BYKdb

Dataset for cluster orphancd of phylum gemmatimonadetes

[Download (right click)] [Alignment] [Repertoires]

38 sequence(s)

>gnl|bykdb|A0A0S7Z9Q9 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonas sp. SG8_23] (length=823 residues).
SDEQFALPAAPSDGPGGEIQLRDAAAAAAAPPVWDEGFYPPSDDGDGGIDFRRYLVSILRHKWLVASSLLVGVVGSVFVW
SRTAVTYTAEGNLWIEAEARTAADLGPNEPSGLLQDNAWVELLESFQVLDTVAVRERLFLRVPADYEPAFQRFSLADEVG
FGTYVLRVSESGADFVLTTDDGTLVQQAAFGVPIGENVGFRWNPAPGSFPPEAVVRFRVLTARDAGQQLRDQLQTQIDRA
GNFIRLTLSGPNPEKIASILNAVMDRHVTIAAELKRNKLDQTLIVLEEQLTQAEAQLQRSERSLEEFRVSTISLPTDQSM
PIAPGLQITRDPTFGNFFDMRVRLDELQQDRRRLQAVIDDFGQRDVRIEALELIPATAGSSELRRILDELVDARSELRAL
RDRYSDDYPPIQDLLNQIESIETTAIPRVVLGIMRELEDQEAELSARLATAQAELQAIPPRTIEEQRLSRQVATNTDLYN
QVRGRVESARLAAASSIPDVRILDPARVPNQPSDDERMLRAGLVFFGCFGLGLLGAVLLDRVDARFRFASDVGRVIGLDI
LGSIPRIESANGRRGVLNAAQALEAFRELRIHVSFAYGSAGPITLAVTSPAPNEGKSMISSNLAVAFSEVGRRTLLIDGD
TRRGDAHRLLGRERSPGLIDHLRGETGQDIIQATDHPNLDFIGCGSRGVSTPELLASPRMAYFIGTLKRTYDVIIIDCPP
LASGGDPLILGSLTGNLAVVIRTGATEKALAQAKIDQLSRLPIRILGAILNDVSAHDTYHSYYASYLPSYEPVPEEGDEV
PTQILSGPSDRELDLEEEGARKG
>gnl|bykdb|A0A143BIC3 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonas phototrophica] (length=816 residues).
MSGQQIQPVSPRDVALEPYQDGAPPADWGGGQEAAPEPKGPSLGRYLAAINRFKWLIMLLGIVGAGAGYMATTFIEPEFE
VRATILLEQGTGISNGGQSRGPIQADELLQASGWQDLLRSFAIADPVVNSLALFVTPSAAGDSTLFRSFRVSEQVPLRPG
AYILKLTGQTYTLETSGGLQVEQGAVGDSVGTRVGFMWQPTSQALAGRKDVGFNVQTPREASIALIKKLKMNLANGSSFL
FLNLTGNDAPRTAATLNAWVEQFVVVATALKKKNVTSVAAILEGQREFAAKSLNEAEGALESFRVRTVTEPTERQTITPG
IELTTNPVFDNYFRDKVLADGYQRDREALERILNAGKQGAPITREAVLSVPSVNTDPAAENLRKVLAEQADREFNLRRLR
ESYTDEYQKVKDEQAALQTLRTVSVPGALDAYLGQLQLREKALVATIDRSSKDLRNIPARTIEEQRLKRQVEVSDAMYRN
LNLKAAEAKLAEAATIPDVSILDPAVAPLRPTKNTAPVIIFAAVAAMLGLGVVLAILLDQVDKRFRYPEQATDDLGLFVL
GVVPVIHSKGKRGKTDEAAQVVESFRTIRMNVRYAADPSRPLTMTITSPGPNDGKSLISSNLALSFAESGARTLLIDGDI
RRGELAKTFQITSKPGLVEYLDGTALIAEVLHPVQSHPNLTVMPGGARRRRAPELLATPRLNQLINQMAAEYDVVIVDSP
PLGAGFDAYALATATGNMALVMRAGVTDRKMAAAKMQVVDTLPVRVMGAVLNGIKMTGAYQYYSYYQDYAATDEEPVARI
TDGTRGDGEMKQGGRS
>gnl|bykdb|A0A1G0LV28 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium GWC2_71_10] (length=515 residues).
MQAYQESQSTTDLSAEEVSLVNTIQDLDREKQRILLDLQTLESSIRPGSDMTIETLNGLAAVPGISGNPAMTFQIQALLR
LYDDRRTMMAEGQRESNPQVTALDSRIQTVSRALNDAAAATVRGLRQQIAALERNIAQLRERLSTFPGKQTQFAQLRLET
ELQNDTYKYLLSQLEAARISAGTIAPYIEVVESATVSYRLGMSTRNKVVLGALVGLFLGVLAAFFLEYLDQTIKTAQDVE
RVLDVPVLGLIPLESRQQLLAGNGHHGRRRYAIPLVSLVSPDDPSSEAYRALRTNVTFVNAEQRSLRVICVTSPGPGEGK
STTAANLAITLAQQGSATLLVDADLRRPLVHRAFNLVQEPGLTDVLVGSSQLREAVRPNVIPKLDVLPAGALPPNPSELL
GSEAMRRLMEQLRTHYDIIIFDSPPTLAVTDATVLGASSDAVILVLRAGETEEIAAQRALEQLRRVQARVAGSVLNGVEK
DRDRYYNYYYYKHHDDGERRDGPFATLRKRLLGVG
>gnl|bykdb|A0A1Q6WKV1 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium 13_2_20CM_70_9] (length=241 residues).
MGGGGGGKSARPHEGVAELVEALRGTCLNLVYAYGAAGPMLVTITSPGPGDGKSFLAANLALTFAEGGHRTLLVDADIRR
GVLHRRLTARRRPGLTDCLRGEVPFEAILQQTAYPLLTLVGCGTRVHNAPELLSSEAMAQLVTRVRPDYDVILMDSPPLA
GGVDPFILGTLTGSLLLVLRTGHSHRDMAAAKLEMLHRLPVRLLGAVLNDVPAEAGYRYYSYYLPGYEATDEYPAGRKLV
V
>gnl|bykdb|A0A1Q6ZF81 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium 13_2_20CM_2_65_7] (length=207 residues).
