BYKdb

Dataset for cluster tadcd of phylum gemmatimonadetes

[Download (right click)] [Alignment] [Repertoires]

89 sequence(s)

>gnl|bykdb|A0A0H4TUX7 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][uncultured Gemmatimonadetes bacterium Rifle_16ft_4_minimus_7] (length=824 residues).
MNLRSGTWSHSLSFLSSATTWENRLDAVRRPEGTEALRRIVHQREVHLRDLVGVVSRHWRLVALLTVLVAGGAWYSARRQ
VPRYQSRLTVQVSSPKQVFAQLEGMRVDELALQTDPVLSEALILTTQQLALEVVRGLALHLELDDPGLRRGDLFAAVAVD
STTPPGAYRLTVQPTSGFEVRDGFGTVVAQGQPGETVVGPGFTLRLVPSPEARTVGFRLVRPEEAAAWVSGGLSYNVREG
TNAVDISFAGTDPTLVPQILNAAAVALRLDGVRRAQEIAARKRTYVAEQLAKADSSYRIKLAELQRFKEGEQITDLSVEE
QSVVQSIQALEQQRQQITVQIATLREALGQPGDSIGVGTLNRLAAVQDIGQNTALGFQIQNLLTLYDQRRTLTAGALGLR
ERNPQVDALSERIRQGYQALRGAVSAALESLESRTEALDQRVASARARLRTFPGKESRIAQLQLEASILNDTYRYLLTEY
ESARLTEATIGPYINLLDPASPAFRVGTTLRQKIVLGMLVGLLLGLGGAFFLEYLDQTIKNAGDVERVIGVPVLGLIPHD
PALRRSGNGKPPITIVAREGMDQPAAEAFRALRTNVTFVGAEKPLQFMSVTSPGPGEGKSTTAVNLAVALAQGGQRTLLI
DGDLRRPLIHRAFALVQEPGLTDVLVGRATAREAVRPDAAPGLDVLPSGSIPPNPSELLGSAAMHSLISALRRDYHYIII
DTPPTLPVTDASVVASGADAAILVLRSGDTQETAAQRALEQLRRVHARIAGAVLNGVSSRHDRYYTYYSYRREPARRGLL
TAGSPRAGGCSPFGRSSAIPSENQ
>gnl|bykdb|A0A0S8H9P3 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonas sp. SM23_52] (length=752 residues).
MGRYERTHLEDYWRVVRRRAWLILLTALVALLAATWAASRRPRLYRATLTLQVGDPRGRMGQLGDIDVTPNMLWTDPVES
EVQQLTTQAVAQYVADTLQLRARSPDISRDLLLSGVRIDREAPSGDYRIRVGSDGSVFIEPGSGAPAVRGQVGEPIEFTA
GSLVVRPQIEPGDYRVHVISQLAAEAVVTGGLAASTRPETNLIDVTYSGPDQRLVPRTLNAVAAALRDLGVRRVRQWARG
RTRFIRDQLDESGRQLREALQAVQDYKGRRGLISLTVEESRVMQRVATLQTEIEQLLIEKSLYTSLVDRIGSVGLRPGDV
QQFVVLSTEEVNRTVQFYYDQLLELLEERSSQLGPLGKDPSHPVIMALDQRISETQDQLVAAAENAAVALDTRIGALTGR
LSNLQAELRQLPAVESELTRLQNEVEIHSDMYKYLLSRYQESQIAEAEISPYVEVLDPASWARPVSGGRRINIIFGGLLG
LLLGLGAAFFLEYLDRSLKSTSDVETSLGVPVLGWIPKITGDGQRRISLVAAHDPEGVAAEAYRVLRTNIAFSTARERPL
SSLAFTSPGPDEGKSTSVANLAAVLADRGDRTLLVDADLRRGTLHEDFDLLRSPGLSDLLVGELDPREAIRPAVRPALDL
LPAGKRPPNPSELLGSQAMAKLLASWREEYRWVLFDTPPVLAVTDASVLAALVDGAVLVVKAGETDRRAGWQAIQQLRRV
GARVVGAVLNEIVLQRGADRYYFDYYYSRSSS
>gnl|bykdb|A0A1E4BBP7 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium SCN 70-22] (length=818 residues).
