEKVIGCVFGNVYPGFGERIGNSYGYGYGYGTYSRAER
>gnl|bykdb|A0A373SA66 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus sp. AF25-19] (length=497 residues).
MKKNYTIKDLLVLLLGKVWYIVAASVVCAILALFVSKFVMSKQYQSHVSMYVKSADNQSTGQDKTNVDLQDINASKSLVQ
TYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTVTSGRVSNDGLRNAYSMTAVNQTEVLQITATTTNAKLSSDLCNIMAD
VAPSFLIRVIGAGSVEKIGDAEVYNTPVSPNTTKNVALGFVGGLMVAVLVILVIDFFDNTVKNSDELGDIYQKPIVGEIM
NIGGKTSKKDEGSSADRKKQLLFNNKDIPFNIVENYKTMRTNLMFTLSTTRNKIVVVSSPNPSEGKSVTVANLAASMAET
ENKVLLIDADMRRPVQHRNFKLKNNVGLSTILSGESTFDKCVHETKNGNFAVLTSGVLPPNPSELLASEKMRELLEYVQH
KYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKLEIGDCNLLGFVLNDISAKNGSHYGYKYSYKY
KYDYSYKYGGKDTSAES
>gnl|bykdb|A0A373UGZ4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus sp. AF21-11] (length=497 residues).
MKKNYTIKDLLVLLLGKVWYIVAASIVCAILALFVSKFVMSKQYQSHVSMYVKSADNQSTGQDKTNVDLQDINASKSLVQ
TYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTVTSGRVSNDGLRNAYSMTAVNQTEVLQITATTTNAKLSSDLCNIMAD
VAPSFLIRVIGAGSVEKIGDAEVYNTPVSPNTTKNVALGFVGGLMVAVLVILVIDFFDNTVKNSDELGDIYQKPIVGEIM
NIGGKTSKKDEGSSADRKKQLLFNNKDIPFNIVENYKTMRTNLMFTLSTTRNKIVVVSSPNPSEGKSVTVANLAASMAET
ENKVLLIDADMRRPVQHRNFKLKNNVGLSTILSGESTFDKCVHETKNGNFAVLTSGVLPPNPSELLASEKMRELLEYVQH
KYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKLEIGDCNLLGFVLNDISAKNGSHYGYKYSYKY
KYDYSYKYGGKDTSAES
>gnl|bykdb|A0A373VCW2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus sp. AF19-15] (length=497 residues).
MKKNYTIKDLLVLLLGKVWYIVAASIVCAILALFVSKFVMSKQYQSHVSMYVKSADNQSMGQDKTNVDLQDIDASKSLVQ
TYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTVTSGRVSNDDLRNAYSMIAVNQTEVLQITATTTNAKLSSDLCNIMAD
VAPSFLIRVIGAGSVEKIGDAEVYNTPVSPNTTKNVALGFVGGLMVAVLVILVIDFFDNTVKNSDELGDIYQKPIVGEIM
NIGGKTSKKDEGSSADRKKQLLFNNKDIPFNIVENYKTMRTNLMFTLSTTRNKIVVVSSPNPSEGKSVTVANLAASMAET
ENKVLLIDADMRRPVQHRNFKLKNNVGLSTILSGESTFDKCVHETKNGNFAVLTSGVLPPNPSELLASEKMRELLEYVQH
KYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKLEIGDCNLLGFVLNDISAKNGSHYGYKYSYKY
KYDYSYKYGGKDASAES
>gnl|bykdb|A0A373VM36 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus sp. AF18-29] (length=497 residues).
MKKNYTIKDLLVLLLGKVWYIVAASIVCAILALFVSKFVMSKQYQSHVSMYVKSADNQSTGQDKTNVDLQDINASKSLVQ
TYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTVTSGRVSNDGLRNAYSMTAVNQTEVLQITATTTNAKLSSDLCNIMAD
VAPSFLIRVIGAGSVEKIGDAEVYNTPVSPNTTKNVALGFVGGLMVAVLVILVIDFFDNTVKNSDELGDIYQKPIVGEIM
NIGGKTSKKDEGSSADRKKQLLFNNKDIPFNIVENYKTMRTNLMFTLSTTRNKIVVVSSPNPSEGKSVTVANLAASMAET
ENKVLLIDADMRRPVQHRNFKLKNNVGLSTILSGESTFDKCVHETKNGNFAVLTSGVLPPNPSELLASEKMRELLEYVQH
KYDYVIIDGTPLLPVTDVMSLADEVAGVLLIARYGRTTYQEIEESMKKLEIGDCNLLGFVLNDISAKNGSHYGYKYSYKY
KYDYSYKYGGKDASAES
>gnl|bykdb|A0A373W906 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus sp. AF17-6] (length=493 residues).
MKKNYTIKDLLVLLLGKVWYIVAASIVCAILALFVSKFVMSKQYQSHVSMYVKSADNQSTGQDKTNVDLQDINASKSLVQ
TYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTVTSGRVSNDGLRNAYSMTAVNQTEVLQITATTTNAKLSSDLCNIMAD
VAPSFLIRVIGAGSVEKIGDAEVYNTPVSPNTTKNVALGFVGGLMVAVLVILVIDFFDNTVKNSDELGDIYQKPIVGEIM
NIGGKTSKKDEGSSADRKKQLLFNNKDIPFNIVENYKTMRTNLMFTLSTTRNKIVVVSSPNPSEGKSVTVANLAASMAET
ENKVLLIDADMRRPVQHRNFKLKNNVGLSTILSGESTFDKCVHETKNGNFAVLTSGVLPPNPSELLASEKMRELLEYVQH
KYDYVIVDGTPLLPVTDVMSLADEVAGVLLIARYGRTTYQEIEESMKKLEIGDCNLLGFVLNDISAKNGSHYGYKYKYDY
SYKYGGKDTSAES
>gnl|bykdb|A0A373XXX0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus sp. AF16-50] (length=493 residues).
MKKNYTIKDLLVLLLGKVWYIVAASIVCAILALFVSKFVMSKQYQSHVSMYVKSADNQSTGQDKTNVDLQDINASKSLVQ
TYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTVTSGRVSNDGLRNAYSMTAVNQTEVLQITATTTNAKLSSDLCNIMAD
VAPSFLIRVIGAGSVEKIGDAEVYNTPVSPNTTKNVALGFVGGLMVAVLVILVIDFFDNTVKNSDELGDIYQKPIVGEIM
NIGGKTSKKDEGSSADRKKQLLFNNKDIPFNIVENYKTMRTNLMFTLSTTRNKIVVVSSPNPSEGKSVTVANLAASMAET
ENKVLLIDADMRRPVQHRNFKLKNNVGLSTILSGESTFDKCVHETKNGNFAVLTSGVLPPNPSELLASEKMRELLEYVQH
KYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKLEIGDCNLLGFVLNDISAKNGSHYGYKYKYDY
SYKYGGKDASAES
>gnl|bykdb|A0A374AVY6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Firmicutes bacterium AF12-30] (length=522 residues).
MSNEKHNISVNDYEMNIDLYSILRDISKYIVVILLLAASMSLLAYVYVGRSYHKQYESTSTFIVSSKGSNNSVYSDLSTT
TEMATKFSEILNSSILQKKVAKEMNMDYFPGTASAEVVNETNLLVLKVQADSPEMAFSLNKAIMNNYSVVTNQLIGTVVL
DVLQNPTVPSGPVNEFQPAALMKKTFVMTIVALCGLIAIISFLKDTVRKPKEVSKKLDGTLLQTLYHERSYKSWKARIHR
KKSSVLLTNPGTSFQYVEDMKKLARKVSSKMKDKQAKTLLVASVEENEGKSTVAANLALALAEESEKVLLIDADLRKPSQ
YKIFGLAPEEVQEFGEVLNGNEKSDHLVHALAKSELLLVTGTMIYPNSTEMIASDMFYKIVDFFKERLDYVIIDTPPMSQ
AADAEELVDYADASILVVRQHTALVKDINEAISILNSGEGTMLGCVYNDVFHGIAQTARNYGYRYAYGSGSSYGYGYGYG
NKYGYGYGYGYGRSSRQSKQEEQKEQHNKDSVTERQVKKEDE
>gnl|bykdb|A0A374B6G0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus sp. AM47-2BH] (length=497 residues).
MKKNYTIKDLLVLLLGKVWYIVAASIVCAILALFVSKFVMSKQYQSHVSMYVKSADNQSTGQDKTNVDLQDINASKSLVQ
TYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTVTSGRVSNDGLRNAYSMTAVNQTEVLQITATTTNAKLSSDLCNIMAD
VAPSFLIRVIGAGSVEKIGDAEVYNSPVSPNTTKNVALGFVGGLMVAVLVILVIDFFDNTVKNSDELGDIYQKPIVGEIM
NIGGKTSKKDEGSSADRKKQLLFNNKDIPFNIVENYKTMRTNLMFTLSTTRNKIVVVSSPNPSEGKSVTVANLAASMAET
ENKVLLIDADMRKPVQHRNFKLKNNVGLSTILSGESTFDKCVHETKNGNFAVLTSGVLPPNPSELLASEKMRELLEYVQH
KYDYVIVDGTPLLPVTDVMSLADEVAGVLLIARYGRTTYQEIEESMKKLEIGDCNLLGFVLNDISAKNGSHYGYKYSYKY
KYDYSYKYGGKDASAES
>gnl|bykdb|A0A374BM61 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus sp. AM43-6] (length=497 residues).
MKKNYTIKDLLVLLLGKVWYIVAASIVCAILALFVSKFVMSKQYQSHVSMYVKSADNQSTGQDKTNVDLQDINASKSLVQ
TYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTVTSGRVSNDGLRNAYSMTAVNQTEVLQITATTTNAKLSSDLCNIMAD
VAPSFLIRVIGAGSVEKIGDAEVYNTPVSPNTTKNVALGFVGGLMVAVLVILVIDFFDNTVKNSDELGDIYQKPIVGEIM
NIGGKTSKKDEGSSADRKKQLLFNNKDIPFNIVENYKTMRTNLMFTLSTTRNKIVVVSSPNPSEGKSVTVANLAASMAET
ENKVLLIDADMRRPVQHRNFKLKNNVGLSTILSGESTFDKCVHETKNGNFAVLTSGVLPPNPSELLASEKMRELLEYVQH
KYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKLEIGDCNLLGFVLNDISAKNGSHYGYKYSYKY
KYDYSYKYGGKDASAES
>gnl|bykdb|A0A374ECC6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus sp. AM31-15AC] (length=497 residues).
MKKNYTIKDLLVLLLGKVWYIVAASIVCAILALFVSKFVMSKQYQSHVSMYVKSADNQSTGQDKTNVDLQDINASKSLVQ
TYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTVTSGRVSNDGLRNAYSMTAVNQTEVLQITATTTNAKLSSDLCNIMAD
VAPSFLIRVIGAGSVEKIGDAEVYNTPVSPNTTKNVALGFVGGLMVAVLVILVIDFFDNTVKNSDELGDIYQKPIVGEIM
NIGGKTSKKDEGSSADRKKQLLFNNKDIPFNIVENYKTMRTNLMFTLSTTRNKIVVVSSPNPSEGKSVTVANLAASMAET
ENKVLLIDADMRRPVQHRNFKLKNNVGLSTILSGESTFDKCVHETKNGNFAVLTSGVLPPNPSELLASEKMRELLEYVQH
KYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKLEIGDCNLLGFVLNDISAKNGSHYGYKYSYKY
KYDYSYKYGGKDASAES
>gnl|bykdb|A0A374GB66 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus sp. AM28-13] (length=497 residues).
MKKNYTIKDLLVLLLGKVWYIVAASIVCAILALFVSKFVMSKQYQSHVSMYVKSADNQSTGQDKTNVDLQDINASKSLVQ
TYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTVTSGRVSNDGLRNAYSMTAVNQTEVLQITATTTNAKLSSDLCNIMAD
VAPSFLIRVIGAGSVEKIGDAEVYNTPVSPNTTKNVALGFVGGLMVAVLVILVIDFFDNTVKNSDELGDIYQKPIVGEIM
NIGGKTSKKDEGSSADRKKQLLFNNKDIPFNIVENYKTMRTNLMFTLSTTRNKIVVVSSPNPSEGKSVTVANLAASMAET
ENKVLLIDADMRRPVQHRNFKLKNNVGLSTILSGESTFDKCVHETKNGNFAVLTSGVLPPNPSELLASEKMRELLEYVQH
KYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKLEIGDCNLLGFVLNDISAKNGSHYGYKYSYKY
KYDYSYKYGGKDTSAES
>gnl|bykdb|A0A374HTV1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus sp. TF12-2] (length=497 residues).
MKKNYTIKDLLVLLLGKVWYIVAASIVCAILALFVSKFVMSKQYQSHVSMYVKSADNQSTGQDKTNVDLQDINASKSLVQ
TYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTVTSGRVSNDGLRNAYSMTAVNQTEVLQITATTTNAKLSSDLCNIMAD
VAPSFLIRVIGAGSVEKIGDAEVYNTPVSPNTTKNVALGFVGGLMVAVLVILVIDFFDNTVKNSDELGDIYQKPIVGEIM
NIGGKTSKKDEGSSADRKKQLLFNNKDIPFNVVENYKTMRTNLMFTLSTTRNKIVVVSSPNPSEGKSVTVANLAASMAET
ENKVLLIDADMRRPVQHRNFKLKNNVGLSTILSGESTFDKCVHETKNGNFAVLTSGVLPPNPSELLASEKMRELLEYVQH
KYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKLEIGDCNLLGFVLNDISAKNGSHYGYKYSYKY
KYDYSYKYGGKDTSAES
>gnl|bykdb|A0A381IX63 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium perfringens] (length=463 residues).
MEQKIEIKEYLQLIRKRMKIIVAIVIASILIVSIKTFFFTTPIYEAQTTIIINNLLGKSSQLTKEDISYSQLLGETYKPI
VKSRKVAEEIKKNLNLEEDYHAISNSIDINSVNGPVMNITVKNADPKVAREIANEVPVVFGGELENISKVDGGQVIDEAL
LPTQPISPNKFRNLALGGIIGVVIAIFVVLLLDYFDNKVKTPEELEDILDTSLLGVIPFENEEERKKYEGNVTIIGNSKS
SVSEAYRNTRTNIQFSNLDENLNVIAITSSKPSEGKSTMISNIGAAFGNLENKKVLIIDCDLRNPSIHRMFGLSNAIGLT
DVLIGNKTFNQCVQNTEVKNLKVLTTGNIPNNPAEILNSNRMRSFVEETKEHFDYVFIDTPPIGIVSDAGIVSTYSDGII
LVAASNEVDDNVIKLSKDRLVKVNANIIGCILNKFDYKNHNEYEYYGYYYSAEGNKRKKRKNK
>gnl|bykdb|A0A395X821 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia obeum] (length=467 residues).
MEERIDNETVQQIDLISMLKDIGREWMTILLLAIAAALFADIWICATYQPEYRTSTTFVVTAKGMNNNIYQNLNSTKELA
SQFTEILGSNVLKKKVAQDLGMNNLNVETSVDLVPETNLITLSVKAGTAAESYRVLQSVMENYNTVSDYAIKNVIIETIQ
QPSVAMAPINPLDEKRTVMKVFAVAAGCLIALLAGISYIRDTIKNPGEVSTKLDTRLLGTIAYEKKSKALSMKRKKDYLS
MLIQNPLRSFAYVESSKMAASRVRSYMDKEDAKVLLVTSVMENEGKSTVAANLALSLAQGGSRVMLIDCDFRKPAQYKIF
NVRDNEEKDLGDVLINHASTEKIIRNWNNSGLYMILNKTSLNAIETLLKSMTLKQIIAFCREKMDYVVIDTSPLALVADT
EELAQMTDASVLVVRQDTVLTKDINDAIDILNNTRGKVLGCILNGVTSQNMAGSGHYGYGGHYGKRA
>gnl|bykdb|A0A396G6S7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia obeum] (length=467 residues).
MEERIDNETVQQIDLISMLKDIGREWLTILLLAIAAALFADIWICATYQPEYRTSTTFVVTAKGMNNNIYQNLNSTKELA
GQFTEILGSNVLKKKVAQDLGVNSLEVETSVDLVPETNLITLSVKAGTAAESYRILQSVMENYNTVSDYAIKNVIIETIQ
QPSVAMAPINPLDEKRTVMKVFAVAAGCLIALLAGISYIRDTIKNPGEVSTKLDTRLLGTIAYEKKSKALSMKRKKDYLS
MLIQNPLRSFAYVESSKMAASRVRSYMDKEDAKVLLVTSVMENEGKSTVAANLALSLAQGGSRVMLIDCDFRKPAQYKIF
NVRDNEEKDLGDVLINHASTEKIIRNWNNSGLYMILNKTSSNAIETLLKSMTLKQIIAFCREKMDYVVIDTSPLALVADT
EELAQMTDASVLVVRQDTVLTKDINDAIDILNNTRGKVLGCILNGVTSQNMAGSGHYGYGGHYGKRA
>gnl|bykdb|A0A396PAC1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia sp. TM10-2] (length=472 residues).
