BYKdb

Dataset for cluster tad of phylum fusobacteria

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bykdb|C3WFM8 [Bacteria] Adaptator of bacterial tyrosine kinase [Fusobacteria][Fusobacterium mortiferum ATCC 9817] (length=248 residues).
MSRKKKYEDYDEEFENDEDEIDLADLIFTLIRRWKLIVLTAIPVVILGVIFAITRPTVYQAETTLIVSNNMSSVSLDSSD
ISLSQRLVITYSEIAKNKSILNKVINKYDLKETTEQLAKLVTITPVDSTELISLTYKNSDPQLAAMVTNEIANEFMDKVV
QVMRVRNVNIVEKAQVPVQPLPKKRALILLASVVLGLAAGTGMAFVMEFLHKKLRKPSEIQAILGVSMIGMIPDLENVIA
EKDEDSNE
>gnl|bykdb|E3H7M4 [Bacteria] Adaptator of bacterial tyrosine kinase [Fusobacteria][Ilyobacter polytropus] (length=252 residues).
MQDNNKKEREKNEIRKEIDMVELFMIVKQNWKVLFRTIFIMVALGFTYSYYKADTYKAEVILMVSGSNLISPDRLENSQV
SLNQKLVSTYTEIAQSSSIMRDVVQKLDLKNSPESLARKVEVAPVGMTELIKISYEDENPQKAALIVNHVSEEFMIKIKS
VMRFDNLKIIESSRVPVNPESKKTKLIIAISMIIGILLGIFEVMWGEYYQNKIKNPEDIERLLDCQVLANVPDYSTVKLD
KKSNELKKVKKR
>gnl|bykdb|E3HB17 [Bacteria] Adaptator of bacterial tyrosine kinase [Fusobacteria][Ilyobacter polytropus] (length=247 residues).
MFKKSRYEEDINTHWMEEDDEIELMDLLFILIRRWKMIIAIAVPVIIIGLTYAVLKPAMYKAETTLMVSSGQIYSVEKLD
SSEISKNQKLVSSYTEVARSKSIMKNVIKRLGLEAEPEEIAKLVKVTPVDETEFIKISYTDINARKATLMVNEVSKEFML
KIRDLMNFENLKIVEKAEIPTKPESRKRVLIVAISGVLGIMLGVFGAFLVEFLHSNIRKPEDLQNIMGCKIIANVPDFEK
IEAEVKR
© 1998-2019