MSANLVPSAANAAAVPRQDGFAPMPQWGGAPSAPPPSQGGVGDQLARTLAAIKRYKWLVLAVIAVGSTAGVTLTRFVKPK
YDVSASIWIAATPGPSGRMGPVSAPGLVNSDVAWMELARSFSVLDKVVSKLALYVYPDVAADTLVVRDLYPSDSLQPGPY
RLTIQGSSYVLARPAQQRGEQDVVVERGAVGDSIGRAVGFQWQPSAQLLAGREQVGFYVVTPREAAFNLGSQLSVTVGQN
SNLMRFQLSGSKAGLLATTLNTLAREFVSEAVRLKRENLTVSAEATEEQLQQAAQQLAAAQTALERFKINTITLPSEQMA
ITPGVSTTMNPVFQAYFSDRVNYEQVRRDREALERIVEEGRGRGGKISLEALRSVGSATASNTSLQAEIANLNQARGQLV
NLQKTYTDEYRMVKDLKQQIEVMESQSIPTLVASSLQELRSREAEMKRRIDGASQELKQIPARTVEEMRLNRELQIAQTM
YVDLQQRAMSARLSERNALPDVSILDTAVAPRFPSSDTTLSIILVAIAASIGLGLALAILLDRLDKRFRYPEQATHELGL
DIVGAIPTYRNPTSAAARLEEASQLIESFRTIALSVRSAFEGLGPVQLAVSSPGPGDGKSFVSANLASALADSGYRTVIV
DGDIRRGTLHDIFAPCAQAPGLVDYLAGEATLDEVLRPTQQHINLSIVPCGKRRRHGPELLASERMTTLIRDLRTQFDAI
IVDTAPLGAGIDPFAIGTATGSMVLVLRAGETDRKLAQAKLTVLDRMPIRLVGAILNDIGELPQFKYYYYLEGYRALEGA
EEGNAALLGSGSGGNGRG
>gnl|bykdb|A0A1G0L906 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium GWC2_71_9] (length=773 residues).
MHLRDLAQVLFSHWKVVVFLTVLVVFSTSYASRKAVPRYQSSATVQVSSKKQALTPLEAMRVDEMSMQTDPVLSEALVLS
TQALALRVVDAIGLRLAMDDWRLSRTTFLYDAQVDTLARPDSFVLELKGTGYQLRSVAGGTLVAAGGYDVPAVGSGFSFR
VREYRGDPRSVRISIMPRIAAGNMVRGGIGFAVPPTTSLVNVTFTGTDPSLVPEILNEALIALQNYGVDRVRDVASLRLR
YINERVDDARTRYLSALSGVQSYKESENTTNFTAEEVAIINSIHGFDREKERLQVDLSTLQGIMGPEAQVTLETLNRLAA
LTGIANNTAMTFQIQNLLKLHDDRRTLVAGSLGLRESNPQVQAIDQRITQAAAALREAANATVRGIQANIASLDQNVANL
RQRLGTYPGKETRFAQLALDIELQNGIYKYLLSELESARISAATISPYIQIVETATVAARIGVGTRQKVTIGLLVGLFLG
IVAAFFLEYLDQTIKTAADVERALEIPVLGLIPLDPRGPHDGPQRNGRRRASISLISHAAPDDPTSEAYRALRTNVTFVS
AEQHALQLICVTSPGPGEGKSTTAANLAITLAQQGARTLLVDADLRRPVVHRAFNLVQEHGLTDILVGTATLRETVRPNL
IPKLDILTSGSLPPNPSELLGSEAMHRLLEEVRSHYDNIIFDTPPALAVTDAAVLGAGSDAVILILRAGKTEEVAAQRAL
AQLSRVQARVAGSVLNGVQKMRDRYYYYYYYRKDPRTTRGLLSALREQIAHLF
>gnl|bykdb|A0A1G0LCC0 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium RIFCSPLOWO2_02_FULL_71_11] (length=773 residues).