MRRFQMGEYDRTGNGQNGEADWDLRSILCDMAKNWWIILLIACSAAMITYTVLTAVHRDQYTVKTTFAVMGRGENANAAS
SLSSTYEMTQKFQAILENNILKKKVMEELGCSSFPADMSASIVPESNLMELSVTADSPETAFRVLRSVLKNYTTISDYII
PNVVLETLQQPQVSDNPSNRIPTEKYAAMAFLAAALGTAALVGFFSFLRDTVKNETEFGRKIDADLLGTVYHEKKRKNSS
MLITNPARSFPYVESLKRIASRVRGRLDRRGGKVLLVTSVAENEGKSTLAANLALALSEEQNRVLLLDCDFRQPALYKIF
ELPQKAGKDFGQVAVGKESASSVFEKYKDTNVYMGICRERLEEPSEAVGGEIFRRILDTCRTNMDYIILDTPPMGAAADA
EELVELADGAVLAVRQDGVLTRDINDAIDALNQKEEKVIGCVFGNVYPGFGERIGGSYGYGYGYGAYSRAER
>gnl|bykdb|A0A3B8KKL6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminiclostridium sp] (length=468 residues).
MERNNFEEIDVREIFFLLLRKWYVVAACFIFVTVSTFLITSYYLTPIYRSEATLFLGKESGNVGGLSIGDIQLNNQLIAD
YRELLKSRTVAERVGEKLNVSPSKLLSNVDVRTVKDSRIFKISYEDSNPTLARDVVNELSNEIQELAADIIEVKNVMVVD
EANMPNSPVKPNKKMNVAVAGLLGIVLGVGLILVLEFVDHTFKKPDEVERYLSLNVVGTIPKFKGGKRGKSKAKNRRELE
KEHLKNLITINDPKAAATEAFRELRTNLHYINIDKEVKTMVVTSPSMGDGKSVTAANLAVILAKSGKRVLIVDADLRKPK
VHHYFGVKNNIGLTSILTDTKEDIKAKAIEKTEISNLDIITSGPVPPNPYEMLSSNKMQSFVEKVKGEYDIVIFDTPPVG
QVTDAAILAGLADGTILVLACAGTRIDMAKRACKALEGVNANMIGAVLTKIDFRKTSYYGYSYSYQYD
>gnl|bykdb|A0A3B9CIM7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lachnospiraceae bacterium] (length=459 residues).
MFKTILSNFHLEKIFWTLKKKALYIFLSTAVLGMVAGAYASITSTSLYMAQISFYVYSNPDYITDSSVNIGSSDITQAKN
LITSYMQILKSRTFLEKVKEETGLGYSTDYLKSQISASAIENTAAFVVRVVDQNPVNAMNIANAIGELAPNEIIRIVKSG
GIEVLDEAELPTVPYQSTSVLKYAVLGAAAGFLLAAAWFLLRSMLDTTVRRKYEIEDLFTIPILGDVPQMEPAAKGEKVN
KILHKESPFAVRESYNSIRAKLLFTGKGEKCPVYAITSADPGEGKTLTCINLASAYAQLGKKILLIDADMRKSNLKSLLD
IEGKEGLSEYLAGITKELKVYKRAENLYVAMAGEVPPNPAELLSGERWSELLEKCKEEYDCIFVDLPPAGIVADALVLAA
TATAYILVVREGVTKFDREQMVVQMLEPVGANICGFVFNGISMKSQDYHYKHYAKDYKY
>gnl|bykdb|A0A3C0IHX1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus sp] (length=534 residues).
MGTLNQKNKNKQDDETEIDLGKLFKALMQRLPIILLVTLCFSAIGFSYGKYYLPLEYTSSTYMYVKNGDTSEEKTAINQQ
DLMASKSLVETYIVILKNDTVVKQVGMSLVSKFGVSEISKCFTVKNGVISTSELKDAISMSADGDTEVLKISAQTKDPHV
SAEICDIYAEVAPTFLIRIIGAGSVEVIGDAEIPQSPSAPDVKKITMMAAAAGFVLSAGVAVLIYLLDRTIKGEDDIQSF
SISYLGEVPEMVEARSGKRKRRKKKNSPSALRNMLLCAKDIPFPCSEAYRSIRTNLMFALAPQEHKIVAVTSPNAADGKS
LTAANIAMAMAMMNKKVLFIDADLRKPVQHQRLKLENKVGLSEVLGHMTTWQVARHLAPLPNMDVLTAGTCPPNPSELLA
SPAMKKLLEEAEQQYDYIIIDTPPVNVVSDALGLSDCIGGILMVARYYVTTTKELETALQAISVTGATVLGLVLTEVDFK
QGGYYKKYYKKGSYYTYGNGNGNGSKKKSHSHSTQQSEPVSTTTDTDSDKQPVS
>gnl|bykdb|A0A3C0QME1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus sp] (length=644 residues).
MNDSYTIKDIISLLLSKLWLLILLAVLGGGGAYAYAHFMMPNQYQSYTSMYVRNSGNILGDLDINISALNASRSLLDTYT
VVLKSNYVMGEVAERLEMEYTTDELAGVFAMNDGKISLSSLRNKITMSSVDETEVMKITANTTNPEISAAICNQIAESAE
ECLTRIVGAGSVEVIDVAESVYKPVSPNKPKMALIGAMAGLILAAFIVLMIDFFDNSVRSSEMLTTKYEKAVFGEIVNFS
DGNSKKVQSEHRTILDEKMDFNIVENYKSIRSNIMFAFSTMPRKILAVSSANPGEGKSTTASNIAIAFAQMESKVLLIDA
DMRKPVQHKVFELSNKKGLSTAIGHMNPLEESVHKGVYKHLDVMPSGPIPPNPSEMLASQQFSDILDELEPQYDYIIIDT
PPINVVSDTLVMGKILSGLLLVVKYGQTTFEELQDAINHANLSELNVIGFVVNNISRKGSGHYYSYKYKYKYRYKSYEYH
YVSHSEDSMTSTPKLSMREDAPQEVPAETKAVETTAPIEETPAEVVEESAPIEETPAEVVEESAPIEETPAEVVEESAPI
EETPAEVVEESAPIEETPAELLEAENLLEEIPLQDAEEAPVKSAIEEAPVALTEETAVEESSEQADIETTKVDLSKESDK
KESE
>gnl|bykdb|A0A3C1J150 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lachnospiraceae bacterium] (length=467 residues).
MLETILNNFHLEKILWILQKRIAYIMILGVLGGMAGGAYAYLTNSTLYRAEVSFYVYSDPDYVYDSSVNISNSEFTQAKN
LVQSYILILKSNTILQKVLEEAGLDYGTEALSGRIGTSVVENTAVFYVYTYDSDPYRAMELANAIGRVAPKEISRIVKSG
GIEVIDYATLPEAPYSSTSLVKYALVGFAGCFGASFVLFLLAGLMDTTIRRRYELKLAFRIPVLGDIPQIQAPDRKSKPV
LVLGENSSFAVKESYNTIRANLLFTGKGEHCPVYAVTSADKDEGKTLNSVNIAISYAQLGKKVLLIDGDMRNMSVASLLK
LRGRLGLSQYLAGLRETPQIVEYRQNLDVLVGGENPPNPSELLGGERMKELLTTLRSRYDCIIIDLPPVGIVTDALLLSH
EVTAYLLVVRAGVSHMSREKSAVTLLEQVDADICGILFNGLPPKSKDCNYRLQQYWQEYKQQNGEAV
>gnl|bykdb|A0A3C1YJQ7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lachnospiraceae bacterium] (length=535 residues).
MEQQKDEVEIDLLELFWALLRKWWMLTIAAVLCAAIGFSYAKFYLPETFTSSIRMYVKNLNSTETVSSVTTSDLNASKSL
VMTYIVILKDPVVVGEVAETLAENHERDYLNRYFALDENGCPTTGSILNYVSMGSVDNTEVLKVSATTPDAKLSAEISNI
FAEVAPDYLIRIVGAGSVEIIGAAVPATVKSGPSVSRYTIMGFLIGFILVAAAIVIRTITDNTFRDAEDINKKFGLSVLG
EVMDYGTKKDKKKRRNVDPSKKNNFSFETILNKDIPFSVVESFKSIRTNIMFAVATQGKKVIAVTSANPSEGKSSTTTNI
AIAMAMANEKVLLIDGDLRKPVQHKIYNIKNDSGLSNIVSKQKKFDAVVHKAVYKDKDCDGFVDLLTAGTIPPNPSEILA
SEALKNLITEASEQYTVILIDTPPVNMVSDVYGLSDSIAGIVLVAEFEGTTSYDIKHALEGAKLSNVNVLGVILNAVAGS
STGYGYKKYGYKYGYKYGYKYGYRYGYGYGNNNEKKAEEALAAKKEQEKATDKKS
>gnl|bykdb|A0A3D0F0Y4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Dorea longicatena] (length=482 residues).
MESSNRNDMPVFMDNDLDPYTLVHDIVSNWWVIILGAIAGALLTYVVVSSRYVPEYTTQATFVVASRGDANAYSNLSSAN
TMAKTFEKILKSNIMEKKICEKLKVEELDADIHAKVLEGTNMLVLSVTADTPKDSIDIIRTVMDNYSSVSLYTVGSAVMD
VLEEPKVPYTPDNPLDAGGQAKKGGLVAGALVLILLGLFSYMKNTIKQENEIEKKLDARSLGAISYEWKYKTIRDIFRRK
KKAILVDDPVASFRFVESYKKLAAKVEYRMAKNEQKVLVVTSVSENEGKSTVAANLAITLAEQSKRVLLVDGDIRRPSQF
LIFGMEPKEENELGEYLKGNRALADVMVPCTRKHMLFMGGKNCYSSSTEMLNSDSFYKLMTACRKFVDYVIIDTPPAGII
GDAQIFAHCADAVMIVSKQNYMLAEDINEVMDAFRDKEGKVLGVVLNGVRSFSGLVDSPVGHYYGKYSKYGRYGNYGRSK
GM
>gnl|bykdb|A0A3D0JG38 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lachnospiraceae bacterium] (length=535 residues).
MEQQKDEVEIDLLELFWALLRKWWMLTIAAVLCAAIGFSYAKFYLPETFTSSIRMYVKNLNSTETVSSVTTSDLNASKSL
VMTYIVILKDPVVVGEVAETLAENHERDYLNRYFALDENGCPTTGSILNYVSMGAVDNTEVLKVSATTPNAKLSAEISNI
FAEVAPDYLIRIVGAGSVEIIGAAVPATVKSGPSVSRYTIMGFLIGFILVAAAIVIRTITDNTFRDAEDINKKFGLSVLG
EVMDYGTKKDKKKRRNVDPSKKNNFSFETILNKEIPFSVVESFKSIRTNIMFAVATQGKKVIAVTSANPSEGKSSTTTNI
AIAMAMANEKVLLIDGDLRKPVQHKIYNIKNDSGLSNIVSKQKKFDAVVHKAVYKDKDCDGFVDLLTAGTIPPNPSEILA
SEALKNLITEASEQYTVILIDTPPVNMVSDVYGLSDSIAGIVLVAEFEGTTSYDIKHALEGAKLSNVNVLGVILNAVAGS
STGYGYKKYGYKYGYKYGYKYGYRYGYGYGNNNEKKAEEALAAKKEQEKATDKKS
>gnl|bykdb|A0A3D1HXX0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcaceae bacterium] (length=507 residues).
MSKIVRKDTDSDGVEVNIMYAFGLLLRRLWLLILVALVVGASCAVITKAVEEPTYTSSMTFIVNNKSEKDLSSSGDNSVS
YNDMSASAYMANTFVHLMTGRTMCNAIAAECKSYPKTADQVAKMIAASRKTDSSIIDMTVTASSPEEAYELAQAVKDTYK
DVVQVYSGGSIHLCDEPELPTKPDKSVGTVRNAIIGALAGAVICALIIIIRDSARNTVRSQEDIQNKLQLNVIGEVSQVP
SGERFYKKSTHGDRELLITDKACGFAFVETYKAMRTKLELLNGRRGYKSFVVSSAGANEGKTTVAVNLSLALAQNGYSVL
LVDADLRKPSVLKNLGISNLSGNGIADVVNGAKNSSDAIKYIEKYKIFVLAGDESITDPTEVLSNAKTGEFIAAAREKFD
YIIIDTPPVGIVADAAICAKYTDSSIFVIREDVFPVPAILEAVSDLTQGGTDLAGCVYNISTDRSKGGYGNYSISRRRYG
YGYGYGKHYGYGYGYGSHSGSHGKNSK
>gnl|bykdb|A0A3D2AD87 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcaceae bacterium] (length=521 residues).
MQDISIMYLFHLAWRRIWAIVIAACLCAAMTFAYCKFVVNPKYKAQSTIYVTNGNINPGETVEEQEETDGVKGTDVSASV
SLSFTVVDILKQPDIYREMVNTIEKYNDKNYRLLKNKISVSRSEEERSMLIYISATSTDKNEAIDLANDFAALCQTFIPN
NVDKNIRVSTTNADSTSVVYPRTVMSTAIAFLVGAVLAFAISFIIDISDQSIRGEDEFVNQYEIPLLGSIPDFDNIVSSP
NYKGYYGKASYRSRLKKHLTDSNNADDSKESVLEKKQIPFVIVESYKNIRTGVAYLLSREEKSSFTITSANAGEGKSTTA
ANLAVAFSQLGKTVLLVDADLRRASLHKKFKLENGKGLADVLTGTATLDEAIVTIKPGLNILTAGFIPPNPSELLDSVNF
EETMKLLNEQYDYVIVDTPPLNVVTDSMIIAPQTGGVILIVRDGYTPHYSIKKVLGDMDFANINILGAVMNGSHPKNKNK
YIYRKYSYGYYGSYYKYDYHKNGYNYDYTSKPESQKETGEQ
>gnl|bykdb|A0A3D2QJB8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcaceae bacterium] (length=507 residues).
MSKIVRKDTDSDGVEVNIMYAFGLLLRRLWLLILVALVVGASCAVITKAVEEPTYTLSMTFIVNNKSEKDLSSSGENSVS
YNDMSASAYMANTFVHLMTGRTMCNAIAAECKSYPKTADQVAKMIAASRKTDSSIIDMTVTASSPEEAYELAQAVKDTYK
DVVQVYSGGSIHLCDEPELPTKPDKSVGTVRNAIIGALAGAVICALIIIIRDSARNTVRSQEDIQNKLQLNVIGEVSQVP
SGERFYKKSAHGDRELLITDKACGFAFVETYKAMRTKLELLNGRRGYKSFVVSSAGANEGKTTVAVNLSLALAQNGYSVL
LVDADLRKPSVLKNLGISNLSGNGIADVVNGAKNSSDAIKYIEKYKIFVLAGDESITDPTEVLSNAKTGEFIAAAREKFD
YIIIDTPPVGIVADAAICAKYTDSSIFVIREDVFPVPAILEAVSDLTQGGTDLAGCVYNISTDRSKGGYGNYSISSRRYG
YGYGYGKHYGYGYGYGSHSGSHGKNSK
>gnl|bykdb|A0A3D3U8B3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lachnospiraceae bacterium] (length=459 residues).
MLGGVCDFMENKKAVAVENAAEDTIDLLEIFRALYRRWVWIVFAALVFGIALGMYGKFVVKDVFQAEASMCIIDSNKEVS
ISDLQIGSALTNDYEGIIKSRVVLTKVISNLNLNIAYKSLYNAVSVDNPEATRIIRIRVVSGNKEEAVDIANEILSVSIE
EIPHVLGSNTPTVLDKADEFFAENTRRSVVSYILIGLMAGIVVSCGVIAISVITNTSIKNEEDIQKCSGLSVLGTIPDYK
GGKKRKEKIIWPDELPFSAAEAIYQLRTAILYSSKDVKMIAVTSAFENQGKSFISFHLAYSLSQVGKRVLLVDTDMRKSV
LQRRMGLEGVKLGLSEYLSGNAEVGQVIYDVGIPNMHVLFSGKLVTNASALLSAKWLRTLCDSVKDSYDYIIFDTPPVGV
VGDAAIVSSVCDGTLLVIENGVTKKKTLCQIAAELEKIDTNILGVVQNMVGSKKDSSYY
>gnl|bykdb|A0A3D4G5Z5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Oscillibacter sp] (length=498 residues).