MVLTISSPGSGDGKSFLSANLGLTFADGGHKTLLIDGDIRRGVLHRRFKGNRQPGLVDYLLGDAGHDAIVQKTAYPRLSL
IGCGTRTQRAPEVLGSPAMNRLLAELRGRYDVIVVDSPPLAAGVDSFIIGTVTGSLLLVLRTGHSHRDITGAKLEVLDRL
PIRLLGAVLNDVPRGAAYGYYAYYSYYLPGYEAVEESSGQASAPRVV
>gnl|bykdb|A0A1Q7DXW6 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium 13_1_40CM_70_11] (length=538 residues).
MACPRSDTRILGDQLEHARANLRDAEAAMTRFRVRTATHPTQGAVPSAEGRPPAATDPAVAGYLDLQVTVAQLAHDREAI
GRVLAQGADSGVLTDALAMITAVQRSAELTEALKELTAKQAELRALRFRYADTHPPVRRLAAQVDTLQRRIIPQLARTLM
AGMAARERDLQVRVDSVSRDLRRAPPVDLEGVRLERDELNASQLFSNLQQRYEEARLAEVSSLPDMRILERASKPDKPVS
QLAPILIVLSFLGSLSVGTLAAMTLDRMDRKVRTAEHVSLAMGLPILGAVPHVHRNGKKRNSQDEDSQPAVEAMRGIRLN
VQHAYGAAGPLLLTVTSPGRGEGKSFVTANLALAFADVGYRTLLIDGDVRLGALHHAVRAQRRPGLTDVLANRATPDQAV
QRTEHRQLWFIGAGSRMHRGPELLCSAGVPRLITAMRGGYDVILVDSAPLAAGVDPYALGTVTGSMLLVLRTGVSDRAIA
EAKVAVLQRLPIRVLGAVLNDVPPGTAYSYYGYSLAGYEMKEEDPGGAAGEILLPERS
>gnl|bykdb|A0A1Q7E008 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium 13_1_40CM_70_11] (length=568 residues).
MRLELTGTSPTAIAGTLNAVLQRYVDVAAELKRAKLTELTHILNEQLSTAARHLHDTEGALEGFRVRTITLPSEQATPLA
PGLEATRDPVFKNFFEMRIEREQLRRDREAIERVLAEVADAEVAAQGLEVIGVVQRSAELTQAQRELTTKQADLRALRYR
YTDEHAAVRRLAVEIETLERRTIPALTRALLSQIVTREQVLDSLVHSAGRELQQIPLRAVEEARLRREVSIAENLYTTLQ
QRYEEARLAEASTIPDVRVLDAAVAPHQPIKNTAPRLILLGLFGGLGLSLMGAVLIDRFDRRFRYPQQATGDMGLTILGA
VPRLRYGRRGIDPDDLTQVIEALRTVRLNVAHAYGAAGPMVVTITSPGPGDGKSFLAANLARSFADSGRRTLLIDGDGRR
GVLHRVLKVVRKPGLIDYLAGAVPFATIVQQTDHAKLWFVGSGTRKQDVPELLASPAMARFLVSARADYQVILVDSPPLG
AGVDPFVLGTFTGSLVLVLRSGTTNRELAQAKLDVLDRLPVRVLGAVLNDVEPHGVYRYYTYLSGYAAEDEPRRTEGWAL
ARRPRGAS
>gnl|bykdb|A0A1Q7JIY3 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium 13_1_40CM_4_69_8] (length=792 residues).
MISDNLPAIRARAAPVSPRRAPPSLAAAEEETGLDWRRSAIALSRFKWVVLLTVVLGTAAGVAATRFVRPEFVAQATVWV
DVPDRRGAADRSGPLRPEQLLDAESWVDLLKSYVVLDQVAREQRLYMGLKTPQDSAVFTSFQVAEDYRPGDYRLAVQGDG
RGYDLATADGVPLERGAVGDSVGARLGFRWVPPAGALPSGRTIDFSLTTLRDAARWLGDALGVQMDPNGNFLKVDLRGKD
PRRISVILNAVTQRYVQVAAELKRQKGTELTKALEEQLNTAHTNLQQAEAALQTVRAQTITLPSDRPLTSAPGPERRDPV
FTNFFDMQIERDQLRRDREAIERLLADARASALPADALSLIGSVQHSAELSQALKELTDKQATLRGLQYRYQDDYAPVQR
LKAEIADLENRTIPTLARTLVAQLAARETEVGRQVNATSHELRQIPPRALEEERLRRSLTLAEELYTTLQRRYEEAQVSE
RTIVPDLRILDAAVVPRRPVKNTAPRLILLAFCGSFGLAVVGAIMLDRIDPRVRYPEQVSHELGLPILGAVPHLKDAAEP
AEVVEALRGLCLNLVHAHGAAGPLLVTITSPGAGDGKSFLASNLALTFADGGHRTLLVDGDLRRGLLHRRFNANRKPGLI
EFLHGDAAREQIVQPTSYPWLYLIGCGTRTNRAPELLGSAAMGQLVAALRQEYDVILIDSPPLGAGVDPFILGTVTGNVL
LVLRTGYSHRDAAGAKLEVLNRLPVRTLGAVLNDVPRGAAYGYYSYYSYYLPGYEAVDEDDSLEAHSRPRVV
>gnl|bykdb|A0A1V4RFS5 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadaceae bacterium 4484_173] (length=227 residues).
MLLERSKSPNAEAIRDLRTSLSFSRPEQGIKSLLVTSSGPREGKSSVSANLAVAEAEAGKKVILVDCDLRRPTVNKTFGF
KRKPGFTELISGKATIDEVVKKTEVEGLFVICSGHIPHNPAEMVETAVKKGVFSQIAEACDMLIIDTPPAAVVTDAVVIA
PAVDSVILVVRSGKIQKKVVQGVWQKLLRSGGHLSGAVINGFDPIRTYTSYTYYTYKYQYYYEEQSE
>gnl|bykdb|A0A257SFA4 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium 21-71-4] (length=392 residues).
AILDADKEGYLRSARALIQTLTGRTRSLTDAIAQTADSLRAIPPRATEEARLMRRVALATSLFNTLQQRYDETRIAQATD
VSDVRILDPAGVPPWPTKNTAPRLLLLAVLGGFGLASLGSVLMDRWDPRFQYPEQVSRDMGIAILGTIPHVRTARDGTLG
DPAFREAMRGVRMNIAFAYGAAGPVTLTVTSPGSADGKSFVALWLARAFGEAGRRTVIVDADVRRGALHRRCDLLRKPGL
TDLLKGDVPLERVVRATGMPGLDLITSGTRMDDGPELLAGPAMRSLVGDLRARFDVVVFDSPPLSAGIDPFVLASLSANM
LLVIRTGLSVRELTYTKLEALNRLPIRLLGAVLNDVPDTAPFAYYSNYLPGYEAEAEHRDASATRATAAEAR
>gnl|bykdb|A0A2N1WA66 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium HGW-Gemmatimonadetes-1] (length=694 residues).