MHLRDLAQVLFSHWKVVVFLTALVVFSTSYASRKAVPRYQSSATVQVSSKKQALTPLEAMRVDEMSMQTDPVLSEALVLS
TQALALRVVDAIGLRLAMDDWRLSRTTFLYDAQVDTLARPDSFVLELKGTGYQLRSVAGGTLVAAGGYDVPAVGSGFSFR
VREYRGDPRSVRISIMPRIAAGNMVRGGIGFAVPPTTSLVNVTFTGTDPSLVPEILNEALIALQNYGVDRVRDVASLRLR
YINERVDDARTRYLSALSGVQSYKESENTTNFTAEEVAIINSIHGFDREKERLQVDLSTLQGIMGPEAQVTLETLNRLAA
LTGIANNTAMTFQIQNLLKLHDDRRTLVAGSLGLRESNPQVQAIDQRITQAAAALREAANATVRGIQANIASLDQNVANL
RQRLGTYPGKETRFAQLALDIELQNGIYKYLLSELESARISAATISPYIQIVETATVAARIGVGTRQKVTIGLLVGLFLG
IVAAFFLEYLDQTIKTAADVERALEIPVLGLIPLDPRGPHDGPQRNGRRRASISLISHAAPDDPTSEAYRALRTNVTFVS
AEQHALQLICVTSPGPGEGKSTTAANLAITLAQQGARTLLVDADLRRPVVHRAFNLVQEHGLTDILVGTATLRETVRPNL
IPKLDILTSGSLPPNPSELLGSEAMHRLLEEVRSHYDNIIFDTPPALAVTDAAVLGAGSDAVILILRAGKTEEVAAQRAL
AQLSRVQARVAGSVLNGVQKMRDRYYYYYYYRKDPRTTRGLLSALREQIAHLF
>gnl|bykdb|A0A1G0LUG0 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium RBG_16_66_8] (length=764 residues).
MHQREVHLRDLVAVVTRHWRLVAAVTAVLVGFSWYNGRNQVARYQSQLTVQISSPRGVFSQLNDRTVDELALQTDPVLSE
ALVLTTQALALQVVDALQLQVELTDPRLRRDDVIAAIAVDSSSTPGRFALVRRGPDGYEVQDASGAAVGGGAYSQPVTVS
GVTLTVQPTTSEDVVPFRITRREEAAAWVSGGLSYRVREATNAVDITFTSTDPLLVPRILNAAGLALQSDGVRRAREVAA
RRRAYIAEQLAGADAAYKGKLTELQRYKEGQQITDLSAEELSIVQSIQTLEQERQLLAVQLSTLRGSLGDSATQIDVGTL
NRLSAVQGIAQNNALGFQIQSLLTQYEERRKLTAGALGLRERSPQISALDDRIQQGHQALRTAVGAALESIEARRQALDL
RVQELRGTLGTFPGKQSRIAQLQLETSIHNDTYRYLLGQLEAARLQENTIAPYINLLDPASPAFRIGRTPWQTAMLGLLV
GLLLGFGAAFLLEYLDQTIKSAADVERALGVPVLGQIPDDQRLARGNSHRGTVGIITQLPHDEPSAEAFRALRTNVTFVG
AERPLQLISVTSPGPGEGKSTTAANLAVALAQSGQRTLLVDADLRRPQVHRAFSLVQEPGLTDVLIGRVPAREAIRPEVQ
PQLDVLPSGPAPPNPSELLGSHAMHALIGELRRSYDYIVMDTPPTLPVTDAAVVASAADGAILVLKSGDTEEVPAQRALE
QLRRVHARVAGAVLNGVNQQKDQYYTYYASREAPRRSRTSLFTR
>gnl|bykdb|A0A1Q6WE01 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium 13_2_20CM_70_9] (length=796 residues).