MDEKNRGLQWSHIEPYCLVRTLLRQLWMLLLAAAACAMAAWIVLSCFVTRQYTSSTTFAVTARASTLYYTNITAAADMAA
SYSQLLQSRVLRQTMEQNLGMSLDGTVSAQQLGETNLIRVTVTADTPRQALVLLKAVSDNYGTLSAHVSSTAVLSQLNAP
TLSVAPSRSYNVPKICLLAGVIGAGLTAAAVAWASVTSGTVQTQEGARSDLDAKLISTVPHEGRRTRKLLGWMDDRRERR
SRRGGRRLRRNLNISSPAISFAFTESIHRIAEKFQHEHAKGRRVFLFSSVSAAEGKSTLAANTAISLASRGVSVLFIDLD
LRRPVQSEMLGLSVKQKNELGTLLSESAAPEKILSAAVTDPSTGLHSLLSTKSYTDVIELLASDQLAKVVALAREQYDYV
IIDSPPLGFFSDSELLSDLSDASVLVVRQDTVPAPEINDAIDALRAGKAEFLGCILNDMVHLTAYSAGYGYGYGYYGYGY
GKKYDKYGYGHRSGQKQQ
>gnl|bykdb|A0A3D4LLB3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridiales bacterium] (length=449 residues).
MYEEEFNDIDLREIFQIIRKYLALIIIITIVFAAAGAVVSIYLIQPVYESSTTLIVREDKDAEEKISISDVNLSKSLVYT
YAEMVKSHTVLDNTAKTLKIDKLDDKSITVSPVKDTQIIKVAVQNTDPVLARDIADALVEEFTLEIQRITKTNNVAVVDY
ARLPLAPVKPDIIMNTAIAGILGAMVILLILFLKEYFDSTAKTEKDIENLLGLSIIGAVPNFNHGSKTAYGNFLIKDNPS
SPTAEAYRKITTNIEFSNVDNVIKTIMITSAKQDEGKTTTICNLAMVMTELKKNILLIDLDLRKPTVHKQFKLSNKTGLT
DLLMKKDDYKAYLQNIYPGLDVLTTGMIPANPAEIINSRALKELIKEVSADYDYILLDVPPVMLVSDPIIISTFSNAVIL
AIEHGKTEKELAKKAVNSLKQVDANIIGAVFNNIPVSKQNNYYYYKSYC
>gnl|bykdb|A0A3D4QRB5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridiales bacterium] (length=477 residues).
MEELDIRDIIHIIRKHFWIIVLTILLFASASGIISVFFLDDVYASSTTLIVSKQNQNSNVNEIQLSDVNLSRNLVDTYSV
IIKSNRVLENVVSDLGLNISVNELKSKINVSAEGNTEILRITVEDLIPEQARDIADSTAEVFISEVNKLLNMENVQVIDT
ARVSQIPIRPTTVRNCIIAAFLGLMVGLGIIFLIEYLDNTIKTQEDAEEFLKLPVIGRIPNFDTKKSKKKSADRSPRLAT
GAATRAPVTEAYKTLRTNIQFSNVDNNLKVLMVTSTSKDEGKSSTAANLAVSIAQSNKKVLLIDCDLRSSIVHRIFHLLN
EKGLTNILVGEAEPSSIVNSGGISNLHIISAGPKPPNPSELLGSTRMQAFLQQAAEIYDMIILDAPPIMPVSDALVLSKY
TDGVVYVVGYGDIAREMVIRAKTDLEKVGAKILGSVINDIPLDTLVGYGSYYYYYGSDSDGKGKKSRNKKRRAQHSA
>gnl|bykdb|A0A3D4T7B4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcaceae bacterium] (length=480 residues).
MRSEKKNQKGLEINVLAFFKELSKKLWIVLIVALIGAIIGAVVSEATKKETYTSTASFVVNTSSDSEKASSNDIYVQINM
AGTFRYILSSRVMKNAIVEKCTPKVDFGTVDRSISVSVVSSTNIIVMSVTTGNPQTSYAIAQTACEVYGDIVAEKYPYAQ
LNLLDTPVLSTYPNSTKSAVSLAAIVGFIGAVAPCIIMFIIFLVKDTAKTADELSDKLDVHILGSVQQITNKNKAAKGLL
VTDRKNGFSFIETYKSIRTKIENNSARTGNKVFLITSACENEGKTTSCVNIALSLAQNGKKVLIIDADLRKPSVSKLLSL
PDTDCGLSDVILGNATLNQAIKLVNNFNVCILADQKSVPNPSELLSTDKMEAIIDEVRKNFDYVLIDTAPASVVTDTSVI
AGFVDAAIIVVREDFSPYSRIRMSIEDIDANGAEIIGCIFNADTSNVSKTGRYGKRYGHYGKSGRYGYGSYGYGYGQSKK
>gnl|bykdb|A0A3D5ES03 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Oscillibacter sp] (length=498 residues).
MDEKNRGLQWSHIEPYCLVRTLLRQLWMLLLAAAACAMAAWIVLSCFVTRQYTSSTTFAVTARASTLYYTNITAAADMAA
SYSQLLQSRVLRQTMEQNLGMSLDGTVSAQQLGETNLIRVTVTADTPRQALVLLKAVSDNYGTLSAHVSSTAVLSQLNAP
TLSVAPSRSYNVPKICLLAGVIGAGLTAAAVAWASVTSGTVQTQEGARSDLDAKLISTVPHEGRQTRKLLGWMDDRRERR
SRRGGKRLRRNLNISSPAISFAFTESIHRIAEKFQHEHAKGRRVFLFSSVSAAEGKSTLAANTAISLASRGVSVLFIDLD
LRRPVQSEMLGLSVKQKNELGTLLSESADPEKILSAAVTDPSTGLHSLLSTKSYTDVIELLASDQLAKVVALAREQYDYV
IIDSPPLGFFSDSELLSDLSDASVLVVRQDTVPAPEINDAIDALRAGKAEFLGCILNDMAHLTAYSAGYGYGYGYYGYGY
GKKYDKYGYGHRSGQKQQ
>gnl|bykdb|A0A3D5LL19 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcaceae bacterium] (length=488 residues).
MAYSSSGKTHAEESDNLDSVVIYLKKILQHWKIVVISAVVLAVLGFAVAKLTYTPSYSSKITFIANNKSSALAVSGQTQS
DLNASATLAESFKYVFTTTELSKRVADNSGFKDISVSDIKSWVSVEAVEDTAIINLTVTTPNADVSYGIANAYVNNYESA
INAAFPSTTLTVIDPPLLASAPNRDASARNYTIVGFAAGLVISIFAIVLAVIAKDTVKTADDVKDKLGVDVIGMVAHVNR
KKKKKGEDYKPLLISDRRSGFPFIETFKIIRTKIEHTAQREKYKTFVVTSTAENEGKTTSAVNIALALAQNGKSVLLVDG
DLRKPAVAKLLGINASEDGGVYGVINGEKTLAEAIKYSEKYNLFLLVSGKPVFDPSELLSTDAMSDIIKSAEKEFDYIII
DTAPCGVVADASILSSYADGILLVVRNDMVASRRIKRAVENLENSGTKLVGCIYNDTESGMPKRFMSSYNKKYGYGYGYG
YGYGSNQK
>gnl|bykdb|A0A3D5R4X5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridiales bacterium] (length=477 residues).
MTREERYLEEEIDIRQLFHILRKRLGWIISITLAFLIISALISFFILTPIYQSSTALMVNKTFSESEMLNQIQLSDINVN
IRLAETYSEIIKSRRVASRVIDEMNLDISYEGLRNITEVSLVRDTEFINIKVQNPNPEQARDIANKLAEVFQEEVVEIMN
VDNVKILDKAVTPTSPIKPNKMMNIAIAGVLGLMLSVGLVFLIEFLDKTIKTPEDIERYLNLSIIGAIPHNEKAEKRKVV
TFEDPKSPVAEAYRSLRTNLKFASLDKEIKSIVVTSTIAGEGKSLTTSNLATAIAQTGNKVLLVDTDFRKPSIHKIARKP
NADGLADVLINKSDYRSSVKQSRTKNLDLMFSGLIPPNPSELLGSKSMLEFIEKVKEEYDYVIFDTPPVALVTDAAILAN
EVDGVILVTSFGMVDYQIAKRAVELLKNANANILGSVLNKIPMGRGGYSYYKYYSSYYGEYEKTSRKKRKKRSDVID
>gnl|bykdb|A0A3D5TNI1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcaceae bacterium] (length=513 residues).
MNRIVKKDTDSDGVEINIMYVFGLLIRRLWLLMLVGLIVGASCAGITKLVEEPTYTSSMTFIVNNKSEKDLSSSGDNSVS
YNDMSASAYMANTFVHLMTGRTMCNAIAAECKTYPKTADEVEEMIAASRKTDSSIIDMTVTAGSPEEAYELAQAVKDTYK
DVVQVYSGGSIHLCDMPELPTEPDKSVGITRNAIIGALAGAVICALIIIIRDSARNTVRSQEDIQNKLQLNVIGEVSQVP
GGERFYKKSAHGDRELLITDKACGFAFIETYKAMRTKLELLNGRRGYKSFVISSAGANEGKTTVAVNLSLALAQNGYSVL
LIDADLRKPSVLKNLGITNISGNGIADVVGRVKNSSDAIKYIEKYKIFVLAGDECIADPTEVLSNAKTGEFIAAAKEKFD
YIIIDTPPAGIVADAAICAKYTDSSIFVIREDRFPVPAILEAVSDLTQGGTDLAGCVYNISTDRSRGGYGSYSVSRRRYG
YGYGRHYGYGYGKHYGYGYGYGGHAGSRDKKDK
>gnl|bykdb|A0A3E4LL92 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus lactaris] (length=468 residues).
MSQESYKSQSLDSQIDLRYIFRTLKKNAVFILMCMCLTGMFSYVILDHSLKDTYTVSVNLCVIPRDNTSEKLAETNIENA
LERSVNVLNSDTMRDQIVKASGGSRVQGNLSASVVTDTNIIRMSASGTNAESAYKLLKGALKQYPELSDYFESGYVLQPL
SSISANNVQRTEKATVKYSALLILLVLAGGVGATVCLCIFTDKIHSMEQAKRLLDIPMIGSLDYVKKKSGQKALLISDQD
TDHVYEEAVDRIVTSIGSEMSAEGYKTLMVGSIKENDGKSTVTANMVLDLARRGKKVVLVDCDMRHPSLAKIFDAAVDPK
EQLSEYLLGKCELDKVLKRTEVQAHPIYCLWQKKAVARPYRLLESERFASLIHQLKEQFDYVVMDTPPLELIRDAEIISE
TADAMLMVMCQDEVHAVAVNDAVDLLEENGVTVIGGVLNMTKGERNISKDRESYGKYYNENAKKNAGE
>gnl|bykdb|A0A3E5A223 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia obeum] (length=467 residues).
MEERIDNETVQQIDLISMLKDIGREWLTILLLAIAAALFADIWICATYQPEYRTSTTFVVTAKGMNNNIYQNLNSTKELA
GQFTEILGSNVLKKKVAQDLGVNSLEVETSVDLVPETNLITLSVKAGTAAESYRILQSVMENYNTVSDYAIKNVIIETIQ
QPSVAMAPINPLDEKRTVMKVFAVAAGCLIALLAGISYIRDTIKNPGEVSTKLDTRLLGTIAYEKKSKALSMKRKKDYLS
MLIQNPLRSFAYVESSKMAASRVRSYMDKEDAKVLLVTSVMENEGKSTVAANLALSLAQEGSRVMLIDCDFRKPAQYKIF
NVRDNEETDLGDVLINHASTEKIIRNWNNSGLYMILNKTSSNAIETLLKSMTLKQIIAFCREKMDYVVIDTSPLALVADT
EELAQMTDASVLVVRQDTVLTKDINDAIDILNNTRGKVLGCILNGVTSQNMAGSGHYGYGGHYGKRA
>gnl|bykdb|A0A3E5FRL7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Clostridium] spiroforme] (length=465 residues).
MNQDEINLDSINYRGIIRDLLKNWWIIVLIVISLYLAATGIGKLVYIPEYTVSTTLVVNAQGTSDTYTSLAMANEMADII
KEVFQSDVLLELVENEIGKTNQGTITCNQIQETNLLVLNVTSKDPQNAYQFMNSALKHYDEVSDYVFTNATLQVLQEPSI
PITPSNSSKLINYRNYIALLGGVAVTGIIICLYLFRHTLKSSKNATKLLDGRVVGVIPYEKKKRDKHLKKLKQSLLISSP
IASMNFVEANGRMSSRIEYHLNRYNYQVLLVTGISENEGKSTVAANICLSFVEKNKKVLLIDGDFRKPAQYKIFDKEVLD
TNPLQDVITGKTTLKESIYFNKKSNIYELFLYHAIDDPSKLMNAVTLKKIMEQLKEHFDYIVIDCSPVAVSVDAEVWMEV
VDSTILVIRQDWTDIRVVNDTVDLIWQSNCNFTGFALNMFIDNDSHHNDYGYSYYDYKTHRHESR
>gnl|bykdb|A0A3E5FSY5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Clostridium] spiroforme] (length=503 residues).
MIVIIMIMVIVIMIIKPIDMKVGDIMDEQRLKESMMEDDSIEIDLSELIHDFLKILKDYWGVFLGTIVICTIAFSTFRYL
TYTPIYRCEATFTVATDSENTGSYSYYYSQNTADQLSKTFPYILDSSYFRSILLDELGVNSLNGTLSASTVSESNIVTMG
VESNSPQDAMSILTSAIEIYPDVARFVLGQIQFHMINNPQLPTDPYNKLTFTNTVLVGGIIGLVSGTIILGCMALFRKTV
KNPEDMKRITNLNCMATIPQVKFKARKIHKQTRISINDRRISFAFKENMRSLQIRLERVFKKEEHKVIVVTSTAANEGKT
TLTINLAETFAANGKRVLLIDADLRRQSIAKILKCDNNEGLVDLYLQKGDVLKNIRKLDNSKFWFIGNDKPINNPVSVLS
HPDFKKFIEKMKKEFDYVIIDTPPCGIFQDVTLIQEYSDALLYVVKYDFLPYQKIQNGLSILKEDCCFMGYVFNIYTKKS
SEYGHYSYGYNQYRYSKGGEYKE
>gnl|bykdb|A0A3N1XSX6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Mobilisporobacter senegalensis] (length=467 residues).
MEFTVKEIIKLILKRLIWIILCLFAGLLISFIFSRYIINPSYTAYVQLYVIPDDTEASLNLNELNYAQKVVTTYINFLNT
NVFYHDIQEESNLNYSINELKHMTTIKTINNTEIFQISVTSSSARDSYTLVETMQRIAPQLIKSIKPSAQISVVDPVSVP
TKPSSPNILKNTLIGGMLGLVLSIIFSFLWEIFDVNIKEKEELITNYQLPVLGEIPNFNGYKEKQLYKRYFPFLLKYKKF
SKTERELMDNSKFIITESYKSLRTNLRFTLLKDQCKKIIVSSPVPEEGKSTTSINLGITISQTGSKVLLIDCDLRKGKIH
NYFNLKYKPGLSDVLSGMAELTNVIRKTSYENLNIITIGSISPNPSELLSSSHMEELINVLEKDYDYIIFDTPPVNVLSD
SLSLVKLSDGLIIVVREGVTSHPNVSNALEKFRLSQGNILGFVINGVSINQTKKSKYYYYQYGDSND
>gnl|bykdb|A0A3R6JRU5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. AF34-10BH] (length=467 residues).
MLETILNNFHLEKILWILQKRIAYIMILGVLGGMAGGAYAYLTNSTLYRAEVSFYVYSDPDYVYDSSVNISNSEFTQAKN
LVQSYILILKSNTILQKVLEEAGLDYGTEALSGRIGTSVVENTAVFYVYTYDSDPYRALELANAIGRVAPKEIGRIVKSG
GIEVIDYATLPEAPYSSTSLVKYALVGFAGCFGASFVLFLLAGLMDTTIRRRYELKLAFRIPVLGDIPQIQAPDRKSKPV
LVLGENSSFAVKESYNTIRANLLFTGKGERCPVYAVTSADKDEGKTLNSVNIAISYAQLGKKVLLIDGDMRNMSVASLLK
LRGRLGLSQYLAGLRETPQIVEYRQNLDVLVGGENPPNPSELLGGERMKELLTTLRSRYDCIIIDLPPVGIVTDALLLSH
EVTAYLLVVRAGVSHMSREKSAVTLLEQVDADICGILFNGLPPKSKDCNYRLQQYWQEYKQQNGEAV
>gnl|bykdb|A0A3R6QUY7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. AM34-9AC] (length=467 residues).
