BYKdb

Dataset for cluster cd of phylum fusobacteria

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bykdb|C3WFM9 [Bacteria] Bacterial tyrosine kinase [Fusobacteria][Fusobacterium mortiferum ATCC 9817] (length=274 residues).
MSKRKIFFIQEDNMEATEAFRTVRTNLAFQNDKEIGRKIMVTSSIPGEGKSTLAGNYGASLAIAGKKVLLIDCDIRRPRA
HESFGIKVERGLESVLTENVNPKDVIIKDLIPNFDLLPTKHMRYNVTELFIGDKMKEVISSLENEYNTIILDMPPLAVAS
DAAILSKYVDGVVVVVAYDQVAKRELEFTKEMLSNAGANIYGFVVTKVDKGGLSYGNYGYYNNYYSYYQEYYSDSNGNRK
KHTVKKPKSKFGKFIHDIKEQYKRQFSGDLKGKK
>gnl|bykdb|E3H7M5 [Bacteria] Bacterial tyrosine kinase [Fusobacteria][Ilyobacter polytropus] (length=233 residues).
MRRRKLVFFDRDKEHIAEAIRILRTNLYFTESKDRKVVLVTSSIPKEGKSTIAANYALSVAISGEKVILVDCDIRRPRVV
DSFGIKANYGLEEVLRGKKNLEDVILHNVERNLDLLPATSFGENVTELFLGKKIVEILDGLKEKYNLIVLDTPPLTVATD
AALLSTYADGVVYVVGYDMVFKKELLSGKKLLEKAGANIYGVVVNKVSINGYSMGNYGHYSSNYKYYDEYKKR
>gnl|bykdb|E3HB18 [Bacteria] Bacterial tyrosine kinase [Fusobacteria][Ilyobacter polytropus] (length=237 residues).
MTERKLYFKLDGQSPVAESLRVLRTNIHFIDEKEKKTVVVTSAIPKEGKSFIAANYAMSEAMVGKKVLLLDCDLRRPRAH
STFGVEGRHGLSEVLMGERNVEELIVKEVEKNLDLLPTKPMEQNVTELLQSKKMESLVEEVQEKYDLVVIDTAPLMVATD
AAILSKISDGVIFVNGYDMVSKKELLYAKEILSSAGANIYGMVVNKIDNSGYGYGYKSHGYYNNNYRYYQDYIKEDK
© 1998-2019