MTEYLPGVAASPLVREAPLPVPARVTTAPDPVASPFEQGVDWRRCWGAVRRHRWWILGCAVLGTAGGVVGARMRPPRYQA
QATIWIQAGEPRGPDRGPIGANRLLDASAWVDLLKSYVVLDDVVRDRQLYLGVVARDTRALTGFAVGDPVMPGRYRVVLD
RSGSTFRLLGDDGVELQRGTVGDSIGQAVGFRWAPAAAVLPPGSEVTLIVSSVRDAAKRLGDELNVTIDPNGNFLRLSLS
GTDGPTVAATLNAVAQRYVDAALKLKRAKLSELAALLAEQLQSARASLQRAESAYEAFRTRTITLPPDPGAAAAAAAGVQ
SPMSEFFGLRMAYDQMRRDQLAVAHVLTQAHDSAASIDALAAIGAVQQSLDLKQALSELTTKRAELRALRYRYTEDHPAV
RRLTTDIDVLQRQAIPGLARALHAELGARAQTLATEISAGGRELQAIPQRSIEEGRLRRDVSIAENLYASVQQRYNEARL
GEASTVADVQVLDAAVSPQEAAKNTASRLVAFGFVVGLSLGMVAAVVVDRLDPRVHHPDQVTEQMGLSIIGVLPHVRDRR
AGPDDQQVAHAIEAMRSIRLSLTHAHGAAGPMLVTISSPGVGDGKSFVSANLALAFAEAGRRTLLIDGDVRRGSLHRAVR
ARRQPGLTDFLAGRAPFEATVQGTPYPDLQFIGAGTRFRDSPELLGSGAMSELLARLRASWSVILVDSPPLGSGVDPYTL
GTLTSNMLLVLRTDATDLSLARTKLSVLDQLPIRLLGVVVNDVRPGGVYRYYSYFAGYGTRDEGVAIATHRVRGVL
>gnl|bykdb|A0A1Q6ZHP2 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium 13_2_20CM_2_69_23] (length=821 residues).
MTISNLPAPLGPAPMAAPGMPQRGISVFDLDGRESGVDWRRILSALLRFKWLIATTTLVGTIAGVGATRFLKPQYSAQAK
IWIDVEGRRGPERGPTPIRSGQLLDAESWVDLLESYVVLDQVVRDQRLYVSPNAPADAQAVAKLGVADQFQAGAYRFTVD
HSGQGYTLATADGVELERGTLGDSVGSRYGLRWVPDASTVAPGRVVEFTLTTLRDAATSLGEGLDARMDQEGSFLRLELR
GANPVDITAIVNAVAQRYVTVYADLKRQKLIELTKILGEQLQHAQENLHGAEASLQRFREETITLPGDRPSVGGASVAGA
AVGGPGATGAVAARDPVFGSFFDMQISREQARRDRDALDRLLAQAGDSGLSAEALSVVGLVQANPELTQALTELMTKQAE
LRALRYKYSDAYPPVQRLLGEIATLQRQTIPTLARQLAGQLAAKETELGRRVDADSRTLKQIPARAIEEARLRRDAALAE
NLYLSLQGKYDEARLAEASTLSDVRVLDSAVVPRRPVKNTRRRVILLAFFGSFAMAVVGAVLIDRVDPRVRYPDQVSREM
GLTILGAVPHIRAGARPERSGRRVRPPEDVAVVVEALRGVCLNLVYTHGAVAPLVVTITSPGAGDGKSFLAANLGHTFAE
AGHRTLLIDGDLRRGVLHRRLGARRRPGVSDFLRGEVPIEAIVQTTPYPSFSLIGCGTRAYNAPELLGSQTMSQLLTTLR
PSYDVILVDSPPLSAGVDPLILGTLTGHLVVVLRTGFSHRDMASAKLEVLQRLPVRLLGAILNAVPAGEAYRYYSYYLPG
YEAVDEEAERASGGKGQPFVI
>gnl|bykdb|A0A1Q7AZK2 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium 13_2_20CM_2_66_5] (length=750 residues).