MLETILNNFHLEKILWILQKRIAYIMILGVLGGMAGGAYAYLTNSTLYRAEVSFYVYSDPDYVYDSSVNISNSEFTQAKN
LVQSYILILKSNTILQKVLEEAGLDYGTEALSGRIGTSVVENTAVFYVYTYDSDPYRAMELANAIGRVAPKEIGRIVKSG
GIEVIDYATLPEAPYSSTSLVKYALVGFVGCFGASFVLFLLAGLMDTTIRRRYELKLAFRIPVLGDIPQIQAPDRKSKPV
LVLGENSSFAVKESYNTIRANLLFTGKGERCPVYAVTSADKDEGKTLNSVNIAISYAQLGKKVLLIDGDMRNMSVASLLK
LRGRLGLSQYLAGLRETPQIVEYRQNLDVLVGGENPPNPSELLGGERMKELLTTLRSRYDCIIIDLPPVGIVTDALLLSH
EVTAYLLVVRAGVSHMSREKAAVTLLEQVDADICGILFNGLPPKSKDCNYRLQQYWQEYKQQNGEAV
>gnl|bykdb|A0A3R6VK11 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. TF08-15] (length=467 residues).
MLETILNNFHLEKILWILQKRIAYIMILGVLGGMAGGAYAYLTNSTLYRAEVSFYVYSDPDYVYDSSVNISNSEFTQAKN
LVQSYILILKSNTILQKVLEEAGLDYGTEALSGRIGTSVVENTAVFYVYTYDSDPYRAMELANAIGRVAPKEIGRIVKSG
GIEVIDYATLPEAPYSSTSLVKYALVGFAGCFGASFVLFLLAGLMDTTIRRRYELKLAFRIPVLGDIPQIQASDRKSKPV
LVLGENSSFAVKESYNTIRANLLFTGKGERCPVYAVTSADKDEGKTLNSVNIAISYAQLGKKVLLIDGDMRNMSVASLLK
LRGRLGLSQYLAGLRETPQIVEYRQNLDVLVGGENPPNPSELLGGERMKELLTTLRSRYDCIIIDLPPVGIVTDALLLSH
EVTAYLLVVRAGVSHMSREKSAVTLLEQVDADICGILFNGLPPKSKDCNYRLQQYWQEYKQQNGEAV
>gnl|bykdb|A0A3R9Q621 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Herbinix hemicellulosilytica] (length=475 residues).
MEFTLAQVIKLLYKRMLWIVLITALALAATFAVNKYLISESYTASVQFYVNTQDSQTQKIDLNELNYAQKVVNTYINFLK
TKVFYNMLIEETRLPYTVDMLKDCIRITVVSNTEIFQVSVTTNSASDSFELAKAIQNIAPDFIKSIKNTTEISVVDPVVM
PRQPSGPHVLLNTAIGGLMGFVLSVLLVFIWELIDVNVKDEEELKQRYNKPVIGNIPSYQGNDAVREKLRRILPGRNKNR
QAGRGKAKSGGLDKIIDENTKFIITEAYRALRSNLRYTLRKDGCKIIMINSPMPEDGKSTTCANLGITMAQTGARVLLVD
CDLRKGKLHRFFNFKSMPGLSDILSGLASETEVIHSTAYKNLHVLPMGSKPPNPAEMLASVHMEELIAKLAKSYDYIIID
TPPINVVSDVIGLVKLVDGMLIVVRQAVTSHPNIAGALSKYELVNANILGFVLNGVIRKQGLKSKSGYYYRSKDD
>gnl|bykdb|A0A3R9WAA7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Herbinix hemicellulosilytica] (length=483 residues).
MNYNDAAFGEVYTIDLSGIGRNFLRGLKKLFWLIPLLAVSVAMLVCVYAREKYSPRYTAAVTFTVNLDLASDGSIYEDSM
RASQLSATFPYIVTSSILKNIIAEELGINELSEQITADNVKDTNLFTIRVSSDNPTRAYEVLQSVIKNYPKVAETVVGTT
HLNMIEESGIPAFPSNPVDYRRLIGSGAAIGAAIALFFIVVYAFARKTIHKPDDLIQITNVKLLGLLPHLRERKKNIIGD
VRKRAQTDRMALGYMDDMYKIRTRLNKIITNRDIKTLLITSAIPAEGKSTFAFNLATAMAELDRKVILVDCDFRRPSIMK
MLPYSAGTVCLNDVLKEKEKLTDAIRYYDEYKIAVLACSKQLEESSEILGKRAIGSILEQLKEEYDYIILDSAPSAVISD
TIELAKYADGVIYVIRQDYSRVRQIQQGMEHIVESSRAEIIGCVLNNVRHMPAGYGYGYGYYGKYGRKSYYGKNTGIAAN
QVD
>gnl|bykdb|A0A401USI6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium tagluense] (length=472 residues).
MREENDIEFNDYLNIIRKKIVVILFIIICPTLIAGLLSFYVIKPVYEAKATVIVGKDSTDKITQSEVMMYQDLIKTYSEI
GKSRVVAENAIKNLKSGIVVKEFMLDLSITPKIGTQIIEISYKSKNPEIAAEGANALSQAFIEESQNLLPSGIAKIMDKA
LIPELPITPKKKFNISIGFIIGLILSLGLVLLINYLNNTIKSEDDVQRYLNLPMVGIIPKQNKMVNLIVEREPKSPVTEA
FKSMRTNLLFSMENRGIKTLMVCSPGPKDGKTSVSTNIASTIAQTGKSILLIDCDLRKPCIHRHFNITNNAKGLVDIVLQ
ERKIEEISIGIDDKFDVLTAGKANYNPSELLSSQKMKDFIKDMEKKYDYVILDTPPIIAFADALTLATEKIGVILVIGSE
ESTIENCKKSKQLLLNINATIIGIVLNKVDKRSFIGYGYDYYSYDKEKSSRLRNKSGRKKRNNNEKPNPINI
>gnl|bykdb|A0A414P2K5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus lactaris] (length=469 residues).
MIQEGYKSQSLDSQIDLRYIFRTLKKNAVFILMCVCLTGMFSYVILDHSLKDTYTVSVNLCVIPRDNTSEKLAETNIENA
LERSVNVLNSDTMRDQIMKASGSSRVKGNLSASVVADTNIIRMSASGTNAESAYKLLKGALQQYPELSDYFESGYVLQPL
SSISANNVQKTEKATLRYSLLLILLVLAGGIGATVCLCIFTDKIHSMEQAKRLLDIPMIGSLDYVKKKSGQKALLISDQD
TDHVYEEAVDRIVTSIRSEMSAEGYKTLMVGSIKENDGKSTVTANIALNLARRGKKVVLVDCDMRHPSLAKIFDATVDPK
EQFSEYLLGKCELDQVLKQTEVQAHPMDCIWQKKAVAKPYRLLGSERFISLINQLKEQFDYVVMDTPPLELIRDAEIISE
TADAMLMVMRQDEVHAVAVNDTVDLLEENGVTVIGGVLNMTKGERDTSKDRDGYRKYYNENAKIENAGE
>gnl|bykdb|A0A414W2C6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia obeum] (length=467 residues).
MEERIDNETVQQIDLISMLKDIGREWLTILLLAIAAALFADIWICATYQPEYRTSTTFVVTAKGMNNNIYQNLNSTKELA
GQFTEILGSNVLKKKVAQDLGVNSLEVETSVDLVPETNLITFSVKAGTAAESYRILQSVMENYNTVSDYAIKNVIIETIQ
QPSVAMAPINPLDEKRTVMKVFVVAAGCLIALLAGISYIRDTIKNPGEVSTKLDTRLLGTIAYEKKSKALSMKRKKDYLS
MLIQNPLRSFAYVESSKMAASRVRSYMDKEDAKVLLVTSVMENEGKSTVAANLALSLAQEGSRVMLIDCDFRKPAQYKIF
NVRDNEETDLGDVLINHASTEKIIRNWNNSGLYMILNKTSSNAIETLLKSMTLKQIIAFCREKMDYVVIDTSPLALVADT
EELAQMTDASVLVVRQDTVLTKDINDAIDILNNTRGKVLGCILNGVTSQNMAGSGHYGCGGHYGKRA
>gnl|bykdb|A0A415D1L1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus lactaris] (length=469 residues).
MSQEGYKSQSLDSQIDLRYIFRTLKKNAVFILMCVCLTGMFSYVILDHSLKDTYTVSVNLCVIPRDNTSEKLAETNIENA
LERSVNVLNSDTMRDQIMKASGSSRVKGNLSASVVADTNIIKMSASGTNAESAYKLLKGALQQYPELSDYFESGYVLQPL
SSISANNVQKTEKATLRYSLLLILLVLAGGIGATVYLCIFTDKIHSMEQAKRLLDIPMIGSLDHVKKKSGQKALLISDQD
TDHVYEEAVDRIVTSIRSEMSAEGYKTLMVGSVKENDGKSTVTANIALNLARRGKKVVLVDCDMRHPSLAKIFDATVDPK
EQFSEYLLGKCELDQVLKQTEVQAHPMGCIWQKKAVAKPYRLLGSERFISLIDQLKEQFDYVVMDTPPLELIRDAEIISE
TADAMLMVMRQDEVHAVAVNDTVDLLEENGVTVIGGVLNMTKGERDTSKDRYGYSKYYKENAKIENAGE
>gnl|bykdb|A0A415HQH5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia obeum] (length=467 residues).
MEERIDNETVQQIDLISMLKDIGREWLTILLLAIAAALFADIWICATYQPEYRTSTTFVVTAKGMNNNIYQNLNSTKELA
GQFTEILGSNVLKKKVAQDLGVNSLEVETSVDLVSETNLITLSVKAGTAAESYRILQSVMENYNTVSDYAIKNVIIETIQ
QPSVAMAPINPLDEKRTVMKVFAVAAGCLIALLAGISYIRDTIKNPGEVSTKLDTRLLGTIAYEKKSKALSMKRKKDYLS
MLIQNPLRSFAYVESSKMAASRVRSYMDKEDAKVLLVTSVMENEGKSTVAANLALSLAQGGSRVMLIDCDFRKPAQYKIF
NVRDNEEKDLGDVLINHASTEKIIRNWNNSGLYMILNKTSSNAIETLLKSMTLKQIIAFCREKMDYVVIDTSPLALVADT
EELAQMTDASVLVVRQDTVLTKDINDAIDILNNTRGKVLGCILNGVTSQNMAGSGHYGYGGHYGKRA
>gnl|bykdb|A0A415VWX5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lachnospiraceae bacterium AM21-21] (length=520 residues).
MSSDKRNISVNDYEMNIDLYSILRDIWKYALVILLLAASMSLLSYVYVGRNYHKQYESTSTFIVSSKGSNNSVYSDLSAT
SEMATKFSEILNSSILQKKVAKEMDMDYFPGSASAEVVNETNLLVLKVQADSPEMAFRLNKAIMNNYSVVTDQLIGNVVL
DVLQKPTVPSGPVNKFQPTALMKKTFLMTIVALCGLIAILSFLKDTVRKPKEVSRKLDAKLLQTLYHEKIYKTWKARIHR
KKSPVLLTNPGTSFQYVEDMKKLARKVSSKMKEKNAKTLLVASVEENEGKSTVAANLALALAEESEKVLLIDADLRKPSQ
YKIFGLDQEEIQQFGEVLNGNEQIDNLVTDLPKSELLLIAGSMIYPNSTEMIASPIFQKIVEFFKTKLDYIIIDTPPMSQ
AADAEELVDLADASILVVRQHTALVKDINETISILNSAEGTMLGCVYNDVFHGVAQTARNYGYKYAYGSGYGYGNKYGYG
NHGYGYGYGYGYGYGSRTKKGNEDKTQESKTERQVKKDHE
>gnl|bykdb|A0A416CXD7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. AF36-18BH] (length=467 residues).
MLETILNNFHLEKILWILQKRIAYIMILGVLGGMAGGAYAYLTNSTLYRAEVSFYVYSDPDYVYDSSVNISNSEFTQAKN
LVQSYILILKSNTILQKVLEEAGLDYGTEALSGRIGTSVVENTAVFYVYTYDSDPYRAMELANAIGRVAPKEIGRIVKSG
GIEVIDYATLPEAPYSSTSLVKYALVGFAGCFGASFVLFLLAGLMDTTIRRRYELKLAFRIPVLGDIPQIQAPDRKSKPV
LVLGENSSFAVKESYNTIRANLLFTGKGEHCPVYAVTSADKDEGKTLNSVNIAISYAQLGKKVLLIDGDMRNMSVASLLK
LRGRLGLSQYLAGLRETPQIVEYRQNLDVLVGGENPPNPSELLGGERMKELLTTLRSRYDCIIIDLPPVGIVTDALLLSH
EVTAYLLVVRAGVSHMSREKSAVTLLEQVDADICGILFNGLPPKSKDCNYRLQQYWQEYKQQNGEAV
>gnl|bykdb|A0A416EYU4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia sp. AF34-10] (length=472 residues).
MRRFQMGEYDRTGNGQNGEADWDLRSILCDMAKNWWIILLIACSAAMITYTVLTAVHRDQYTVKTTFAVMGRGENANAAS
SLSSTYEMTQKFQAILENNILKKKVMEELGCSSFPADMSASIVPESNLMELSVTADSPETAFRVLRSVLKNYTTISDYII
PNVVLETLQQPQVSDNPSNRIPTEKYAAMAFLAAALGTAALVGFFSFLRDTVKNETEFGRKIDADLLGTVYHEKKRKNSS
MLITNPARSFPYVESLKRIASRVRGRLDRRGGKVLLVTSVAENEGKSTLAANLALALSEEQNRVLLLDCDFRQPALYKIF
ELPQKAGKDFGQVAVGKESASSVFEKYKDTNVYMGICRERLEEPSEAVGGEIFRRILDTCRTNMDYIILDTPPMGAAADA
EELVELADGAVLAVRQDGVLTRDINDAIDALNQKEEKVIGCVFGNVYPGFGERIGGSYGYGYGYGAYSRAER
>gnl|bykdb|A0A416MP73 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Firmicutes bacterium AF25-13AC] (length=477 residues).
MESKEITAMGASAEEDTIDLMEIFRALRKRWYWIVLLAIIFGAALGVYGKFIVKDAYQAEASMCIIDSNKEVSMSDVQLG
SALTGDYEGIIKSRVVLNKVIENLKLDLTYKQLYNIVSVENPDSTRILKIYVTAGTVREAVNIANEILSVSVDEIPHVLG
SSKPTILDKADDLFAENTRRSVLSYALIGILAGIVIACGIVAVSVITNTSIKSDEDIQKCTGLSVLGAIPDYKGKKQKKI
MWPEDLPFNASEAIYQLRTGILYSSKDVKTIVVTSAFENQGKSFISFHLAYSLSQVGKRVLLVDTDMRKSVLQRRMGLDG
VKLGLSEYLSGNAELGQVIYDVGLPNMHVLFSGKLVPNASALLSAKWLENLCAEVRDSYDYVIFDTPPICVVGDAAIVAS
FCDGALLVIENGVTKKKTLAQMKFEMDKVGANVIGVVQNMVGSKKDSSYYGKGNYGYYYGNYGNNQNKNKFTKAIVN
>gnl|bykdb|A0A416SCQ2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia sp. AF19-13LB] (length=472 residues).
MRRFQMGEYDRTGNGQNGEADWDLRSILCDMAKNWWIILLIACSAAMITYTVLTAVHRDQYTVKTTFAVMGRGENANAAS
SLSSTYEMTQKFQAILENNILKKKVMEELGCSSFPADMSASIVPESNLMELSVTADSPETAFRVLRSVLKNYTTISDYII
PNVVLETLQQPQVSDNPSNRIPTEKYAAMAFLAAALGTAALVGFFSFLRDTVKNETEFGRKIDADLLGTVYHEKKRKNSS
MLITNPARSFPYVESLKRIASRVRGRLDRRGGKVLLVTSVAENEGKSTLAANLALALSEEQNRVLLLDCDFRQPALYKIF
ELPQKAGKDFGQVAVGKESASSVFEKYKDTNVYMGICRERLEEPSEAVGGEIFRRILDTCRTNMDYIILDTPPMGAAADA
EELVELADGAVLAVRQDGVLTRDINDAIDALNQKEEKVIGCVFGNVYPGFGERIGGSYGYGYGYGAYSRAER
>gnl|bykdb|A0A416TGN7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia sp. AF19-1] (length=472 residues).
MRRFQMGEYDRTGNGQNGEADWDLRSILCDMAKNWWIILLIACSAAMITYTVLTAVHRDQYTVKTTFAVMGRGENANAAS
SLSSTYEMTQKFQAILENNILKKKVMEELGCSSFPADMSASIVPESNLMELSVTADSPETAFRVLRSVLKNYTTISDYII
PNVVLETLQQPQVSGNPSNRIPTEKYAAMAFLAAALGTAALVGFFSFLRDTVKNETEFGRKIDADLLGTVYHEKKRKNSS
MLITNPARSFPYVESLKRIASRVRGRLDRRGGKVLLVTSVAENEGKSTLAANLALALSEEQNRVLLLDCDFRQPALYKIF
ELPQKAGKDFGQVAVGKESASSVFEKYKDTNVYMGICRERLEEPSEAVGGEIFRRILDTCRTNMDYIILDTPPMGAAADA
EELVELADGAVLAVRQDGVLTRDINDAIDALNQKEEKVIGCVFGNVYPGFGERIGGSYGYGYGYGAYSRAER
>gnl|bykdb|A0A416U6I1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia sp. AF17-9LB] (length=467 residues).