IRGPNAESMFGVPLEGPTGPDASLFDNFERTETIRSGSYLLAVNEDSRRWELTHQGSQQKETGVVGDSVGRAFGFRWAPN
LGGGRRGRSFRFDILTPQEVADDIRGKLRPDLERMNARFLRLNYEGQNAERAAATLNAIVAQFVTQAAALKNRNLSAEAA
VLDTQLTRARDRLNTAQAALESFKVSVVTLPREDVPVPAGLQSSTPSVFGNFIRQRNEVDSLRREQTELREALAQARSGE
LAIDRFLNIGAVTRAPELTQVLTELGEAERQRRTLLLTLMAEHDSVRAVTAKIDELRIGTLPTYVQSVLNRLAREQARLE
TQIQAAQRDLAGIPQRAIQEQEYLRELEIADLQYRDLQQRFENSRLQEASSLPDLSVLDRAFPPSQPEKNRKSVIIALGT
LLGLGAGIGLAFLLDLTDKRFRYADQITAGLGISILGAVPEIRRAKGETPSAEEASQVIEAFRTIRLNLMHTVAREKGFA
ITITSAMPGDGKSLVSSNLALSFAEAGFKTLLIDGDTRRGELHRTFGVERRPGLLDHLAEQVPIADALHPTNHPRLTVLT
GGSRHRNGPELLGSAAMRELMDQLQKEYDVILVDSPPLGAGIDPFLLGTLTGHLMLVVRAGETNREFTEAKLQIIDQLPI
RLVGAVLNDIRTSMNEYSYYAYSSGYAATDEAERTEARARPVVPTIPAEVGTRD
>gnl|bykdb|A0A2V7EJU4 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=357 residues).
QRAVEEARLRREVTIAENLYTTLQQRYEEARLAEASTIPDVRVLDTAVVPHQPIKNQAPRLILLGLFGGLGLSLMGAVML
DRLDRHFRYPQQVTGEMGLAILGAVPRIKRGRRAVDPEDARQVIEALRTVRLNLTHAYGAAGPLLVTITSPGPGDGKSFV
SGNLARAFADAGQRTLLIDGDSRRGVLHRLFKGLRKPGLTDYLTGVVPLEAVVQPTDHATLWFIGSGSRKQDAPELLGAP
TMAQLLASARASYQVILIDSSPLGAGVDPFLLGTLTGSLLIVLRSGTTDRELAHANLDVLGRLPIRVLGAVLNDVEPRGA
YRYYSYLSGYAAEDEASAPPQRWAVARRLPGASSPSA
>gnl|bykdb|A0A2V7EK09 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=406 residues).
MQRLAEQIATLQRQAIPTLTRALVSELAAREAEFGRRVAADSRNLREIPARAIEEARLRRAAGLAETLYTTLQQRYQEAR
VEVASSVPDVRVLDAAAVPQRAVKNRAPQVILFAFFGSLGLAMIGAVLVDRGDPRVRYPYQVSREMGLTILGAVPHLRLT
GVPGRHGNERSPEDIAAVVEGLRGICLNLVYAHGATVPLLVTITSPEPGDGKSFLSANIAHTFAQGGHRTLLIDGDIRRG
VLHRRLNGRRRPGLTDFLQGETSLDTIVQATPYPAFSLIGCGVRAYNGPELLGSAAMSQLLTTLRSSYDVILIDSPPLAA
GVDPLILGMLTQSLALVLRTGYSRREVAASKLEALQRLPLRLLGAILNDVPPRGGYPYYSYYLPGYEAVDEESGRRSGPT
GRPLVA
>gnl|bykdb|A0A2V7GP46 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=685 residues).
ESWIDLLRSYAVLDRVARDLRLFLQLPKGPDPALRSFNVADQFRPGAYRLTTDAARAYVLAKVDGGVLERGTVGDSIGRG
IGFLWAPPAESLPPGHTVEFRLQTAREAALYLSDALDARMDYNGNFLKIELRGGDPARITRILNAVAERYVEVAAELKRG
RLTELTGIIGDQVRTAKQSLDSAEGDLESFRRRTITLPPDAVAAGGDTPRDPVLGDFFEQQVQRQQAARDRAALTRVLAQ
PADSGLASALEVIGAVQHSPELKDALQELTTKQAALRTLRYHYTEAYPPLARKAAEVATLERQTIPTLVRSLIDELGTRM
AELDRRIGSASQELRRIPARSVEEARLRRSVTIADNLYTSLQQNYEAARLAEASSIPDIRIFDKAVVPLQPVKNSAPRLL
LLGFLGGLGLALAGVVLLDRFDPRVRYPEQVSHDLGLPILGAVPHLKARTGGQLTREQRVQLVEAMRGVCLGVSYTYGAA
GPVVVAVSSPGPGDGKSFITANLAVTFADAGRRTLLVDGDLRRGAQHRLFGADRRPGLTDALRGEVPLEAGLRPTGYDAL
TLLPCGVRTSDAPELLGSAKMPELLARLRGDYDVILVDSPPLGAGIDPFVLGTLTGNLLLVLRTGVSHREVMAAKLEVLR
RLPVRLLGAVLNDVPPGAAYQYYSYYTPGYEATDEKPARLTPSVG
>gnl|bykdb|A0A2V7H298 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=695 residues).
MDLLQSYAVLDDVVRGQRLYLHAKVPGDSDILATLRIKDHVAPGKYRLVVEDTGDAPHFTLYNARSKAPVQTGVAGDSVG
PDMGLAWVPPRAVLAGPREVDFTLDPPYEAALGLARNLKVAADLDGNFLRMELGGHDPAQIAATVNAVAERFVAVAAGLK
RDNLTELTRILGDQLAQAQANLRQAEASLKSFRVGAVTTVAAGAGSVTESSQYPRDPMFAGLVDLKVNLDEVRRDRTAIE
RLLAPSTDPTVEVPVDALSMVGSVQRSTELVQGLRDLTSKQAELRALRAHYTDANPPVRRLASEVDELAHRTVPALAASL
VAELRVRESELVQRVDAASSSIQKIPPLAVEESRLQRGVTLAEQTVTNLQARYEEARLAEISAIADVRLLDRAVEPQVPV
GHMRAILIFLAFWGGLGVGVAGAVLLDRTDRKVHYPEHVTRAMGLSILGAVPHVDWRNGNRDAAATQVIESLRGVRLNVV
HRHGTAGPVRLTVTSPGKSDGKSFVASNLALAFADAGYRTLLVDGDVRRGRLHHTLSAARRPGLTELLEGSAPQDAAVQA
TRYKNLSFISCGLRSHAGPALLSSVAMARLLDALRASYEAIIVDSPPLAAGADGLALATVTGSLVLVLRTGVSDRELTET
KLGALHHLPVRVLGAVLNDVRPGGAYRYYSYYLEGYEVHDEPAAAEVHVLRGPER
>gnl|bykdb|A0A2V7HL73 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=409 residues).