MLLRFKWVVILMLALGLGAGFAATRVLRPVYRAQANVWVDVPDRRGNGSSDARGPIRQGALLDADAWVELLRSYVVLDQV
VRDLRLYLKVKRTSDRATFDAFRVNDIFRPGDYRLSVSDDGRQYTLASAEGVDLERGTVGDSVGNRLGFRWAPPAGSLPP
GRTVEFSVVPPRDAALRLGEQLDVRMDMNGNFLALELRGPNPVLITSILNAVAQRYVEVAAQLNREKLTQLTKILEDQLT
TAKRNLDSAETALQGFRTRTITLPSDQAADRKAAADTRDPIRTSFFDMAVERDQLRRDGDAIDRLLAQGGGGDGLPTEAL
SAIGSVQHAPELSNALKELSDKQAQLRTYRYHYSEAYPPVQRLAREISELQQRTIPTLARALSAQLATRESELGRQVGAA
SRDLRQIPARDIEDVRLNRNAQLKEQTYTALQQRFDQARLAAEATLPDVRILDPAVVPQRPVKNTAPRLLFMGLLGGLGL
GVLGAILLDRADPRVRYPEHVSRDLGLPIIGAVPHLRAKEPAEVVEALRGVRLSLVHEYGPGPLLVTVTSPGPGDGKSFL
SANLALTFADAGHRTLLVDGDVRRGVLHRRFKANRQPGLVDFLLGKAGLDEIVQGTEYPRLAFIGCGTRTQRAPEVLGSP
AMTQFIADLRNQYDVILVDSPPLTAGVDPFVLGTVTGALLLVLRTGHSHRDITGAKLEVLDRLPIRLLGAVLNDVPHGAA
YGYYSYYSYYLPGYEAVDEGDRQASGARVV
>gnl|bykdb|A0A1Q7DLS9 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium 13_1_40CM_69_22] (length=798 residues).
MFNDLPELPPSSPETPGRATVPAPARRRSPPMVEAAPDVDWGRYRTAIWRFRWWVLLITLLGTAAGVGASRIVRPVYVAR
ATIWIEGANEKQPGPGPAGSGDLLGATGWVDLVRSYVVVAAVVNDRQLYLTPASPSDSAVFAGFSVAPRFRPGSYRLEVD
QAGRGFTLATHDAVVLQRGAAGDSVGGALGFVWLPPAAELSPLRRLEFVVESPHEAASRLAERLRVKTDLEGNFLRVELR
GQDPRKITVIVNAVAQRFVAVAADLKRQQLTELVRILGEQLNHSQVNLSAAESALRDLLSKTVSFVADGATPVAPGLQFT
HDPGFASYFETKVNLEQVRRDRAAIERLLAQVRDSGLPVDALAAIGAVDRSTELVAALRELTAKRAELRALQQRYTEEHG
TVRRLAGEVQALEGRTIPALARVLVSELAARDAELTQRVRAASAELRQIPSLAIEDARLRREVANAERLFTSIQQRYDEA
RLAEVSTIPEVSVLDAAVEPEEPLLDPTPFLVLVSFLGSLGLAALGAVVLERADRKVRYPDQVTRTMGLPILGAVPHVSW
HDGANGDGVSRVIEALRGIRLNVLHAYGTAGPLLVTVTSPGRSDGKSFLTSNLAVAFVDAGYSTLLIDGDIRRGGLHRVL
DAARTPGLTDLLAGTAAVQQVIQQAKSYPSLAFIACGSRTRSGPELLSSTAMAGFVTSLRSRYAVILIDSPPLAAGVDAC
ALGTMTGSLVLVLRTGVSDRELVEAKLDVLERLPIRILGAVLNDVRPGGAYRSYAYSLSGYDLHDEEEPPKRILRSVE
>gnl|bykdb|A0A1Q7DVU6 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium 13_1_40CM_69_22] (length=811 residues).
MKESPETDMETGDLPAALDPERPERLPSTAAPFDTIARYAPPAAGAPRDADALAELRRYLSAVWRYKWAVAGVTVLGTAA
GVAGKMLLAPSYVARATVWIQVPQRPTRDEGPIWSGQLPISSGWTDLLQTNVVLEDVVRQQRLYVTPKEPGDADALTGFG
IKDRVRGGTYRLVVNDAGTAFTLEEKKAGVLQHGAAGDSVGAPLGFVWVPPAAALTRGRTVEFTVSAPYEAARALGKRLK
TSLDLDGNFLRLELGGPDAAGITAVVNAVAERFVAAAADLKRQNLTELTRILNGQLERAQANLRDAETTLKTFRVSAVTE
YADGAAPVTPNMQFPRDPVFAGLLDMKVSREQLRRDREAIARILAQGRDSGLAVDALAMIGSVEKSTALIQALRDLTGKV
AELRALRGRYTDANVAVRRVSDEVAVLEQQTIPALATKLTQEMAVQERVLAQRVDSAAGGLRRIPPLAVAETQLQRDVTL
AEQVVTNLQRRYEEARLAEVSAIPDVRLIDPAIEPQQPAASWSVLLVALAFLGSLGAGVAGAVLRDRTDRHVHYPEHVTG
TMGLAILGAVPHLERGRNGKKSGAVLQVVEAVRGIRLNVLHAHGAGPAVLTVTSPGRSDGKSFLASNLALAFADAGYRTL
LVDGDVRCGTLHRALKLARKPGLVDVLGGKASTELVVQATSYRALSFIGSGTRTHTGPSLVSSAALPRLLATLRPGYDAI
IVDSPPLAAGADAFAIGTATGSMVLVLRTGVSDRELAQTKLEVLAHLPIRMLGAVLNDVRGGLYRYYSYYLEGYEVKEEP
EPAWQLVRAPE
>gnl|bykdb|A0A1Q7DXB9 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium 13_1_40CM_69_22] (length=798 residues).