MGEYDRTGNGQSSKTDWDLRSILCDIAKNWWVILLIACSAAMITYTVMATVHKDRYTVKTTFAVMGRGVDANAASSLSAT
YEMAQKFEAILENTILKKKVMEELSLSSFPAKMNDSIVPESNLMELSVTADSPEMAFRILKSVLNNYTSISDYIIPNVVL
ETLQQPQVSGVPSNQIPTKKYAATAFLAAALAMAALIGLFSFLRDTVKNEAEFTRKIDADLLGVVYHEKKKKNSSMLITN
PARSFLYVESLKRIASRVRGRLDRKGGKVLLVTSVAENEGKSTLAANLALALAEEQNRVLLLDCDFRQPALHKIFEIPEK
DGKDFGKVVLGKESASGVFEKHKDTNVYTGICRNRLEEPSLAIGGEIFHRILETCRTNMDYIILDTPPMGMTADAEELAE
YADAAVLSVRQDGALTRDINDAIDALNQKEEKVIGCVFGNVYPGFGERIGNSYGYGYGYGTYSRAER
>gnl|bykdb|A0A416Y441 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia sp. AF14-40] (length=472 residues).
MRRFQMGEYDRTGNGQNGEADWDLRSILCDMAKNWWIILLIACSAAMITYTVLTAVHRDQYTVKTTFAVMGRGENANAAS
SLSSTYEMTQKFQAILENNILKKKVMEELGCSSFPADMSASIVPESNLMELSVTADSPETAFRVLRSVLKNYTTISDYII
PNVVLETLQQPQVSGNPSNRIPTEKYAAMAFLAAALGTAALVGFFSFLRDTVKNETEFGRKIDADLLGTVYHEKKRKNSS
MLITNPARSFPYVESLKRIASRVRGRLDRRGGKVLLVTSVAENEGKSTLAANLALAISEEQNRVLLLDCDFRQPALYKIF
ELPQKAGKDFGQVAVGKESASSVFEKYKDTNVYMGICRERLEEPSEAVGGEIFRRILDTCRTNMDYIILDTPPMGAAADA
EELVELADGAVLAVRQDGVLTRDINDAIDALNQKEEKVIGCVFGNVYPGFGERIGGSYGYGYGYGAYSRAER
>gnl|bykdb|A0A416ZL97 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia sp. AM47-4] (length=467 residues).
MGEYDRTGNGQSSKTDWDLRSILCDIAKNWWVILLIACSVAMITYTVLTTVHKDRYTVKTTFAVMGRGVDANAASSLSAT
YEMAQKFEAILENTILKKKVMEELSLSSFPAKMNASIVPESNLMELSVTADSPEMAFRILKSVLNNYTSISDYIIPNVVL
ETLQQPQVSGVPSNQIPTKKYAATAFLAAALAMAALIGLFSFLRDTVKNEAEFTRKIDADLLGVVYHEKKKKNSSMLITN
PARSFLYVESLKRIASRVRGRLNRKGGKVLLVTSVAENEGKSTLAANLALALAEEQNRVLLLDCDFRQPALHKIFEIPEK
DGKDFGKVVLGKESASGVFEKHKDTNVYTGICRNRLEEPSLAIGGEIFHRILETCRTNMDYIILDTPPMGMTADAEELAE
YADAAVLSVRQDGALTRDINDAIDALNQKEEKVIGCVFGNVYPGFGERIGNSYGYGYGYGTYSRAER
>gnl|bykdb|A0A417CE88 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia sp. AM42-2] (length=472 residues).
MRRFQMGEYDRTGNGQNGEADWDLRSILCDMAKNWWIILLIACSAAMITYTVLTAVHRDQYTVKTTFAVMGRGENANAAS
SLSSTYEMTQKFQAILENNILKKKVMEELGCSSFPADMSASIVPESNLMELSVTADSPETAFRVLRSVLKNYTTISDYII
PNVVLETLQQPQVSGNPSNRIPTEKYAAMAFLAAALGTAALVGFFSFLRDTVKNETEFGRKIDADLLGTVYHEKKRKNSS
MLITNPARSFPYVESLKRIASRVRGRLDRRGGKVLLVTSVAENEGKSTLAANLALALSEEQNRVLLLDCDFRQPALYKIF
ELPQKAGKDFGQVAVGKESASSVFEKYKDTNVYMGICRERLEEPSEAVGGKIFRRILDTCRTNMDYIILDTPPMGAAADA
EELVELADGAVLAVRQDGVLTRDINDAIDALNQKEEKVIGCVFGNVYPGFGERIGGSYGYGYGYGAYSRAER
>gnl|bykdb|A0A417I9B9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia sp. AM28-10] (length=467 residues).
MGEYDRTGNGQSSKTDWDLRSILCDIAKNWWVILLIACSAAMITYTVMATVHKDRYTVKTTFAVMGRGVDANAASSLSAT
YEMAQKFEAILENTILKKKVMEELSLSSFPAKMNASIVPESNLMELSVTADSPEMAFRILKSVLNNYTSISDYIIPNVVL
ETLQQPQVSGVPSNQIPTKKYAATAFLAAALAMAALIGLFSFLRDTVKNEAEFTRKIDADLLGVVYHEKKKKNSSMLITN
PARSFLYVESLKRIASRVRGRLDRKGGKVLLVTSVAENEGKSTLAANLALALAEEQNRVLLLDCDFRQPALHKIFEIPEK
DGKDFGKVVLGKESASGVFEKHKDTNVYTGICRNRLEEPSLAIGGEIFHRILETCRTNMDYIILDTPPMGMTADAEELAE
YADAAVLSVRQDGVLTRDINDAIDALNQKEEKVIGCVFGNVYPGFGERIGNSYGYGYGYGTYSRAER
>gnl|bykdb|A0A417JMV2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lachnospiraceae bacterium AM26-1LB] (length=522 residues).
MSSDKRNISVNDYETNIDLYSILRDIWKYALVIMLLAASMSLLSYVYVGRNYHKQYESTSTFIVSSKGSNNSIYSDLSAT
SEMATKFSEILNSSILQKKVAKEMDMDYFPGSASAEVVNETNLLVLKVQADSPEMAFRLNKAIMNNYSVVTDQLIGNVVL
DVLQKPTVPSGPVNKFQPTALMKKTFLMTIVALCGLIAILSFLKDTVRKPKEVSRKLDAKLLQTLYHEKIYKTWKARIHR
KKSPVLLTNPGTSFQYVEDMKKLARKVSSKMKEKNAKTLLVASVEENEGKSTVAANLALALAEESEKVLLIDADLRKPSQ
YKIFGLDQEEIQQFGEVLNGNEQIDNLVTDLPKSELLLIAGSMIYPNSTEMIASPIFQKIVEFFKTKLDYIIIDTPPMSQ
AADAEELVDLADASILVVRQHTALVKDINETIGILNSAEGTMLGCVYNDVFHGVAQTARNYGYKYAYGSGYGYGSKYGYG
NHGYGYGYGYGYGYGYGSRTKKGNEDKTQESKTERQVKKDHE
>gnl|bykdb|A0A417MP97 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia sp. TF10-30] (length=467 residues).
MGEYDRTGNGQSSKTDWDLRSILCDIAKNWWVILLIACSAAMITYTVMATVHKDRYTVKTTFAVMGRGVDANAASSLSAT
YEMAQKFEAILENTILKKKVMEELSLSSFPAKMNASIVPESNLMELSVTADSPEMAFRILKSVLNNYTSISDYIIPNVVL
ETLQQPQVSGVPSNQIPTKKYAATAFLAAALAMAALIGLFSFLRDTVKNEAEFTRKIDADLLGVVYHEKKKKNSSMLITN
PARSFLYVESLKRIASRVRGRLDRKGGKVLLVTSVAENEGKSTLAANLALALAEEQNRVLLLDCDFRQPALHKIFEIPEK
DGKDFGKVVLGKESASGVFEKHKDTNVYTGICRNRLEEPSLAIGGEIFHRILETCRTNMDYIILDTPPMGMTADAEELAE
YADAAVLSVRQDGVLTRDINDAIDALNQKEEKVIGCVFGNVYPGFGERIGNSYGYGYGYGTYSRAER
>gnl|bykdb|A0A417SMF6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia sp. OM05-6] (length=472 residues).
MRRFQMGEYDRTGNGQNGEADWDLRSILCDMAKNWWIILLIACSAAMITYTVLTAVHRDQYTVKTTFAVMGRGENANAAS
SLSSTYEMTQKFQAILENNILKKKVMEELGCSSFPADMSASIVPESNLMELSVTADSPETAFRVLRSVLKNYTTISDYII
PNVVLETLQQPQVSGNPSNRIPTEKYAAMAFLAAALGTAALVGFFSFLRDTVKNETEFGRKIDADLLGTVYHEKKRKNSS
MLITNPARSFPYVESLKRIASRVRGRLDRRGGKVLLVTSVAENEGKSTLAANLALALSEEQNRVLLLDCDFRQPALYKIF
ELPQKAGKDFGQVAVGKESASSVFEKYKDTNVYMGICRERLEEPSEAVGGEIFRRILDTCRTNMDYIILDTPPMGAAADA
EELVELADGAVLAVRQDGVLTRDINDAIDALNQKEEKVIGCVFGNVYPGFGERIGGSYGYGYGYGAYSRAER
>gnl|bykdb|A0A417T0L2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus sp. OM05-10BH] (length=506 residues).
MAERDLYSKNNQNLSRRIDEDDVIDLGALFWNVIQGILRFWWLIIFLAAVGAGAFYLRATSLFYTPMYQSSATFTVLTGG
STDSENSTYNFYYDTTTAGQLAKTFPYILSSTLLTEAIEEDLGVDAVNGSISAQAVSNSNMITMTVTSNSAEDAKAILES
AIKVYPDVARFVIGDTKFNMIDEPSTPTEPYNRPSYRGQIKKGAVYGAGAGFLLICLYAFFKKTVQKPEELKSVMSLSCI
ANIPEVSRKLRKKQTTRWIQMQDSRTPQAFRENIQSLQIRISRELEEKGGKVLVLTSTMPGEGKSTLAYNLAIAAASHGV
KVLFIDADLRKQADRKHLTEEKGRGLASVVAGKCTLKEAVYREKETGVDFLGGNKPVKGVQQILNHSHFHEVMEEMKAQW
DLILLDAPPVEMFEDASILAEQSDGILYVIRYDQVQKRRILDSISGLEDSKAPLLGYVFNGVPVHRGGYGYYGYGRYGYG
YYGYGSYGYGKKQESKKKNDTEELQS
>gnl|bykdb|A0A417UUA3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lachnospiraceae bacterium OM02-26] (length=520 residues).
MSSDKRNISVNDYEMNIDLYSILRDIWKYAIVILLLAASMSLLSYVYVGRNYHKQYESTSTFIVSSKGSNNSVYSDLSAT
SEMATKFSEILNSSILQKKVAKEMDMDYFPGSASAEVVNETNLLVLKVQADSPEMAFRLNKAIMNNYSVVTDQLIGNVVL
DVLQKPTVPSGPVNKFQPTALMKKTFFTTIVALCGLIAILSFLKDTVRKPKEVSRKLDAKLLQTLYHEKIYKTWKARIHR
KKSPVLLTNPGTSFQYVEDMKKLARKVSSKMKEKNAKTLLVASVEENEGKSTVAANLALALAEESEKVLLIDADLRKPSQ
YKIFGLDQEEIQQFGEVLNGNEQIDNLVTDLPKSELLLIAGSMIYPNSTEMIASPIFQKIVEFFKTKLDYIIIDTPPMSQ
AADAEELVDLADASILVVRQHTALVKDINETISILNSAEGTMLGCVYNDVFHGVAQTARNYGYKYAYGSGYGYGSKYGYG
NHGYGYGYGYGYGYGSRTKKGNEDKTQESKTERQVKKDHE
>gnl|bykdb|A0A417WQF8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia sp. OF09-25XD] (length=467 residues).
MGEYDRTGNGQSSKTDWDLRSILCDIAKNWWVILLIACSAAMITYTVMATVHKDRYTVKTTFAVMGRGVDANAASSLSAT
YEMAQKFEAILENTILKKKVMEELSLSSFPAKMNASIVPESNLMELSVTADSPEMAFRILKSVLNNYTSISDYIIPNVVL
ETLQQPQVSGVPSNQIPTKKYAATAFLAAALAMAALIGLFSFLRDTVKNEAEFTRKIDADLLGVVYHEKKKKNSSMLITN
PARSFLYVESLKRIASRVRGRLDRKGGKVLLVTSVAENEGKSTLAANLALALAEEQNRVLLLDCDFRQPALHKIFEIPEK
DGKDFGKVVLGKESASGVFEKHKDTNVYTGICRNRLEEPSLAIGGEIFHRILETCRTNMDYIILDTPPMGMTADAEELAE
YADAAVLSVRQDGVLTRDINDAIDALNQKEEKVIGCVFGNVYPGFGERIGNSYGYGYGYGTYSRAER
>gnl|bykdb|A3DF66 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium thermocellum] (length=464 residues).
MEKDDILEIDLREIVYILLKKWYLIVLCFVLSAGTAFVVTQFYIKPVYKAETTLFLGKEKDQVSLSFSDIQVNNQLVVDY
REILQSRRVAEIINQKFGVGIQEFQKNVNVKTVKDSRLFSISYEDTDPKRAADIVNELATVIQKMADEIIQVKNIKVIDT
AKIPENPIKPNKKMNICVAGLFGLVLGIGLIFLLELIDHTFKKPEEVEKMLGINVIGTIPAFDGGKRGKKKAKDEKELQE
QYLKNLIVHNNPKSATAEAFRELRTNLYYSSVDSEVKTIVVTSPTLGDGKTVTAVNLAITLARSGKKVLVIDADLRKPKV
HHYFGVKNKEGLTNLLTDSKEEVKIKTTERSDISNLYIITSGPIPPNPAEMLNSNRMKSLLEKVREEYDIVIIDTPPVGQ
VTDAAILAGITDGVILVLASGQTRIEMAKRAFKSLESVKARFIGAVLTKLDTERTGYYYSYKYE
>gnl|bykdb|A5ZNE7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia obeum ATCC 29174] (length=467 residues).
MEERIDNETVQQIDLISMLKDIGREWLTILLLAIAAALFADIWICATYQPEYRTSTTFVVTAKGMNNNIYQNLNSTKELA
GQFTEILGSNVLKKKVAQDLGVNSLEVETSVDLVPETNLITLSVKAGTAAESYRILQSVMENYNTVSDYAIKNVIIETIQ
QPSVAMAPINPLDEKRTVMKVFAVAAGCLIALLAGISYIRDTIKNPGEVSTKLDTRLLGTIAYEKKSKALSMKRKKDYLS
MLIQNPLRSFAYVESSKMAASRVRSYMDKEDAKVLLVTSVMENEGKSTVAANLALSLAQEGSRVMLIDCDFRKPAQYKIF
NVRDNEETDLGDVLINHASTEKIIRNWNNSGLYMILNKTSSNAIETLLKSMTLKQIIAFCREKMDYVVIDTSPLALVADT
EELAQMTDASVLVVRQDTVLTKDINDAIDILNNTRGKVLGCILNGVTSQNMAGSGHYGCGGHYGKRA
>gnl|bykdb|A6BH65 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Dorea longicatena DSM 13814] (length=482 residues).
MESSNRNDMPVFMDNDLDPYTLVHDIVSNWWVIILGAIAGALLTYVVVSSRYVPEYTTQATFVVSSRGDANAYSNLSSAN
TMAKTFEKILKSNIMEKKICEKLKVEELDADIHAKVLEGTNMLVLSVTADTPKESIDIIRTVMDNYSSVSLYTVGSAVMD
VLEEPKIPYTPDNPLDAGRQAKKGGLVAGALVLILLGMFSYMKNTIKQENEIEKKLDARSLGAISYEWKYKTIRDIFRRK
KKAILVDDPVASFRFVESYKKLAAKVEYRMAKNEQKVLVVTSVSENEGKSTVAANLAITLAEQSKRVLLVDGDIRRPSQF
LIFGMEPKEENELGEYLRGNGSLADVMVPCTRKHMLFMGGKNCYSSSTEMLNSDSFYKLMTACRKFVDYVIIDTPPAGII
GDAQIFAHCADAVMIVAKQNYMLAEDINEVMDAFRDKEGKVLGVVLNGVRSFSGLVDSPVGHYYGKYSKYGRYGNYGRSK
GM
>gnl|bykdb|A6CLL4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. SG-1] (length=454 residues).