MRDRVSAITLTSDGETLGTTVKPDVVETTVLAAAPQDATSRAGQDAARRGGIVLPRAPGSVDPQVERSRGRRPRTTIAHR
LQDERPSNEVFCHLSREGSPVSKFLKALERAEQQRALGRHPAPSEAASERGLAVPETAPPRPPRASHELAREVPNGLEEH
LVSLLAPRSFEAEQYRTLRHLIEQLHKSTGLSVVAISSPGVADGKTTTAINLAGALAQASDARVLLVDVDLRGGALAARL
GIDERAGRGLVDAILNAELTLEAVVEVRPDLNLTILPAGRLPRAPFEVLKSPRVEELLAEARRRYDYIVLDTPPLVSFPD
CRVIEKCVDGFLIAVAAHKTSRKLLEEALNVTERAKIVGFVFNGDDRHLSRDSYGTYASTRSVDLGGGGWRRLVSSSSRT
HRRQTASDH
>gnl|bykdb|A0A2V7IEC4 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=255 residues).
MGLAILGAVPHLRTLPHAGRHGRGRVPEDVNQVVEALRGVCLNLVYAHGGRAPLLVTVTSPGAGDGKSFLAANLAHTFAD
GGHRALLIDADIRRGVLHRRLNARRRPGLSDFLRGETPLDSIVQATPYPSLSLIGCGTRAYNAPELLGSPPMSELVNGMR
SGYDVILIDSPPLAAGVDPLILGTLTGTLVLVLRTGYSHRDVAAAKLEVLQRLPVRLLGAILNDVPAGGAYRYYSYYLPG
YEAADEDSGSRRVPV
>gnl|bykdb|A0A2V7ILF0 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=821 residues).
MGARCAPRPSFPYRTPATMPSDQPLQPVISLGRLEPAKSAGSALPSRALQPALPPSADWRRYLVAIRRYKWIVLAGSLLG
GGAGFAAGRYLGSEYTARATIWIDVPDPRNREEGPLWTGQLRISSGWTDLLETSAVLESVVRERRLYLSLDDPADSAALR
SFRIKGQVRPGTFAFSVAELDPTFTLSSEDGVHEQGSLGDSVGADLGFLWAPAPDAVAPGHKIVFTVAAPSDAAKLLAKA
LVVKSDLDDNFIQLELRGSSPTGVAGIVNAVADRFEALATELKRRKLTELTGILSEQLKQAQGKLAEAEAALKRFRVTAV
TQFAEGTAAVTPNLERTQDPGFAGLLELKVSREQVRRDRDALRRVLAQARDSGLSVDALGMIGAVQRSLELSEALKGLTA
KQAELRAVRFRYTDATPAVRHLAEEVKLLERQTIPRLATALMNELAVRESEVGRDVDSASGNLRRVSPLAVEEAALQRDV
TSAEQLVTNIRQRYEEARLADVSSIPDVRILDRAAVPFLPTFNLLPVLVVLGLMGGFGAGGGAAVLLDHLDRKVREPDEV
TRVMGLPILGAVPHLKQRRNGSVHEGGLPIIEAIRGIRLSVQYAHGAAGPLVCTITSPGRSDGKSFLASNLALGLADAGL
RTVLIDGDIRRGALHRVLAVARKPGLTDVLAGKATVDEVVRATAFPRVSFVPCGTRRFSGPELLGSPAMRALLANLRGRF
DAVLVDSPPLDAGVDAYLLGTLTANLLLVLRTGVTDRELAAAKLGVLDRLPVRVLGAVLNDVEPRGAYRYYSYSLEGYEL
KEEQDPDDEGAAARVLVRSPK
>gnl|bykdb|A0A2V7J5T6 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=316 residues).
QRFDQSRLAAEATVPDVRILDPAIVPQRPIKNTTPRLLLMGFVFGLGLGMVGAIVLDRVDPRVRYPEQVSRDLGLPILGA
VPHLRTKEPAEVVEALRGLRLNVAHEFGAGPVVFTVTSPEPGDGKSFVSANLALTFADGGHRTLLIDGDIRRGVLHRRFK
CNRQPGLVDFIQGHAPRDQIVQETPYPRLSIIGCGTRTQRAPEVLGSPAMADLFTELREQYDVIVVDSPPLTAGVDPFVL
GTVTGALLVVLRTGKSHRGITGAKLEVLERLPIRLLGAVLNDVPRGAAYGYYAYYSYYLPGYEAVEEAGTSGSQVV
>gnl|bykdb|A0A2V7JCT0 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=471 residues).
QLEAERRTDESLLAALRDRDSSVSRKALQTALATPGVAASPSVMQLSTQLYQYERARDSLASRSTSHPDLPRLNQLVSST
EADLLHAVQGGVQSAIASLEGRITAMNDLRARQQQLSTSEEEEARLTERVDNAQKVADELRVEYQKAKIAEAVTVGQVEI
VDHAALPAKPAGIGLPEQIALGLLLGLMLGSGGAFLAERLGSTIAQRVQVEQLGMSVIGVITHLDRDGAETGMKSPDAVV
EAFRGLRLSLVNEYGAPGPLVITVTSPGSGDGKSFVSSNLSLAFAYAKQRTLLVDADLRRGALHRVLNLRRQPGLTDFLA
GDVSRAPVVQTTSHPCLDFIASGTRRRDAPELLGSAAMTDLVTSLRSTYEVIVVDTAPLGAGVDALVLAKLARNLLMVLR
LGRTDRVLAEAKLEILRRLPLRLLGAVLNDVRDESEYRAYAYYMDGYALTNEPLFRPLAGNKQGVGSRPAR
>gnl|bykdb|A0A2V7JF48 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=530 residues).