MAHEGPSLPESARLEAIAATPRPRAPTRYDQPPRLLPAVEPDWRRIFGAIRRRRWVVLGVTLLGTVAGVVAAAKFVGPRY
LARARLWVGAAEPDPNAIRGTTPAPGAERLLGVEAWVDFVRSDAVLDTVVREVRLYLSPKTPIDGTALLGLRLKDQVLPG
RYRLEVDRDGQAFALFSAEGVVQRGERGDSVGPALGFAWVPGAAVLTPGRRIEFTLLTPHDAAELLASQLQVTTDREGTF
VTVQLTGTDPQLTAAIVKGVADRTVAVAADLRRHKVAALADILGQQVQHAQASLTVAELALKNFRVRAAGVLPAGVAAPP
PSPAFTNAFELRVAVDQHGRDRQAIDRVLAQPPDSGLSVDALAAIDAVQKSPELTQALKELTDKQAELRALRYTYTDQHF
PVQQLADAVATLERRTIPGMLRALRNNLAAREHDLGQRVDSTVRYLSNIPPLLFEQTRLEREVQVAGQLYASLQQHYDEA
RVAEASALPDVRILDAPVQPYQPIGSVAPFLVIMAFLASGGLGVLGAVLIDTLDPRFRDPGHVTQGLGLRILGALPHLSR
AGNGEGTAQAIEAMRTVRVKLQHASNGGNPLLLTVTSPGVGEGKSLVSANLALAFAYAGLRTIVIDGDIRRGALHRLLRG
SRRPGLTDHLTGRAPLEKVLQPTPYKGLSFIGCGSRMHNSPELLSAATMVDLLAALRSRYDVVLVDTAPLAAGADPYTMA
SLTTNLLMVLRAGVTDLELAQAKLESFEDLPVRVVGTVLNDVQPKGAYRYYAYYVPGYETKEEADLGPEKPVLGVPSV
>gnl|bykdb|A0A1Q7E3T7 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium 13_1_40CM_70_11] (length=758 residues).
MRVNLRDPLAVVRRHLWLVLGMTAVVGGIVGYRAYAAVPSYRAIAVIRLSDPRRALTGGVADGPTGDLAGSSADPLLSQV
ELLTSRRVGGVVVDSMLMLRVRARNFPTSILAVVQLPSDVGGDSLRLEFNRDSLTVLGRSRAIRTSYGTSVELDGMRFTV
VARPTVERGTISVVSREEAINGLLGGLRVTLRPHTDIFDVAYVASDPQHAQQVVNRVVEVFRAVNAEEAQRQSRLRREFL
ETQLRVNDSVLADARRALTAFRRHAGRAGSDQQGPTQQAGIDQLQLQRDQLDADRRMYRSILVSLDSGGGRGNREALRTA
ASTPAISANAVVAPLFTQLVQYENTRDSLTARSTTHPDVPRLNQLLVATEGKLLRAVQSALKGLIASLDVRIATLDDLRV
RRVANVEQRSSTDAEEARLEERVENGRKIADELRIEYQRARIAEAVEVGHVEIVDLAVPPTAPLGIGFAERLALGLLFGL
VLGGGSAWLTEHLRSSIARPNEIVELGLPLLGAVPRCQDGRNGSSVKAVGAVIEAFRGLRLNLAYAYGAAGPVLLVLSSP
RSREGKSFIAANLALAFAQANYRTLLIDGDTRRGALHKVLAVARKPGLTDFLGGDVSWGEIIQVTRHGTLHFIGCGMRRP
DSPELLSSPRMSDLFAQLRANFAVIIVDSPPLGAGVDAFALATITGHLVMVLRPGTTNREVIEAKLDLLHRLPVRVLGAV
LNDVQDGPEYTGYSYYLEGYEATAEGVREHHTVLRSSG
>gnl|bykdb|A0A1Q7E5D3 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium 13_1_40CM_70_11] (length=813 residues).