MNQSLTLKELFQILQNHFWLILSIIFLVTASGIILSLSLPKEYEAKVDLLVNYSPENNQGSLSVGEVETNLRLISTYKYI
LKSPRVLEIVAERTEENDNVQCLNEQISVTSSSDSQIISITATALNPNQAVDIVNNTAETFKEETYNLMQIDNIQILSYA
QEQDSTTPVKPSLILSAGISFTIGIFLAILIVFIREAFFTKLNNQEKVERMLNAPYLGSVPKLPPQSNLNNKHSPNNTYS
KFLISSSEANSPAMELYREIRTNIQFLLKKEKTKVLLVTSSGASEGKSLTTGNLAISMAMDGVKTVVIDMDLRKGVGSQL
FHLPSKKGISNYLHGITPLNEIIQRTDIPKLFFISAGPLPPNPTELLSSDRLSSMINTLKKEVDLILIDTPPLIVSDAAV
LSSRVDGCLFLINARKTRMETAKKNLNKLNRVGANIIGVILNKTKKEKSQTYYY
>gnl|bykdb|A9KN92 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Lachnoclostridium phytofermentans] (length=482 residues).
MQNNNNDIEINLGEIFILLLHKIWIIVLSSIVCAVAAGLISKFVMTPVYTSDTKLYIINRQNKDTITSSDLQTGSQLTQD
FKVMVLSRPVTEQVISKLNLNMTHDELVSNINVKVPENTRILEITVQNQDPLLAKQLADSIAEVASERMVSVLEMEKVNI
VEEGNIPTIPTSPHIMKNTILSGIIGALISAFVIIFIHIIDDSIKNAEQIEKYLGLTVLGTIPLELKNSNKRGKNKKAYK
RKKGDTNNEHSSIQKATLEFTINEAYKSLRTNIQFCGKDIKTICITSSLPNEGKTVVSFRLATAFADSGKKVLFIDADLR
KSVIISKLKIDNAVNGLSQYISGMNSLEEVIHKSNVENRDIIFTGILPPNPSEMLGSEEFKNLVKNLRDEYDYIIIDTPP
LGVVIDSANVADICDGTIMVIESNKISYRFAQRVLKQLITEKSKVLGAVLNKANIYGVGYNKKYYGKYYSHVYANDYDEN
GN
>gnl|bykdb|B0P408 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. SS2/1] (length=522 residues).
MSSDKRNISVNDYEMNIDLYSILRDIWKYALVILLLAASMSLLSYVYVGRNYHKQYESTSTFIVSSKGSNNSVYSDLSAT
SEMATKFSEILNSSILQKKVAKEMDMDYFPGSASAEVVNETNLLVLKVQADSPEMAFRLNKAIMNNYSVVTDQLIGNVVL
DVLQKPTVPSGPVNKFQPTALMKKTFFTTIVALCGLIAILSFLKDTVRKPKEVSRKLDAKLLQTLYHEKIYKTWKARIHR
KKSPVLLTNPGTSFQYVEDMKKLARKVSSKMKEKNAKTLLVASVEENEGKSTVAANLALALAEESEKVLLIDADLRKPSQ
YKIFGLNQEEIQQFGEVLNGNEQIDNLVTDLPKSELLLIAGSMIYPNSTEMIASPIFQKIVEFFKTKLDYIIIDTPPMSQ
AADAEELVDLADASILVVRQHTALVKDINETISILNSAEGTMLGCVYNDVFHGVAQTARNYGYKYAYGSGYGYGNKYGYG
NHGYGYGYGYGYGYGYGSRTKKGNEDKTQESKTERQVKKDHE
>gnl|bykdb|B1C231 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Clostridium] spiroforme DSM 1552] (length=498 residues).
MTMVIVIMIIKPIDMKVGDIMDEQRLKESMMEDDSIEIDLSELIHDFLKILKDYWGVFLGTIVICTIAFSTFRYLTYTPI
YRCEATFTVATDSENTGSYSYYYSQNTADQLSKTFPYILDSSYFRSILLDELGVNSLNGTLSASTVSESNIVTMGVESNS
PQDAMSILTSAIEIYPDVARFVLGQIQFHMINNPQLPTDPYNKLTFTNTVLVGGIIGLVSGTIILGCMALFRKTVKNPED
MKRITNLNCMATIPQVKFKARKIHKQTRISINDRRISFAFKENMRSLQIRLERVFKKEEHKVIVVTSTAANEGKTTLTIN
LAETFAANGKRVLLIDADLRRQSIAKILKCDNNEGLVDLYLQKGDVLKNIRKLDNSKFWFIGNDKPINNPVSVLSHPDFK
KFIEKMKKEFDYVIIDTPPCGIFQDVTLIQEYSDALLYVVKYDFLPYQKIQNGLSILKEDCCFMGYVFNIYTKKSSEYGH
YSYGYNQYRYSKGGEYKE
>gnl|bykdb|B1C232 [Bacteria] Bacterial tyrosine kinase [Firmicutes][[Clostridium] spiroforme DSM 1552] (length=465 residues).
MNQDEINLDSINYRGIIRDLLKNWWIIVLIVISLYLAATGIGKLVYIPEYTVSTTLVVNAQGTSDTYTSLAMANEMADII
KEVFQSDVLLELVENEIGKTNQGTITCNQIQETNLLVLNVTSKDPQNAYQFMNSALKHYDEVSDYVFTNATLQVLQEPSI
PTTPSNSSRLINYRNYIALLGGVAVAGIIVCLYLFRHTLKSSENATKLLDGRVVGVIPYEKKKRNKHLKKSKQSLLISSP
IASMNFVEANGRMSSRIEHNFDKHNFKVLLVTGTGENEGKSTVAANICLSFVEKNKKVLLIDGDFRKPAQYKIFDKEVLD
TNPLQDVITGKATLKESIYFNKKSNIYELFLYHAVDDPSKLMDVITLKKIIDQLKEQFDYIIIDCSPISVSVDAEVWMEV
VDSTILLVRQDWTDIRIINDTVDLIWQSDCDFIGFALNMFIDDEIRHNDYGYSYYDYKTHRHESR
>gnl|bykdb|B5CSZ7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus lactaris ATCC 29176] (length=474 residues).
MRGGNMSQESYKSQSLDSQIDLRYIFRTLKKNAVFILMCVCLTGMFSYVILDHSLKDTYTVSVNLCVIPRDNTSEKLAET
NIENALERSVNVLNSDTMRDQIMKASGSSRVKGNLSASVVADTNIIRMSASGTNAESAYKLLKGALQQYPELSDYFESGY
VLQPLSSISANNVQKTEKATLRYSLLLILLVLAGGIGATVCLCIFTDKIHSMEQAKRLLDIPMIGSLDYVKKKSGQKALL
ISDQDTDHVYEEAVDRIVTSIRSEMSAEGYKTLMVGSIKENDGKSTVTANIALNLARRGKKVVLVDCDMRHPSLAKIFDA
TVDPKEQFSEYLLGKCELDQVLKQTEVQAHPMDCIWQKKAVAKPYRLLGSERFISLINQLKEQFDYVVMDTPPLELIRDA
EIISETADAMLMVMRQDEVHAVAVNDTVDLLEENGVTVIGGVLNMTKGERDTSKDRDGYRKYYNENAKIENAGE
>gnl|bykdb|C0CIK6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia hydrogenotrophica] (length=488 residues).
MTVDERLEDREELEIDLGILLWNFLQGLARFWWLVILLAALGSAAYYVKNSQFYTPMYQSVASFTVMTGGNSENGQEEGS
YNFYYDTTTAGQLAKTFPYILGSSLLTDAIKEDLGVDSINGSISAQAVSDSNLITMTVTSSDPQDAKAILESAIKVYPEV
SRFVIGETKFNMIDVPTAPKEPYNQPNFVKKAVKGALLGAAAGIFLIVLYAFFRKTVQTPDELKNVMSLPCLGNLPEMKQ
KARKKKRRRDISILNKEFSQRFKESLLSIELKAERELQDKNGKILLVTSTISGEGKSTVALNMAYAAALHEKKVLFIDAD
LRKQTDRRCLTETEGKGLYGVVTGKCSLEKAVEKDGRSGISFLCGSLPVRNVPAVLNRPEFQETLRRVRGEYDLVILDSP
PAEMFEDASLMAEFSDGICYVIRHDFVQKRRILESLAGLESSGTTILGYAFNGVPLHKGRYGYYGYGRYGYGYYGKYGYG
EQDEETQS
>gnl|bykdb|D4LC36 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus champanellensis] (length=499 residues).
MKKEYTIKDLVYLMLGRIWWIIGAALICGLGAFLISDFAIPRKYQSNVSMYVRNKEDQKQDINNSDLSVSKSLVSTYIVI
LNNDAVMEQVGEQLLKQHTPEELSGNFTIKNGKITNESLKSAFTMAAVNNTEVLKITATTKNAALSAELCNIMADVAPEV
LIRVVGAGSVEKIGDAKIYEAAVSPSVTKNTAIGFAGGALLAILVILLIDFFDNTVRGTEELREHFSKPIIAEIQSIGGK
AKKKNRGTDADRKTRLLFGNENIPFSTVEAYKSFRTALSFVISTCDSRIVAMTSANPSEGKSVTVANLAVAVAQTDKKVL
LIDADMRKPVQHKCFRLSNKVGLSDVITGDKPLDKALNRNVTGSLDVLTSGTIPPNPSELLASRQMKELLETLKERYDMI
LIDCAPINVVSDVAGLSQEIAGVVMVVHYGFTTYPELDDAVNRLALANCNVLGFAVNEVSSKHGSGYYSNYKYKYKYKYD
YQYGSAKQAEEKEKAGSAC
>gnl|bykdb|D4MV82 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Anaerostipes hadrus] (length=522 residues).
MSSDKRNISVNDYEMNIDLYSILRDIWKYALVILLLAASMSLLSYVYVGRNYHKQYESTSTFIVSSKGSNNSVYSDLSAT
SEMATKFSEILNSSILQKKVAKEMDMDYFPGSASAEVVNETNLLVLKVQADSPEMAFRLNKAIMNNYSVVTDQLIGNVVL
DVLQKPTVPSGPVNKFQPTALMKKTFFTTIVALCGLIAILSFLKDTVRKPKEVSRKLDAKLLQTLYHEKIYKTWKARIHR
KKSPVLLTNPGTSFQYVEDMKKLARKVSSKMKEKNAKTLLVASVEENEGKSTVAANLALALAEESEKVLLIDADLRKPSQ
YKIFGLNQEEIQQFGEVLNGNEQIDNLVTDLPKSELLLIAGSMIYPNSTEMIASPIFQKIVEFFKTKLDYIIIDTPPMSQ
AADAEELVDLADASILVVRQHTALVKDINETISILNSAEGTMLGCVYNDVFHGVAQTARNYGYKYAYGSGYGYGNKYGYG
NHGYGYGYGYGYGYGYGSRTKKGNEDKTQESKTERQVKKDHE
>gnl|bykdb|G7M1U2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. DL-VIII] (length=459 residues).
MDSETISIEEIFQILKKKWKLVIILPLITTAISIFYSFYIVKPQYEACTKVFVGKETADKEKYDNNDVEMYQKLLKTYSE
LAKTNTLVSKALKEHNIDLQSSAVLNALTTIPTANTQILEIRYINLNKSLAKDTVSAITDEFIKETQELIPDSTVKVIED
VVISETLTSSKKRMYVAIGFIIGLMLSFGIIFLIEFLDYTFKDKEKLERIVQLPTFGIIPDDTKVRKIKNHITLIVEKKP
KSIVAEAYRTLITNILYSESEKTIKTILVTSSKLQEGKSTVAGNLALSFAENDKKVIIVDCDLRKPSLHEKFNISNTSGL
SDVILKRDSLDNVIQKHNKNLYVISSGKFTEKPASMLASQTMDDILTELNQKYDIILLDSPPAQAVTDAQILSSKVDCTL
IVIRSGLTNAKSVLETKSLLTKVSGLVIGTVLHRTEYNKDTYYYRSHGSSNKTTRSLLG
>gnl|bykdb|G8LSN0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium clariflavum] (length=466 residues).
MGKNDYIEIDIREILIVLLKRWYLIAICFILATGSSFAITKFYLKPVYRAQTTLFLGKESDKVASLSIADIQVNNQLVSD
YRELLKSNLVAESIEKKLGVSAAKFKRSVNVQTVKDSRIFSISYEDTDPKLAADVVNELALVIKQLASDVIQVKNVSIID
VAKVPERPVGPSAKKNVGIAGILGLALAAGLIYLLEIMDYTFKKPEDVERQMELTVIGAVPKFEGGKRGKNEKKDSKENE
RDYLKNLITKNDPKAPASEAFREIRTNLHYKSVDKELKTIVITSPALGDGKTVTSVNMAVTLAKSGKKVLLIDSDLRKPK
VHLYFGIPNEKGLTNIIKGDIEDKDINVLELKDIPNLSVITSGPIPPNPAEILSSNKMQNLLEDLRGNYDFILLDTPPVG
QVTDAAILAGIADGTIMVFACSQTRIDMAKRAKKALESVGSNILGTVLTKLDIGRARYYSYNYEYK
>gnl|bykdb|R5B467 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Firmicutes bacterium CAG:103] (length=484 residues).
MNEQRQGHTIDLAELLGRFARSLRRLWWLCLALIVLCAAASGGYARLSYRPQYTASMTFLVNAGGTSQSGSAASTATAAQ
MAKTFPYILTSGLLDSAVRADTGLATLPAISATSEEGTNLCTLSVTGSDAQQCYDVLQSVIVHYPDVAELVVGPTELVMM
DQTGVPTQPSNPFSWRHSLVRGALIGAVLSLLVLYLSGRARATVMNRDDLQQATSARYLGALPAVRVKKRSRTTPAALPE
EMARSSAYCEAMRIVAMRVDKAMQHHAYRTLLVSSAAPGEGKTTFVCQLALALVRQGRHVLVIDCDLRNPSVHKTLGRPA
QTGLAEYLAGTAKPGQIVTALGKDKPDVIFAGRRAGAQTEQLGSAAFHTLLHDLREHYDVVLLDTPPCAVMTDALETGAA
TDCALLVVRQDASSRVSVINSLAALDALGVPVLGYTLNACAGRSHGGYGYGFGYGYGGYGYGYGYGGYGYGYGSGENRER
NGAD
>gnl|bykdb|R5EFZ0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Firmicutes bacterium CAG:110] (length=480 residues).
MENTSKSNMQSARLLPFDPIVLVQDVLKRWLVVVLAALAVGIGTYIYTDATYAPVYRTTTTFVVTTRGSSTSVYSNLSST
SNLAGLFTELLNSSIMRKTILQETDISSFDGTIDTAVVPNTNLITMTVTDSDPRMAFLAAQAIIEHHESLTYQVIDDIGL
EVLQYPAVPTSPTNQNFAFHQMKKAAVIAALAATALLAILSYLRDAVRSGTEAREKLDCSYLGEISHERKYKTVFALLRR
KKTSILITNPVTSFRFVESIRKLRRRVEQHMDGGKVLIVTSLLENEGKSTVTVNLALAMEQKGKRVLLIDCDLRKPACGM
VLGQSKFTYGLNDILGGKENLSECFLRYQNSDMYMLLAKRGEQNTGDLLISPRMNALLDWARECFDFIVLDLPPMSAASD
AEGMADLADASLLVVRQNAAAAPALNNAVASLDGHKAKVLGCVLNNVYATQLSTGQSYGGYSKYSHYGHYGNYGSSGSRK
>gnl|bykdb|R5ETF9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Firmicutes bacterium CAG:110] (length=480 residues).
MEIEKTEQQGRDTFVLLDDFLHQAKRMWLLGLALILICAAGLTFVQRRAYRPVYEASASFTVRVANPLYASVSSYNEKTA
QVMADTFPSILTSGLLQRRVMDELGIDEVPDMSVSATAHSSILTLKVRDTDPQRAYDVMSAVIACYPEVAEFVVGSTVLV
LLDESGMPTAPVAEFNYRYYITCGAVVGAAVWCVILAFLVLMKNTVHNEDELRETLNAPCLGQIPAVKISRKRPYPLLHR
YRSESGFSESVRLLRLRVEKAMQENGQKILLVSSAIPGEGKTTVSVNLAVSLAQKGRRVLLIDCDFRNPSVAKTLSSKSH
PLDEGRNLTNFTGSGEAAGALAQATDVEGLFVIVGNADGKADYFDVPTQARLTKLIRYARDKYDYVILDTPPCSLLTDAA
EAAEAAEAGLMVIRQDYASRDQILDGAQRLSDSRLPIIGCALNNVRKSLSGSKEYGYGYGYGYGYGYGYGYGSKSRQEKK
>gnl|bykdb|R5MNF0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Eubacterium sp. CAG:180] (length=488 residues).