QQSTRRREFLESQLKVNDSLLADARQAVTAFRQRAGTYGSREALAREQAGLAGVELQRQQLEAERRTDESLLAALRDRDS
SVSRRALQTALATPGVAASPSVTQLSTQLYQYERARDSLASRSTSHPDLPRLNHLIGSTEADLLHAVQGGIQSAMASLEG
RITAMNDLRARQQQLSTTEEEEARLTERVDNAQKVADELRVEYQKAKIAEAVTVGQVEIVDHAALPAKPAGIALPEQIAL
GLLLGLMLGSGGAFLAERLGSTIAQRVQVEQLGMSVIGVITHLDRDGPETGMKSPDAVVEAFRGLRLSLVNEYGAPGPLV
ITVTSPGSGDGKSFVSSNLSLAFAYAKQRTLLVDADLRRGALHRVLNLRRQPGLTDFLAGDVSRAPVVQTTSHPCLDFIA
SGTRRRDAPELMGSPAMADLVTTLRSTYDVIVLDTAPLGAGVDALVLAKLAGNLLMVLRLGRTDRVLAEAKLEILRRLPL
RLLGAVLNDVRDESEYRAYAYYMDGYALTNEPLFRPLAGSKQGASSRPTR
>gnl|bykdb|A0A2V7K2H8 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=397 residues).
MRRLATDIDVLQRQAIPGLARALHADLGARAQTLATEISAGGRELQAIPQRSIEEGRLRRDVSIAENLYASVQQRYNEAR
LGEASTVADVQVLDAAVSPQEAAKNTASRLVAFGFVVGLSLGMVAAVVVDRLDPRVHHPDQVTEQMGLSIIGVLPHVRDR
RAGPDDQQVAHAIEAMRSIRLSLTHAHGAAGPMLVTISSPGVGDGKSFVSANLALAFAEAGRRTLLIDGDVRRGSLHRAV
RARRQPGLTDFLAGRAPFEATVQGTPYPDLQFIGAGTRFRDSPELLGSGAMSELLARLRASWSVILVDSPPLGSGVDPYT
LGTLTSNMLLVLRTDATDLSLARTKLSVLDHLPIRLLGVVVNDVRPGGVYRYYSYFAGYGTRDEGVAIATHRVRGVL
>gnl|bykdb|A0A2V7KN28 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=326 residues).
QTYTALQQRFDQARLAAEATVPDVRILDPAMVPQRPVKNTAPRLLLMGLLAGLGLGVLGAILLDRADPSVRYPEQVSRDL
GLPIIGAVPHLRAKDPAEVVEALRGVRLSLANEHGPGPLLVTVTSPGPGDGKSFLSANLALTFADAGQRTLLVDGDIRRG
VLHRRFKANRQPGLVDFLRTEAGQGDIVQRTAYPRLAFIGCGTRTQRAPEVLGSPAMAQLIAELRGQHDVILIDSPPLTA
GVDPFILGTVTGSLLLVLRTGHSHRDITGAKLEVLDRLPIRLLGAVLNDVPRGAAYGYYAYYSYYLPGYEAVEETDGRRT
SSPQVV
>gnl|bykdb|A0A2V7L8K7 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=511 residues).
LLADARQAVTAFRQRAGTYGSREALAREQAGLAGVELQRQQLEAERRTDESLLAALRDRDSSVSRRALQTALATPGVAAS
PSVTQLSTQLYQYERARDSLASRSTSHPDLPRLNQLIGSTEADLLHAVQGGIQSAMTSLEGRITAMNDLRARQQQLSTTE
EEEARLTERVDNAQKVADELRVEYQKAKIAEAVTVGQVEIVDHAALPAKPAGIALPEQIALGLLLGLMLGSGGAFLAERL
GSTIAQRVQVEQLGMSVIGVITHLDRDGPETGMKSPDAVVEAFRGLRLSLVNEYGAPGPLVITVTSPGSGDGKSFVSSNL
SLAFAYAKQRTLLVDADLRRGALHRVLNLRRQPGLTDFLAGDVSRAPVVQTTSHPCLDFIASGTRRRDAPELMGSPAMAD
LVTTLRSTYDVIVLDTAPLGAGVDALVLAKLAGNLLMVLRLGRTDRVLAEAKLEILRRLPLRLLGAVLNDVRDESEYRAY
AYYMDGYALTNEPLFRPLAGSKQGASSRPTR
>gnl|bykdb|A0A2V7MB00 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=737 residues).
DQASRSEQDRGPIQQGELFGSATGWLDLLRSHVVLDDVVRQWRLYLRPKSADDNAALATLTVTGEIRPGRYRLLLDREGK
AFRLLDVAEQQVLQEGSWGDPVGGVLGVSWTPPTNAVRPGGSVDFTLATISEAAVELSEQLRIRAGQEGNFVRIARRSPN
PDQATGIANSVADRFVAAAADLKRQRLTELTAILQDQLDHAQTNLRTAEAALTAFRVRNAVRPSEGPAQGPDGRRITADP
TYASYIDLQVSLDELKRDRAAIAQLLTRSADSGVAVDRLAMIGSVQRSSELTAALKELTDRQAELRALRFRYADTHPPVR
RLALQVDTLSRRVIPGLARTLMAGLAAREQVLAQQRDSIARDLRTAPPVALSEIRLARDQANAEQLFSNLQHRYQEARLA
EVSTLPDVRILERAVRPSRPASNTAPLLIIAAFLTSFGVGVAGAVVRDRADPTVRRPDQITSAMGLPILGAVPHVRQTAP
RREPLGKHRGPEADADDGARAVEALRGIRLNVHHAAGAVGPLLATITSAGRGEGKSFVSANLAYAFSAVGFRTLLIDGDV
RLGALHRPLRGARRPGLTDVLAGSIPPELAVQNTPHERLSFIGAGSRMHRGPELLCSDAMPRLLATFRSSYDVILVDSAP
LAAGVDPYALGAATGNVLLVLRTGVTDRGLAEAKVEMLHRLPLRVLGAIMNDVRPGTAYSYYSYSLEGYEVWEEDPEGKV
SKMLLSEESKPTGAGIP
>gnl|bykdb|A0A2V7N2D0 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=837 residues).