MTTSNLLAPLAPPPAVAPVAPSCAVAESGFPGLDDGLDWRRVLSALLRFKWLIAAVTLAGTAAGVGATRFLTPEYVAQAT
VWIDGPDRRGPDRGPIRPGQLLDPEAWVELLKSYVVLDEVVREQRLFLGLGSPADAHVFDAFRPAEQYRPGAYRLKVDAT
GQNWTLATEDGIDLERGAVGDSIGGRVGFHWAPGLGVLTPGRSVGFTVASVRDASRHLAERLDVHMDMNGNFLRVELTGA
YPARITAIVNAVVERYVQVAADLKRQKVTELTKILNDQVESARRNLQDAEVALEAFRVRTITLPSDRPAPSRAGVAGATG
AAAGDVAGDPVFTHFFDTQVEREQVRRDRETLERVLAQAGDSGSSADALSVIGSVQRHAELSQALKELTAKQAELRALRY
RYSDAYPPVQRLLAEIATLKRQAIPVLARALVGELASRETELGRRVDADSRTLRQIPPRLIEEARLRRADTLAANLYTTL
QQRYEEARLAQASTVPDVRILDSAVVPQRPVKNRAPRVILLAFFASFGLAVMGAVFIDRVDPRVRYYDQVSREMGLTILG
AVPHLRPRAGLGRSGGAHPPEDIAVVVEALRGACLNLVYAHGAEGPLLVTITSPGAGDGKSFLAANLARTFVEGGHRTLL
VDGDNRRGVLHRRLAARRRPGLTDLLRGDVTFEAIAQPTPYPGCTLVGCGTRAHNAPELLGSEAMSQLIRHARRSYDVVV
FDSPPLGAGVDPLILGTLTGSLVLVLRTGYSDRDVAAAKLEMLQRLPIRLLGAILNDVPAGAAYRYYSYYLPGYEAVDEG
ERNSGPKVRSLVI
>gnl|bykdb|A0A1Q7GIK9 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium 13_1_40CM_4_65_7] (length=807 residues).
MVTSTLVVPARPKGPSVYPAVVPAGPDDWRRVFAAMRTSRWLILAVTAVGTLAGIVGSRFLKPTYEARATVWLEIPDEAS
HARERGPIESGELFPTATGWLDLLRSHVVLDDVVRRWRLYLKPKSAADSAALATLTVPGDVRPGHYRLVLDRAGKRFRLL
DADEKQVLQEATPGEAIGAALGLVWVPPAGTVQPGGRVDFTVTTTSEAALQLAEELRIRAAPEGNFVRIARRGPDPDQAT
GIANAVAERFVAAAADLKRQRLTELTAILQDQLNHAQANLRTAEAALTVFRVHNAVRPSEGPAQGPDGRRITADPTFASY
VDVQVTLDGLTRDRAAIAQVLTHAADSGVAVDQLAMIGAVQRSSELTAALKELTDRQADLRALRFRYADTHPPVRRLALQ
VDTLAQRVIPGLARTLMDGLAARARELASRRDSIARDLQSAPPVALTEIRLARDQTNAEQLFSNLQQRYQEARLAEVSTL
PDVRILERAVRPTRPASRTAPLLIIAAFLTSFGAGVAGAVVRERADPKVRYPDQVTSAMGLPILGAVPHVRQTAPSRRPA
EVRATWRAPEVDAEDGAKAVEALRGIRLNVHHASGAVGPLLATITSPGRGEGKSFVSANLAYAFSAVGYRTLLIDGDVRL
GALHRTLRAARRPGLTDVLAGHVEYAAVLQSTPHTRLSFLGAGSRMHRGPELLGSAGMPRLLTALRSAYDVILVDSAPLA
AGVDPYALGAATGNVLLVLRTGVTDRSLAEAKVEVLHRLPLRVLGAILNDVRPGSAYSYYSYSLEGYEVRDEDPEGKAGK
MLLPDPA
>gnl|bykdb|A0A1Q7GLJ7 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium 13_1_40CM_4_65_7] (length=784 residues).