MAYSSSGKTHVEESDNLDSVVIYLKKILQHWKIVVISAVVLAVLGFAVAKLTYTPSYSSKITFIANNKSSALAVSGQTQS
DLNASATLAESFKYVFTTTELSKRVADNSGFKDISVLDIKNWVSVEAVEDTAIINLTVTTPNADVSYGIANAYVNNYESA
INAAFPSTTLTVIDPPLLASAPNRDASARNYTIVGFAAGLVISIFAIVLAVIAKDTVKTADDVKDKLGVDVIGMVAHVNR
KKKKKGEDYKPLLISDSRSGFPFIETFKIIRTKIEHTAQREKYKTFVVTSTAENEGKTTSAVNIALALAQNGKSVLLVDG
DLRKPAVAKLLGINASEDGGVYGVINGEKTLAEAIKYSEKYNLFLLVSGKPVFDPSELLSTDAMSDIIKSAEKEFDYIII
DTAPCGVVADASILSSYADGILLVVRNDMVASRRIKRAVENLENSGTKLVGCIYNDTESGMPNRFMSSYNKKYGYGYGYG
YGYGSNQK
>gnl|bykdb|R5V506 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus sp. CAG:254] (length=534 residues).
MGTLNQKNKNKQDDETEIDLGKLFKALMQRLPIILLVTLCFSAIGFSYGKYYLPLEYTSSTYMYVKNGDTSEEKTAINQQ
DLMASKSLVETYIVILKNDTVVKQVGMSLVSKFGVSEISKCFTVKNGVISTSELKDAISMSADGDTEVLKISAQTKDPHV
SAEICDIYAEVAPTFLIRIIGAGSVEVIGDAEIPQSPSAPDVKKITMMAAAAGFVLSAGVAVLIYLLDRTIKGEDDIQSF
SISYLGEVPEMVEARSGKRKRRKKKNSPSALRNMLLCAKDIPFPCSEAYRSIRTNLMFALAPQEHKIVAVTSPNAADGKS
LTAANIAMAMAMMNKKVLFIDADLRKPVQHQRLKLENKVGLSEVLGHMTTWQVARHLAPLPNMDVLTAGTCPPNPSELLA
SPAMKKLLEEAEQQYDYIIIDTPPVNVVSDALGLSDCIGGILMVARYYVTTTKELETALQAISVTGATVLGLVLTEVDFK
QGGYYKKYYKKGSYYTYGNGNGNGSKKKSHSHSTQQSEPVSTTTDTDSDKQPVS
>gnl|bykdb|R5YGY6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus sp. CAG:488] (length=482 residues).
MKSYSDRKNSKGIEINILAFFKELSKKLWIVAIIAVIGATIGGVIGEATKSETYTSTVSFVVNSATENGQVSSGEINAQI
NMAGTFSYILSSRALKEAIVEKCPEKVNFGTVDKSISVNVVSSTNVIVMSVTTGDPKISYAIASTVVDVYGDIVTERYPN
AKLTLCDTPVLPTYPNSNRSVVSLALMIGFIAAVASCVVFFIMFLVKDTAKTADELSEKLDVHILGSVQQITNKNKTAKG
LLVTDRKNGFSFIETYKSIRTKIENNSTRTGNKVFLVTSACENEGKTTSCVNIALSIAQNGKNVLIIDADLRKPSVSKML
SLPTTEYGLSDVILGNVELNQAIKRVTSFNVCVLADQKGVNNPSELLSTEKMESIIEEARKEFDYVLIDTAPASVVTDTS
VIAGFVDAAIIVVREDFSPYSRIRMSIEDIDSNGAEIIGCIFNADTSNLSKTSRYGRRYGGYGKRYGYGSYGYGYGQSSS
KK
>gnl|bykdb|R5YI67 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. CAG:571] (length=460 residues).
MEEIDLRDLLKLFWKRKAIILLTTMAFLFIGYVYNAFVTTPQYKSATTLILVKAENSGTTTNDVTLNQKLVYTYSELVKS
DSVLNEVISRVQLDKTTAQLRKNVTIESVKNTEIIKISVQDSNKDEAPIIANSIAEVFSEQIKEIYNMENIRVVDKAVAP
SAPSNINPVKYAGVFAVVGFALSIGVILILNLFDSTVKNDKDIEKALNIKTLATFARNPNIKQGLIDLDPKSQCAEGFKS
LRTNLQFMNGSEGLKSVLITSALPGAGKSWVATNLAITFARGGYRTILVDADMRKGIQHKKFRLNQVPGLSDFLSSSSEN
LEEELQKCIQPTELDNLCVLTCGSITYDSSELLLSNKIIKAVEILKKNCDIVIFDATPSNLVTDAIVLSRLVDTSFIVTE
HEKTQIEDIEKIKTQIEDVGGNIAGIVINKVQDEKSSKGNYYYMNEEDIKRKKRKRSEHH
>gnl|bykdb|R6DNR8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus sp. CAG:563] (length=484 residues).
MKSYSERKSSKGLEINILAFFKELSKKLWIVAIVAFIGAAIGGFVGHATRQETYTSTVSFVVNSATEAGQTSSGEINAQI
NMAGTFSYILSSRALKEAIVEKCPEKLNYSTVDKSISVSVVSSTNVIVMSVTTGDPKIAYAIASTVVDVYGDIVSERYPN
AKLTLCDKPVLSTAPNSNRSVVSLALMVGFISAIACCVVFFIMFLVKDTAKTADELSEKLDVHILGSVQQITNKNKTAKG
LLVTDRKNGFSFIETYKAIRTKIENNSTKTGNKVYLVTSACENEGKTTSCVNIALSLAQNGKNVLIIDADLRKPSVSKML
SLQDTEEGLSDVILGKADLGKAIKSVNSFNVCVLADQKGVNNPSELLSTEKMESIIEEVRKAFDFVLIDTAPASVVTDTS
VIAGFVDAAIVVVREDFAPYSRIRMSIEDIDSNGAEIIGCIFNADTSNLSKSSRYGRRYGHYGKSGRYGYGYGSYGYGYG
QSKK
>gnl|bykdb|R6HPC1 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Oscillibacter sp. CAG:241] (length=498 residues).
MDEKNRGLQWSHIEPYCLVRTLLRQLWMLLLAAAACAMAAWIVLSCFVTRQYTSSTTFAVTARASTLYYTNITAAADMAA
SYSQLLQSRVLRQTMEQNLGMSLDGTVSAQQLGETNLIRVTVTADTPRQALVLLKAVSDNYGTLSAHVSSTAVLSQLNAP
TLSVAPSRSYNVPKICLLAGVIGAGLTAAAVAWASVTSGTVQTQEGARSDLDAKLISTVPHEGRRTRKLLGWMDDRWERR
SRRGGKRLRRNLNISSPAISFAFTESIHRIAEKFQHEHAKGRRVFLFSSVSAAEGKSTLAANTAISLASRGVSVLFIDLD
LRRPVQSEMLGLPVKQKNELGTLLSESAAPEKILSAAVTDPSTGLHSLLSTKSYTDVIELLASDQLAKVVALAREQYDYV
IIDSPPLGFFSDSELLSDLSDASVLVVRQDTVPAPEINDAIDALRAGKAEFLGCILNDMAHLTAYSAGYGYGYGYYGYGY
GKKYDKYGYGHRSGQKQQ
>gnl|bykdb|R6HZX3 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Firmicutes bacterium CAG:137] (length=504 residues).
MQEHSYEHNTDQKVDLELIFRNFLHVLKRTWWWVTLLAILVGALRYVQAQRSFVPQYTATASFSVKSGYVGTTDLVDSTQ
YYDNQAAEQVVSSFPYIICSEAMQERICLALNTSWINGTVTASSIGETNIFTLTVTSTNPQDAYDILNAVIQNYPQVASF
VIGGTQLSMIEEPQVPTVPVNTFRGSRSAAKGVAAGLLLGLALTLLMAIGRKTVRTADDLKRSTSVPCMGTIPAIQVKRR
RKAAGSGVSILNPHLGDTLSVPIGALQVRLLRSQPAGGTGRIILITSTMPGEGKTTVSFNLAASLAQSGKRVILVDADLR
HQVVKARFGITTPSAGLLELSRAAKPDIARVLIPVPGVANLSLLAGDTRMTSPMGILDSPKMRSLLERTRTLADYVIIDA
PPAGLLADAAVLCRSADQVLYVVRYDSFARNQVADAMHSVSGRGAELTGYVINGRPTRRGRGYGYGYDRYGYGKYGYGTK
YGYGKNGSRKQDNAHRSSGDLGRG
>gnl|bykdb|R6I3L7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus sp. CAG:177] (length=507 residues).
MSKIVRKDTNSDGVEVNIMYAFGLLLRRLWLLILVALVVGASCAVITKAVEEPTYTLSMTFIVNNKSEKDLSSSGENSVS
YNDMSASAYMANTFVHLMTGRTMCNAIAAECKSYPKTADQVAKMIAVSRKTDSSIIDMTVTASSPEEAYELAQAVKDTYK
DVVRVYSGGSIHLCDEPELPTKPDKSVGTVRNAIIGALAGAVICALIIIIRDSARNTVRSQEDIQNKLQLNVIGEVSQVP
SGERFYKKSAHGDRELLITDKACGFAFVETYKAMRTKLELLNGRRGYKSFVVSSTGANEGKTTVAVNLSLALAQNGYSVL
LVDADLRKPSVLKNLGISNLSGNGIADVVNGEKNSSDAIKYIEKYKMFVLAGDESITDPTEMLSNAKTGEFIAAAREKFD
YIIIDTPPIGIVADAAICAKYTDSSIFVIREDVFPVPAILEAVSDLTQGGTDLAGCVYNISTDRSKGGYGNYSISRRGYG
YGYGYGKHYGYGYGYGSHSGSHGKNSK
>gnl|bykdb|R6T4X7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus sp. CAG:57] (length=497 residues).
MKKNYTIKDLLVLLLGKVWYIVAASIVCAILALFVSKFVMSKQYQSHVSMYVKSADNQSTGQDKTNVDLQDINASKSLVQ
TYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTVTSGRVSNDGLRNAYSMTAVNQTEVLQITATTTNAKLSSDLCNIMAD
VAPSFLIRVIGAGSVEKIGDAEVYNTPVSPNTTKNVALGFVGGLMVAVLVILVIDFFDNTVKNSDELGDIYQKPIVGEIM
NIGGKTSKKDEGSSADRKKQLLFNNKDIPFNIVENYKTMRTNLMFTLSTTRNKIVVVSSPNPSEGKSVTVANLAASMAET
ENKVLLIDADMRRPVQHRNFKLKNNVGLSTILSGESTFDKCVHETKNGNFAVLTSGVLPPNPSELLASEKMRELLEYVQH
KYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKLEIGDCNLLGFVLNDISAKNGSHYGYKYSYKY
KYDYSYKYGGKDTSAES
>gnl|bykdb|R6UHV6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. CAG:964] (length=489 residues).
MNNSQDDLKAQDDLKEQDANYSFDLASTLQDLTKRWFVILLSGIIAAIGCFITATQLYSPQYMTSTTLLVQSKNNTESAY
NNLTATNKMAGVFKNILDSSQLQNSAARQLGYTSFPGNLSCSVIEETNILSFTVTSDSPIKSYRLLKAVLECYPQFTKNV
VSSIVLQTLEEPVVPTEPTNPSNALKLAVIGFFAGAAAVVLIISVLSFYKDTVKKESDINKKLITQRLVSIPTQKKRLSV
REKVKGIKRPLSITNPVISFEFREAFKRLRQKIVSDSKTHHNKVYAVTSSLENEGKTTVAVNLALSLAKMDYKVLLIDGD
LRKPAVAKFLEAKITNGKSIIDFLRGKARLSEIASYDEINNITIMGSNKGTQQANELITGEKMDYLISAAREQYDYIIID
TPPLCFVSDAEDILTLSDSSLIVVRRNVANALSINDTIDIILASGVKLMGCVYNDAENVSIVGRGSVYSDYQYGKYGYGK
YGKYGSTAE
>gnl|bykdb|R6VAT5 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. CAG:964] (length=511 residues).
MEKKFVPENSRSYTPVGEYASKILTGIKKHWYIIAVLAGICCVGFTLYSYAAYTPQYTAAATFTVTPKGDSLSAYTSISS
NASTQQLEKTFPYIITSAPLTRVVAEDLGLSDVPGTLTATAVEDTNLFTITVTSSNYETAYNVLKSVINNYPSVAEYVVG
ATDLVLVVPPSASSTPINPISYREKALIGTAVGALLGLLIVFFLENLNHTVRHPDEIRKLLNNQRLGSIVKVVKKKSSHS
TGSLTIDDAHTDPRFKESVFSIRNKIIKLCADQKINSVMVASTTTNEGKTTVAANLAIALAKKHYRTVIIDCDLRNPTVR
QQLNIPESCSLGIVDVITGTCSLQDAIVKTKKNGLYVLPGTIPVNNASELMGSKQLADLVAALEKIFDYVVIDAPPVGIV
SDALEMKDYVGGLVFVVRQDYAKVSKILDSISLFGYSKIKILGCIFNMASGVLSTRGYGRYGYNSYGGYGSYGSYGRYGY
GYGQYGDYYGNEENSQAEEASYTDSDSADED
>gnl|bykdb|R6XBL9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium sp. CAG:91] (length=467 residues).
MLETILNNFHLEKILWILQKRIAYIMILGVLGGMAGGAYAYLTNSTLYRAEVSFYVYSDPDYVYDSSVNISNSEFTQAKN
LVQSYILILKSNTILQKVLEEAGLDYGTEALSGRIGTSVVENTAVFYVYTYDSDPYRAMELANAIGRVAPKEIGRIVKSG
GIEVIDYATLPEAPYSSTSLVKYALVGFAGCFGASFVLFLLAGLMDTTIRRRYELKLAFRIPVLGDIPQIQAPDRKSKPV
LVLGENSSFAVKESYNTIRANLLFTGKGERCPVYAVTSADKDEGKTLNSVNIAISYAQLGKKVLLIDGDMRNMSVASLLK
LRGRLGLSQYLAGLRETPQIVEYRQNLDVLVGGENPPNPSELLGGERMKELLTTLRSRYDCIIIDLPPVGIVTDALLLSH
EVTAYLLVVRAGVSHMSREKSAVTLLEQVDADICGILFNGLPPKSKDCNYRLQQYWQEYKQQNGEAV
>gnl|bykdb|R7BXS4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Firmicutes bacterium CAG:270] (length=522 residues).
MSNEKHNISVNDYEMNIDLYSILRDISKYIVVILLLAASMSLLAYVYVGRSYHKQYESTSTFIVSSKGSNNSVYSDLSTT
TEMATKFSEILNSSILQKKVAKEMNMDYFPGTASAEVVNETNLLVLKVQADSPEMAFSLNKAIMNNYSVVTNQLIGTVVL
DVLQNPTVPSGPVNEFQPAALMKKTFVMTIVALCGLIAIISFLKDTVRKPKEVSKKLDGTLLQTLYHERSYKSWKARIHR
KKSSVLLTNPGTSFQYVEDMKKLARKVSSKMKDKQAKTLLVASVEENEGKSTVAANLALALAEESEKVLLIDADLRKPSQ
YKIFGLAPEEVQEFGEVLNGNEKSDHLVHALAKSELLLVTGTMIYPNSTEMIASDMFYKIVDFFKERLDYVIIDTPPMSQ
AADAEELVDYADASILVVRQHTALVKDINEAISILNSGEGTMLGCVYNDVFHGIAQTARNYGYRYAYGSGSSYGYGYGYG
NKYGYGYGYGYGRSSRQSKQEEQKEQHNKDSVTERQVKKEDE
>gnl|bykdb|R7D5E6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus obeum CAG:39] (length=467 residues).
MEERIDNETVQQIDLISMLKDIGREWLTILLLAIAAALFADIWICATYQPEYRTSTTFVVTAKGMNNNIYQNLNSTKELA
GQFTEILGSNVLKKKVAQDLGVNSLEVETSVDLVPETNLITLSVKAGTAAESYRILQSVMENYNTVSDYAIKNVIIETIQ
QPSVAMAPINPLDEKRTVMKVFAVAAGCLIALLAGISYIRDTIKNPGEVSTKLDTRLLGTIAYEKKSKALSMKRKKDYLS
MLIQNPLRSFAYVESSKMAASRVRSYMDKEDAKVLLVTSVMENEGKSTVAANLALSLAQGGSRVMLIDCDFRKPAQYKIF
NVRDNEEKDLGDVLINHASTEKIIRNWNNSGLYMILNKTSSNAIETLLKSMTLKQIIAFCREKMDYVVIDTSPLALVADT
EELAQMTDASVLVVRQDTVLTKDINDAIDILNNTRGKVLGCILNGVTSQNMAGSGHYGYGGHYGKRA
>gnl|bykdb|R7FFK6 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus sp. CAG:330] (length=516 residues).