MATDLPVGPQGGDTVPLGHGRTRGGRGTSLGYRLPPSGDTPPEEEWRGYFGSIKRWKRLVIIVTLAGTALGVVATKLVVP
SLPFYAATANIWIDGSGHRPDRDQATPGPIHSGQLLGASGWVNLARSYVVLDSVARGMRLYLGWDSEQDSAALASLELKP
QFRSGEYRLQVDSSGRRFRLLTAQGGEVQHGIAGDSIGGAVGFVWVPPASAFTPRRTIRFSVSSPYDAATNLAQRLQVEL
DPDGNFLQISLRGSDPAYIAATVNAVATRFVDVATDLKGKRLSELTKILATQLEHAQANLRSAESALRSFQIRTATVLPG
SAIIPPEALAPGANTPPQRRPPVSDLVGQSRDPVFANFLDTRVALEQLKRDRAAIERVLAQTADSGLAVDALELVGSVER
SSELTDALKELVGKRADLRALRYRYTETNPEVRRVAGEIGTLERQTIPALTRQLLGELRRREAELVRQVEWASADLRQLP
SLAIDELRLQRDVVDAEQLFANIQQRSEEARLAEASSIPDVRILDAAVEPRQPFMDAAPFLLLLSVVGSLGAGVLAAVLR
DRVDPKLRDPAHVTQEMGLPILGAVPHLNAANGKGARGLNGGGAGAAGPVIEALRGIRLSLVHAYGTAGPLLVTITSPGS
GEGKSFVAANIALAFADAGHRTLLIDGDIRRGQLHRVLNAARVPGLTNGLTEGTPLDAILQTTPYPRLSFIGCGPRTPLG
PELLGSGEMARLFASLRPRFEVILVDSPPLSVGVDPYILGTLTGNLLLVLRSGVTDRELAATKLDALDRLPIRLLGAVLN
DIRQDGAYRCYSYFPEGYELREEESAGQRKRILTAAQ
>gnl|bykdb|A0A2V7N4E0 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=256 residues).
MGLAILGALPHFAGRGDGNGAGRTPEDIAQVVEALRGVCLNVVHAYGAAGPLIVAITSPGPGDGKSFLAANLAHTFAEGG
HRTLLVDGDIRRGVLHRRLSARRRPGLTDYLRGEVPLEAILQPTGCHTLTLIGCGTRAHNAPELLGSQAMGELITGWRAS
YDVILIDTPPLGGGVDPLILGTLTGNLLLVLRTGCSDRDVMAAKLEVLGRLPIRVLGAVLNDVPPGAAYRYYSYYLPGYE
AVDEDTGRNKRQPLVI
>gnl|bykdb|A0A2V7NMY2 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=744 residues).
MVLAVTLLGTAAGVVAAAKFVGPRYLARARLWVGAAEPNPNALRGTTPPPGAERLLGVAAWVDFVRSDAVLDTVVRDVRL
YLDPKTPLDGTALLRFGLKDQVLPGRYRLEVDRDGAGFTLFSAQGGVVQHGERGDSVGPALGFAWVPGAAVLTPGRRIEF
TLLTPHDAAELLASQLQVTTDPEGTFVTVQLTGTDPQLTAAIVKGVADRTVAVAADLRRHKVAALADILGEQVRHAQASL
TAAELALKSFRVRAAGVLPAGVAAPPPSPAFTNAFELRVAVDQLGRDRQAIDRVLAQQPDSGLSVDALAAIDAVQKSPEL
TQALKELTDKQAELRALRYTYTDQHFPVQQLADAVATLDRRTIPGMLRALRNNLAARERDLGQRVDSTVRYLSNIPPLLF
EQTRLEREVQVAGQLYASLQQRYDEARVAEASALPDVRILDAPVQPYQPIGSVAPFLVIMAFLASAGLGVLGAVVIDTLD
PRFRDPGHVTQGLGLRILGALPHLSRAGNGEGTAQAIEAMRTVRVKLQHASNGGNPLLLTVTSPGVGEGKSLVSANLALA
FAYAGLRTVVIDGDIRRGALHRLLRGSRRPGLTDHLTGRAPLEKVLQTTPYKCLSFIGCGSRMHNSPELLSAATMVDLLA
ALRSRYDVVLVDTAPLAAGADPYTMASLTTNLLMVLRAGVTDLELAQAKLESFEDLPVRVVGTVLNDVQPKGAYRYYAYY
VPGYETKEEADLGPEKPVLGVPSV
>gnl|bykdb|A0A2V7NW82 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=282 residues).
MAGLGLGLLGAVLIDRFDPRLRHPDQVTYGMGLRILGVLPHVRDRRVGQDDEHVIQLVEAVRSVRLSLAHAYGAAGPMVV
TLTSPGVGDGKSFLSANLALAFAEAGHRTLLVDGDVRRGALHRALHATRQPGLTDFLAGRAPLEAIVQETTSPSLHFIGS
GTRHRDAPELLGSPPMVELLTRLRTSHRVILVDSPPLGSGVDPLTLGTLTGSLLLVLRAGASNLDLTRTKLALLELLPIR
LLGVVLNDVPAAGAYRYYSYLSGYEAADEPESVAVQRVRALL
>gnl|bykdb|A0A2V7PL95 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=805 residues).
MTMDNLPTRFEEPTAPAWQASGTGYAVGRAAAGESDWLDEIGRYLRAVRRHKWLVLGTTLLCAGAGIVLARVKLQPTFIA
RASVWIQVPSAHVAREPGPIWSGQLPISSGWEELVRTNIVLEDVVRRRRLYLDYKNAADSDLFATFDIKQRVRPGAYRLV
VNDSGNGLTLSFKRLLFPSARNVLERPAVGDSVGVAQGFAWVPRAGALRPRRKVEFTVAGPSDAAKALGRALKMAADPDA
NFLRLELGGPDPVAVTATVNAIAERFVAAAADLKRDNLVQLTGILDNQLDRAQATLRDAEAALKTFRVRAVTQFADGAGS
VTPNLRYPQDPVFAGLLDMKVEREGLVRDREAINRLLAKPDSGVAVDALAMIASVQKSTELSQALRDLTAREAELRALRA
RYTDATPNVRRLAGEVAALEHRTIPAMAAALTQELAVRAGELEHLVDSAAGGLRRVPPLAVEETRLQREVTMAEQAVVNL
QQRHEEARLATVSSLPDVKLVDPATEPQEPATNWAPLVIGLALIVGLGAGVTGAVVLDRTDRRVQYPEDVTSTMGLNILG
VVPHLGRNGHAKHHEGVLQVLEAVRAIRLNVLHAHGVGPAIVTVTSPGRADGKSFLASNLAVAFADAGYRTLLIDGDIRC
GTLHRVLKRPRRPGLTDVLAGNATTAQAIQQTTYRTLSFIASGTRTHGGPALINSAALPRLLAELRPYHDAIIVDSSPLS
AGADAFALGTAAGSMVLVLRTGVSDRALMQTKLGVLDHLPIRVLGAVLNGVVPGGVYRYYSYYLEGYEAKDEPAGAAGQV
LRAPE
>gnl|bykdb|A0A2V7Q431 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=269 residues).