MKKSYTIKDLIFLFLGHIWWIICAAVVGAAGTFLVSSYVIPQQFQSNISMYVKNSEKQNQEQQGINNNDLTVSKSLVSTY
IVILNNDVVMDEVGNQLAKEYTEEELSRYFTLKNGKVTDTSLKACFSMTAVDETEVLKITTTTQNAELSASLCNIMADVA
PQFLIRVVGAGSVEKIGDAKIYDTPVSPNVTKNTAIGFAAGAMLAILVILVIDFFDNTIKDSSELGEHFQKPMIGEIQSI
GGKVKKKDRGTSADRKRKLIYHNSDLPFSILETYKALRSSLNFLVSTSENKIVAVTSASPNEGKSVTVANLATAISETDK
TVLLIDADMRKPVQHKNFQVSNKLGLSNVITDASLLDEALHQNVTGTLDLLTAGTIPPNPSELLASKQMAELLDKLKEKY
DIILIDCAPVNVVSDVAGMANSIAGVVMVVHYGTTTYAETEDAVKQLELANCNVLGFVLNEVVHKHSAGYYSNYKYKYKY
KYDYQYRTEPSETESTETVAAEAEADAKHIEGEKQA
>gnl|bykdb|R7G0D7 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Dorea longicatena CAG:42] (length=482 residues).
MESSNRNDMPVFMDNDLDPYTLVHDIVSNWWVIILGAIAGALLTYVVVSSRYVPEYTTQATFVVSSRGDANAYSNLSSAN
TMAKTFEKILKSNIMEKKICEKLKVEELDADIHAKVLEGTNMLVLSVTADTPKESIDIIRTVMDNYSSVSLYTVGSAVMD
VLEEPKIPYTPDNPLDAGRQAKKGGLVAGALVLILLGMFSYMKNTIKQENEIEKKLDARSLGAISYEWKYKTIRDIFRRK
KKAILVDDPVASFRFVESYKKLAAKVEYRMAKNEQKVLVVTSVSENEGKSTVAANLAITLAEQSKRVLLVDGDIRRPSQF
LIFGMEPKEENELGEYLKGNRALADVMVPCTRKHMLFMGGKNCYSSSTEMLNSDSFYKLMTACRKFVDYVIIDTPPAGII
GDAQIFAHCADAVMIVSKQNYMLAEDINEVMDAFRDKEGKVLGVVLNGVRSFSGLVDSPVGHYYGKYSKYGRYGNYGRSK
GM
>gnl|bykdb|R7JQZ9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Blautia sp. CAG:37] (length=467 residues).
MGEYDRTGNGQSSKTDWDLRSILCDIAKNWWVILLIACSAAMITYTVMATVHKDRYTVKTTFAVMGRGVDANAASSLSAT
YEMAQKFEAILENTILKKKVMEELSLSSFPAKMNDSIVPESNLMELSVTADSPEMAFRILKSVLNNYTSISDYIIPNVVL
ETLQQPQVSGVPSNQIPTKKYAATAFLAAALAMAALIGLFSFLRDTVKNEAEFTRKIDADLLGVVYHEKKKKNSSMLITN
PARSFLYVESLKRIASRVRGRLDRKGGKVLLVTSVAENEGKSTLAANLALALAEEQNRVLLLDCDFRQPALHKIFEIPEK
DGKDFGKVVLGKESASGVFEKHKDTNVYTGICRNRLEEPSLAIGGEIFHRILETCRTNMDYIILDTPPMGMTADAEELAE
YADAAVLSVRQDGALTRDINDAIDALNQKEEKVIGCVFGNVYPGFGERIGNSYGYGYGYGTYSRAER
>gnl|bykdb|R7MQJ4 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus sp. CAG:624] (length=510 residues).
MESNYTIKKLIQLFLSKIYVIIILTIVGGAAAFGFSKFFMPLKYQSYTSMYVKNNNSVTETDGVNLNDLNASKSLVSTYI
AVMQDDAVMEKVGSELLAEFDKDKLSKCFSIKDENGEESISAASIRNCLTMAAVGDTEVMKITAETADPEVSAALCNIIS
NVTPDFLIRVVGAGSVEAIGTAKVNNNPVSPNFLKMAVIGAFAGMLLAALIILVIDFFDNTVKDKEEIAQKYEKAIIGEI
PEFIDDKKKKKDSNDYDLLLTQKGIPFTIKESYKSMRTNVMFSLSVSEKKVIVVSSANPGEGKSTTAANLAITFSQMEHK
VLLIDADMRKPVQHKIFGLKNKKGLSSIIGKMNKFDECVNKNVVKSLDILTSGTKPANPSELLASEQAAELLNTLSEAYD
YIIVDTPPVNIVSDAMGLSNSIAGILMVLRYGRTTFDDLDNAMKKIELADVKMLGFILNDISKKHGSYSKYGYNYKSHYY
DSYGYGEETSEDKDESKKDKSDNKVKKEKK
>gnl|bykdb|S3FFL2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Exiguobacterium sp. S17] (length=731 residues).
MGVAPKQKGAFAGLPVQQAGDTPIIRQYMRIANRWRWVILGIVAASLVAGLVITLLMTPQYTATAQIEISREGNQVTNFQ
GVERNSNQVDQEFYQTQYGLLRSRSLSERVATQLRLVDDPGFFEMFGVGREDQGPFALVNNRYTAAGRSERLRIAGDILR
SHIEISPARLSRLVDLYFTSPDASFSARVVNAWADAYIQTNLERKSQATSYGRNLLQRQLAQAKERLDESQRQLVNYASQ
QQIINLPAPSSGASGTTTSERSIVADNLATLNAALTQATADRIQAEARYQQAGRAGASTEALRNSAISALRQQRAELAAN
YQKLMVQFEPEYPAARALSAQIAQLDRSIAREESRVSGSQLADYREAQERERALKAQVDALKSSYLDLRRRSIQYNIYQQ
EVDTNRALYDGLLQRFKEIGVAGGVGINNIAVVDAADVPQKPSRPRLLLNLAIALFVGLGLGVLVAFALEQMDEAIADPS
EVERQFGLPLLGSVPKVTDGRSPRDVLFDRKSDMVDAYLAVQTNLGFTTAHGVPRTFAVTSTRPGEGKSTTALALATMLS
RAQRRVILIDGDMRSPSVHHLGGVDHNRGLSNFLAGENDIASLTFSMSELNFTAMSAGPIPPNAAELLTGDRFGVLLTRL
LDQYDHVVVDSPPVMGLADAPLIASRVEGVIYAIESHGIRATLVKTALGRLLNANVHIFGGVLTKFEATKSNSGYGYEYG
YGYGRDEKAGD
>gnl|bykdb|U2A8X2 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. EGD-AK10] (length=473 residues).
MELKDYLLLLRRRWVTVAVAAALGLVLAGAYSLLSTPTYSARSQVYVSVQGSDSTTDLLQGSNFTVRQVKSYIELVTSPR
VLDPVVDELGLADDAASLAQRVQADSPLDTALVNVTATDESPQLAAEIANATARSLASVVAELETPVGGGDSPVQISTVR
AASVPTAPASPNLRLNLVLGLVIGLAVGVAVAVVRELLDTRVRSTADVEDVTDAPVLGVIGYEADAPEHPLIVQESPQAV
RAEAFRRLRTNLQFLELGPAARTYVMTSALPGEGKTTTSVNLAITLADAGQRVVLVDADLRRPAVARYLGIEGSVGLTTI
LIGKVAVEDAVQPWGNGNLDVIASGQIPPNPSELLGGDSMAQLLERLRTEYDVIVVDTPPLLPVTDAAILAKGVGGAIVV
VGAGTVHRNQLETALSALGTVGVRPLGIVVNRVPVKGPGAGPYEYGYYEYTADAAAEASQGRSARRSAVRGSR
>gnl|bykdb|U2AC50 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Bacillus sp. EGD-AK10] (length=465 residues).
MTLREYVTAVLRHWVVVAVCAVLGAVAGFGYARSEPKVYQSSASVMVVPEQGENAAELVQGSNYVQNLVASYAVLAQSPY
VLEPVIEDLGLDTTPARLARSVSVNTPLNTVVIEIAVSDTSPDRAREIADGISDQLALAVPELSPQLADRSSAVRITTIA
PARQPVNPIAPNTRMLMMVGLAAGLAVGVTYAVLRELLARRVVSSSSIQSMLGVPFLGEVVKVPSRTSLPAVVAAGPGSR
PSESVRTLVANVRFADVDHGRRVLMVSSGDAGEGKSSIAISLALSLAEDGSSVLLVDADLRRPSIARVTGLEGSVGLTNL
LVGDVAQEDIVLPWTRPNLFVLPSGVLPANPGVLLSSERLVAVIGDLRTHYDYVVIDTAPILPLSDPLWLSRAVDGVLVV
ARARKTRISRLRQTVDKFERGEADVIGIVLNDVKPRGRSAYYVNDSRVGVPGAFSREAGSPDVSP
>gnl|bykdb|V8C417 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus lactaris CC59_002D] (length=469 residues).
MSQESYKSQSLDSQIDLRYIFRTLKKNAVFILMCVCLTGMFSYVILDHSLKDTYTVSVNLCVIPRDNTSEKLAETNIENA
LERSVNVLNSDTMRDQIMKASGSSRVKGNLSASVVADTNIIRMSASGTNAESAYKLLKGALQQYPELSDYYESGYVLQPL
SSISANNVQKTEKATLRYSLLLIFLVLAGGIGATVCLCIFTDKIHSMEQAKRLLDIPMIGSLDYVKKKSGQKALLISDQD
TDHVYEEAVDRIVTSIRSEMSAEGYKTLMVGSIKENDGKSTVTANIALNLARRGKKVVLVDCDMRHPSLAKIFDATVDPK
EQFSEYLLGKCELDQVLKQTEVQAHPMDCIWQKKAVAKPYRLLGSERFISLINQLKEQFDYVVMDTPPLELIRDAEIISE
TADAMLMVMRQDEVHAVAVNDTVDLLEENGVTVIGGVLNMTKGERDTSKDRDGYRKYYNENAKIENAGE
>gnl|bykdb|W0U604 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus bicirculans] (length=497 residues).
MKKNYTIKDLLVLLLGKVWYIVAASIVCAILALFVSKFVMSKQYQSHVSMYVKSADNQSTGQDKTNVDLQDINASKSLVQ
TYIVILTDDPVMNEVSDKLLEMYTPEQLAPYFTVTSGRVSNDDLRNAYSMIAVNQTEVLQITATTTNAKLSSDLCNIMAD
VAPSFLIRVIGAGSVEKIGDAEVYNTPVSPNTTKNVALGFVGGLMVAVLVILVIDFFDNTVKNSDELGDIYQKPIVGEIM
NIGGKTSKKDEGSSADRKKQLLFNNKDIPFNIVENYKTMRTNLMFTLSTTRNKIVVVSSPNPSEGKSVTVANLAASMAET
ENKVLLIDADMRRPVQHRNFKLKNNVGLSTILSGESTFDKCVHETKNGNFAVLTSGVLPPNPSELLASEKMRELLEYVQH
KYDYVIVDGTPLLPVTDVMSLADEVAGVLLVARYGRTTYQEIEESMKKLEIGDCNLLGFVLNDISAKNGSHYGYKYSYKY
KYDYSYKYGGKDASAES
>gnl|bykdb|W1UFG0 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Intestinibacter bartlettii DORA_8_9] (length=450 residues).
MKDTMTISLRELFTIIKRKLWIIVLVGIIFGLITAGVNQFLLKPVYEANTTIITNKEVDEEKVQMSTSDDFTFSQRMAIT
YSKIITSDTVLNQVIDNLNLKMKAKKLAKYIDVENIQDTQIIKISVRNGNPKTAAKICNEIPIVFEKEVKRITKASGVEV
IDKATVPTKHIRPRKTVNTIIATLIGIILAITVILLREILDKTIKTTKDIEKYFDFNILGVVSKQKEKLMYVKDLDRKNL
VQEEFIKIRTNIQYANIDNEMKVILFTSTHKDEGKSILSLNTAYKFSELEETKVLLIDCDLRNPTINKILNKPNQKGVMD
ILLGKKDIKNSIEKVNDKFDILFTGKIPQNPTEILASKKMKNLIDYLKNDYDYIFIDTPPAGVVSDCSILSRYSDGLVYI
MASKESEIDYIKDSIKGLQGIKIIGCILNKFDAKSVSYYNYSNYSYYYGE
>gnl|bykdb|W4V1T8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Hungateiclostridium straminisolvens JCM 21531] (length=463 residues).
MEKDDILEIDLREIVYILLKKWYFIVLCFVLAAGSAFVVTQFYIKPVYKAETTLFLGKEKDQVSLSFADIQVNNQLVVDY
REILQSRRVAETINQKFGVGIREFQNNVTVKTVKDSRLFSISYEDTDPKRAADVVNELASVIQKMADEIIQVKNIKVIDT
AKIPENPIKPNKKMNVGAAGLLGLVLGVGLIFLLELIDHTFKKPEEVERILGINVIGTIPAFEGGKRGKKKAKDEKELQE
EYLKNLIVHNNPKSASAEAFRELRTNLHYSSVDREVKTIVVTSPTLGDGKTVTAVNLATTLARSGKKVLVIDADLRKPKV
HHYFGVKNKEGLTNLLTESKEEIKIKTTEKSDISNLYIITSGPIPPNPAEMLNSNRMKSLLEKVKEEYDIIVIDTPPVGQ
VTDAAVIAGITDGVMLVLASGQTRIEMAKRAYKSLESVKAQFVGAVLTKLDTERTGYYSYKYD
>gnl|bykdb|W6RXP9 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium bornimense] (length=451 residues).
MEQEILEKEISISEIMEALQKRWKMIALITLIFSVVAGVLSFFVIKPTYEAGTKLFIGKEESQNSTYDNNDIQMYQKLLK
TYAEMIKNDELIEKAIREVNTTMTAEEILDSLTVNPLTDTQILEIKLQGKKPKEIAEILNGINNEFIFQANELVPNGNVK
VIREVRVPKDPVAPNKVMNIAIAFLLGLMVGVGLTFLLEYLDNTFKTKESVEGALNIPVMGVIPQMSNSSKPGKKYFVVE
DDPKAVASESYRTLKTNIQYSSFDEKHRVMVVTSSTPGEGKSTTTGNLALALAEGEAKVILIDCDMRKPTVHKKFHISND
KGLSDVLIGKVDIMEAAHKYNKNLLILTAGKIPPNPSEMLGSKTMKELLDRLKEVVDYIILDTPPVQAVADAQILSTRAD
GTLLVIKAGETKKEATENAINLLNKVNANVIGGILNGAEDRKNKTYYYYGE
>gnl|bykdb|W6S4G8 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Clostridium bornimense] (length=460 residues).
MEEVKVVEEFSNEISFSQIIFALKKRWKIIFATTIFFTALVALITFFFIDPVYEVHTKVFIGKDAEVNYDNNDVQMYQKL
LLTYAQILKTEDLIGTALNNVDSDMTMEEVMKDITVEPITDTQILQIKLTGKNKDDLAVVLESITEEFIKESKEIVPNGN
VKIIRHVKEAEAPISPNKKMNIILGFLIGLVSGMAIVFLIEYMNNTYKSKEEVERNLKLPVLGVIPKFGRKREKLVMEEE
PRSLEAECYRTMVTNIQYSSIDSRCKTIVVTSSQKGEGKTTISGNLALSLAGWGNRVVLIDCDIRRAALHKAFNISNSKG
LTDVLVNQASLKDVAVGIKETLLLIPAGRVSPNPTELLNSKAMELLLEELKETCDYVILDTAPVEAVADAQILSAKADGT
LVVIKSGDTRINVIQDALNLLNKVRGKILGVVLNATEDGRLSKMYQYYGEEHKKKGDKVS
>gnl|bykdb|W7V182 [Bacteria] Bacterial tyrosine kinase [Firmicutes][Ruminococcus flavefaciens 007c] (length=517 residues).
MKNDGKDMLDLKSMVALLLSKLWIIILAAVLGGTAAFCVSKFLMPLKYASHISMYIQSYTTFNENPDQNFNNINNSKQLI
NTYMEVMKDDAVMNAVAEELRGSFENDVLEQNFSVVNGRITPASLRSCISISSVTDTSALKLSAVTKNPEVSAAICNDIA
KVAPDYLHDAVGVGQINTIGTAEVYNSPVAPNVKKNTMLGLMAAAMLAACIIVVIDFFDNTVKDAGRLGESYKKAIIGEI
QQFDESKKRKKDVDDNHVKLTDKNVPFAVVESYKSIRTNITFALSTSEKKIFTVSSANPSEGKSTTSANIAIALAQGGNK
VLLIDGDLRKSCQHKIFGIKNKKGLSTAISKMAALDECISKDVMEDLDIMTAGPIPPNPSELLASSNMENILDQLSERYS
VIIIDTPPVNVVTDAMELANKVSGIIMVARYAKTTTDDIDNAMKKIEFAKMNMLGFILNDIKTGRSGKYYSKYRYDKGYG
YGVKYEEDSDEDKTETPEKSEKKTEEKNQSKKKKGGK
© 1998-2019