FLADHLNRSVHRREDVAHLGLPVLGVVPHAKGGSNEDAAPIVEAMRGIRFNVLHAYGAAGPAMFTITSPGSREGKSFVAS
NVALAFADAGHRTLLIDGDMRRGSLYRILNTRRKPGLTDVLHDEVSAEDVIQPTRYPPLFFVGCGTRTPDAPELLGSEAM
SRFIAGVRESFSAIVIDSPPLGAGVDAYALGAVTGNVVLVLRLGTTDRETTEAKLDLLDRLPVRLLGTVLNDVPEHSAYA
PYSYYMEGYAYEAERGREPRTLTGGRSRS
>gnl|bykdb|A0A2V7Q893 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=802 residues).
MTTGGLATLLDTTKSQRLPTVGDRKAAERRARPTPPDGGDWIGEAQRYLRSVRRHKWLVLSLTLFATAAGVELSMYALPP
NYAARATVWIQVPARQARDEGPIWSGHLPISSGWIDLIRTNIVLEDVARRERLYLTTDAGDAAPLTTLAIKERVRPGTYR
LAVDTTGTAFTLSDAAGAVLDRGAVGDSIGAPLGLAWVAPAGMLRAGDVVNFTVTTPAEAATRLRRELKVSSDVDGNFLR
IELAGPDAAAVTGTVNAVATRFVATAADLKRDNLTQLTGVLAAQLEQEETKLRSAEGALQRFRVTAVTEYGDGAAPVTSN
MRSPQDPVFAGLLEVKVRRGELLRDQAAIKRILAQPPESGLIVDALATIGSVERSTELSQALRDLTAKQAVLRALQARYT
AEAPVVRRVAAEVATLERQTIPMLATALAREMGLRAAELEHRADSVARDLRRIPPLAAEENRLQRDVTQSAQAVANLQRR
YEEARLAETSSIPDVRLVDPALEPQEPTENWAPVLVLFTMISGLGAGVGSAVVLDYRDRRVHDPEDFTRTIGLKILGVVP
HLERKGRNRAPEDALHVLEAMRGTCLNVLHAHGTGPVIVTVTSPGRADGKSFVASNLAVAFADGGYRTLLVDGDVRCGTL
HRTLKLARRPGLTDLLQGRAGQEQVVQPSAYGTLSFLGCGSRTHDGPALVSSAALPRALAGLRSSYDVIIVDSSPLAAGT
DAFALGTATGTLLLVLRTGVSDGGLAQAKLQVMNHLPIRVLGAVLNDVRRDRLYRNYSYYLEGYEAQDEPDGARGQVLRA
PV
>gnl|bykdb|A0A2V7QD43 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=418 residues).
KQAELRALRYKYSDQYPLVQRRLSDVATLERQTIPTLARRLLAELSGREAELGRRVAEDTRSIQAVPPRAIDEARLQRQV
TLAENLFTSLQKNYDEARLAEESAVPDARILDHAVVPQDPVRNTAPRVVFLGFAASLALGLCGAVVLDRIDPKLRYPDQV
SRGLGIPILGAVPHLRNLPRGGRGSGARVPDDVNEVVEALRGVCLNLVYAHGGRAPLLVTITSPGAGDGKSFISANLAHT
FADGGHRTLLIDADIRRGVLHRRLSVRRRPGLSDFLRGEAQLDVIVQATQFPALSLIGCGTRAYNAPELLGSPAMTSLVN
GLRGSYDVVLIDSPPLAAGVDPLILSTLTGTLALVLRTGYSHRDVAAAKLEVLQRLPVRMLGAVLNDVPAGGAYRYYSYY
LPGYEAMDENSGSPRVPV
>gnl|bykdb|A0A2V7QPQ4 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=805 residues).
MATFDSPSSGLPQLSHPRRTAPLGPYDAAHGPAQMEPDPGVVDWRRVFAALLRFKWVVVLVTVLGTAGGVVLSRVIKIPY
TTHATVWVDVPDVRAHDEGPIQTAGLVGASGWVDLLKSNAVLEDVVRRQRLYLALDSPDDTGAVKSLGVKERVQPGAYRL
VVTAQGGRFLLLDGHGVTLQQGAVGDSVGPALGLAWVPAASALRPGRTIAFALATPPSVAAGLADQLRVQTDMMEGKVGN
FISFELRGTSADTITAVVNAIADRFVLVATDLRREKLSALVKILGDQVQNAQLNLTRAEQRLRDFRVHSVTLLTGTPAPL
LVPAPQGRDPAAANFFEMKVSSEELRIDRTALARVLAEGADSGPSTDALEMIPSVQQSSVLTQALGELTEKQATLRALGY
RYTAGLPQVKRLAVEITQLERQTIPTMVRALIAQLGAREAAVTQRIDSAAGGLRQIPPLAIEDARLDRDVTIAAQLFANI
QQRYAEAQLADVSSIPEVRILDRAPHPDTPLFNIAAVLIVLAFVGSGVAGVLGVVALDHLDSRVRHPDQVTRAMGLTILG
AVPHVGQRNGKGDQVAPVIEALRAIRLRVVHAHGSAGPIAVTISSPGRSDGKSLIASNLALAFADSGYRTLLVDGDVRRG
ALHRVLKTARKPGLTELLAGTASREEAVRATAYPSLWFIGCGARSQQGPERLTSAPMVRLLADLRPAFDVILVDSPPLAA
GADAFALGTMTGAMLLVLRTGFSDREQAEAKLDVLARLPIRVLGAVLNDVRLGGEYRYYSYYMAGYEAEDEHPAWDDRPV
LQPSD
>gnl|bykdb|A0A2V7RBS9 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=725 residues).
MLPPRYLVQATIWIQSSEARGTPDRGPIGANQLLAPTAWGDLLKSYVVLDAVARERRLYLQARPRDLPALAGFAVADQFT
PGRYHLTIDHDGQTFHLQREDGTELEQGAVGSPVGRTLGFIWTPTTAVLTPGREVRFVVSPLRDAAKKLADNLNVTLDLS
GNFLRVALTSPNGTDAAATVNAVADRYVAVATDMKRVKVTELSRLLNEQLQAAEANLHKAERALEDFRVRTIMLPAEPVA
GTATRTSPVSEFLTRRVQEDQLRRDQDALAQLLAQGPDSLGFSERLAAIGAVQGSADLTRALSELTTKRADRRALLYRYT
DDHPAVRRVTTDIDELEHQTIPGLIRGLLAELGTQRRGLASQLETGGRELQGIPQRAIEDARLRRDVSIAENLFTSVQQR
YSEARLAEASSIADVRVLDAAVAPETPVKNTAVRLLIMGLFAGLGLGVVGAVVIDRFDPRVRYPAQVTTDMGLRILGALP
HVKKRAGASDDESGALVIETMRGVRLSLIHAYGTAGPLVVTITSPGPGDGKSFVSANLALACAQAGQRTLLIDGDTRRGA
LHRVLGAVRRPGLTDFLAGHVSFEGLIQTLKFGSLQFIGGGSRIRESPELLGSPRMVELLVRLRAMYPVIIVDSPPLGAG
VDPYTLGTMTGAMMLVLRTGATNLDLARTKVAMLENLPIRVVGAVLNDVRLGQMYGEYYGYMAGYGTTTEDGGTRIARRR
LQGAL
>gnl|bykdb|A0A2V7SCT4 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=811 residues).
MRGSCKTVGAVSDLLRGQAMISDNLPAIRARAAPVSPRRAPPSLAAAEEETGLDWRRSAIALSRFKWVVLLTVVLGTAAG
VAATRFVRPEFVAQATVWVDVPDRRGAADRSGPLRPEQLLDAESWVDLLKSYVVLDQVAREQRLYLGLKTPQDSAVFTSF
QVAEDYRPGDYRLAVQGDGRGYDLATADGVPLERGAVGDSVGARLGFRWVPPAGALPSGRTIDFSLTTLRDAARWLGDAL
GVQMDPNGNFLKVDLRGKDPRRISVILNAVTQRYVQVAAELKRQKGTELTKALEEQLNTAHTNLQQAEAALQTVRAQTIT
LPSDRPLTSAPGPERRDPVFTNFFDMQIERDQLRRDREAIERLLADARASALPADALSLIGSVQHSAELSQALKELTDKQ
ATLRGLQYRYQDDYAPVQRLKAEIADLENRTIPTLARTLVAQLAARETEVGRQVNATSHELRQIPPRALEEERLRRSLTL
AEELYTTLQRRYEEAQVSERTIVPDLRILDAAVVPRRPVKNTAPRLILLAFCGSFGLAVVGAIMLDRIDPRVRYPEQVSH
ELGLPILGAVPHLKDAAEPAEVVEALRGLCLNLVHAHGAAGPLLVTITSPGAGDGKSFLASNLALTFADGGHRTLLVDGD
LRRGLLHRRFNANRKPGLIEFLHGDAAREQIVQPTSYPWLYLIGCGTRTNRAPELLGSAAMGQLVAALRQEYDVILIDSP
PLGAGVDPFILGTVTGNVLLVLRTGYSHRDAAGAKLEVLNRLPVRTLGAVLNDVPRGAAYGYYSYYSYYLPGYEAVDEDD
SLEAHSRPRVV
>gnl|bykdb|A0A2V7SVD5 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=714 residues).
VEPSYEARAKVWIMSPKPTNGPQPTGPIRAEELLPQSSWAELFQSFAITDSVVAKRGLAATPEDAKDRPAFMRFATSERP
IIGDYSLRVDAKGQRYTLTRKADGTVVDTGTVGDSIGRTVGFRWAPTPQMLKPGRTYNFNVVTPRDASTALLAKLKPPPA
VAPNSNFMNVTLVDNDAVEAAATLNTWLTEFDSTALWLKRRNVSEYSKLLEVQRQYANDKLKDAELRLEGFRTRTITMPS
EATIVTPGLQETRDPVFRSFFEKKLESSDLRQYADALARAMTAGPAAPEAISAIPGLLTQAGAKDLSILLDELTKRQGEL
RDAQKVYTDEFSKVKDLQKQIADLRARAIPAAARNFLAQLRSRENSLNAQLAATSEEIRTIPTRSIEEQRLRREQAMYEG
MYTNLSARYADARLAESSAMPDITILDRAAPANGVVTFRDLKIIGTAILIALGLGLGLSVMLDRLDHKFRHLAQVNADLG
LAVLGTVPQIAQPPRRAKPEDAAEVIESFRGIRLRLQYAYSANQPLVCGVTSPEQGDGKSLVASNLALAFAEAGYRTLLI
DADTRRGSLHDVFGAQRRPGLIEVLSGEVTRAEVMHPTTQERLSLLPCGGRRTTNPELIASPALPRLLSELVGEFSVIIV
DGPPLSAGENTLMILRHSKTDMRMAKTKLALLRRLPLRTVGVVLNDVKAMGDYKYYGYDTAYRALPEERAVATV
>gnl|bykdb|A0A2V7T7Z8 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=783 residues).
MAGAPRAGGAPPPSAEGDWLADARRYLIAIQRYRWMVFGLSALGLLVGFAFAGVVLAPGYAARASLWIHGPAGQEGEPGP
LWSGRLPISAGWSDLVRTNIVLDDVVRGERLYLTNNPASDTVLATFAINQQVRPGRYRLVVDNGGTAFTLRDAAGRVLDR
GAVGDSVGARLGFVWVPSPGTLHAGETVAFTLITPSAAAAWLTRELKVSPDPDGNFIQLELYGPDASRTTAIVNAVAARV
VAVAADLKRANLTQLNAVLGGQMRRAEADLRSAEGALQRFRMQAATQLADGSGSVTANFSAPTDPRFARLLDVKSRRTQL
LRDREAINRILARSSGSGPVVDALATIGAVAGSTELSRALGELTQKQAMLRTLQVRYTAESPLVRRLTGEVATLEQATIP
ELAAGLARELERQAAELERQANATARDLRRIPPLAVEQAALQRAVTSKEQVVADLRRKYDKVRLAVTSSIPDLELVDPAV
EPQEPSDNWAPVIVMFCAITCFGAGACGAILLDRTDRRVHDPDDVAHKMGLKVLGVLPHFDSPPPPLWAARSEGGVKLIE
AMRGIHVNVLHSHGVGPAIMTVTSPGRADGKSFVAAYLATAFADAGYRTLLIDGDVRCGVLHRAVKLLRRPGLTDLLGGE
AIEAQVVQRTRQGGLWFIGCGTRTRAAPTLVGSGALPRALARLRPNYDAIIIDSSPLAAGADALALGTAAGSLLLVLRTG
VSDGALARVKLYDIRRLPIRVLGAVVNGVRLRRGSSQDAYYLEGYEAKDEPESVGGPVVGASG
© 1998-2019