MSEQLRSEPPAPSRRLADRADPEAFVHTVGLEELLSTLRRHVWLVLGVAAVAVAATGFVAYTTGPVYRAVAVIRLSDPRR
ALTGGVVEDPGPSADERFADPLLSQVELLTSGTVAGAVVDSVPMLRVLTRKFSPSLLGGVAVAADSAAHSFQLTFGRDDF
VVEGPAGQQRRAAYGRVVDLGVIRFAVLHRPSAKQGFLQVLDQESAISYLIAKVRVRPRLRTDIVDVAYSAPDPARAQEV
VNRVVDVFRAASADAAQRQSKLRREFLEAQLKVNDSLLADARQALTEFQRRARPYGSGGSSAREQSELPGLELERQQLMA
ERRTDEALLAALRDSSTSRKAIQTALAAPGMGASPALSQLSAQLFQYEMARDSLASRSARHPDLPRLNLLVSSTEAKLLR
AVQAGVQGSIASLDGRIAAIDDLRAHWAGGLQQDAEEARLKERVDNARKVADELRVEYQKAGIAEAITVGQVEIVDHAAL
PAKPAGIGLPEQIALGLLVGLMLGSAGAFLAERLGSTIAQRVQVERLGMSVFGVITHWDRDAREKGVKNPDAVVEAFRGL
RLTLVNEYGAPGPIVVTVTSPGSGDGKSFVSSNLALAFAYAKQRTLLVDADLRRGALHRLLNLRRQPGLTDFLIGDVSRA
PALQTTAYPFLDFLPSGTRRRDAPELMGSAAMVDLVTSLRSTYDVIVLDTAPLGAGVDALALAKLAGNLLMVLRLGRTDR
ELAEAKLEILRRLPLRLLGAVLNDVRDESEYRAYAYYMDGYALTNEPPFRPLGGKQGASSHAAG
>gnl|bykdb|A0A1Q7GX75 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium 13_1_40CM_4_65_7] (length=764 residues).
MAGLDDEESGLDWRRIVSALLRFKWLVLLAVALGLGGGFAATRKLPPVYSAQANVWVDVLDRRGEGGAEARGPIQQRALL
DEDAWVELLRSYIVLDQVVRDLRLYLAVKRPADQATFVGFRVNDTFRPGQYAFSVSADGREYTLDGANGVELERGMVGDS
VGRRLGFQWVPASGRLAPSRTVEFSLVSPRDAALTLGEQLSVRMEMNSNFLALELRGSNPVLIANILNAVSQRYVEVAAQ
LKREKLTELTKILEDQLRTAQGNLDDAETALERFRTRTITLPSDQTTGVESRDPRRANFFEMQVDRDQLRRDRDAIDRLL
AEAGGASGLPTAALSAIESVQHAPELSNALKELSDKEAQLRALRYHYSDAYPPVQRLAAEIAELQQRTIPTLARALSVQL
AARESELGRHVDAASSDLRQIPARTIEEARLNRNVQLKEQTYTALQQRFDQARLAAEATVPDVRILDSAIVPQRPVKNTA
SRILLMGLLAGLGLGIVGAVLLDRIDPSVRYPQQVSRDLGLPILGALPHLRAKEPAEVVEALRGVRLNLLHEYGPGPVVL
TISSPGSGDGKSFLSANLGLTFADGGHKTLLIDGDIRRGVLHRRFKGNRQPGLVDYLLGDAGHDAIVQKTAYPRLSLIGC
GTRTQRAPEVLGSPAMNRLLAELRGRYDVIVVDSPPLAAGVDSFIIGTVTGSLLLVLRTGHSHRDITGAKLEVLDRLPIR
LLGAVLNDVPRGAAYGYYAYYSYYLPGYEAVEESSGQASAPRVV
>gnl|bykdb|A0A1Q7J2X5 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium 13_1_40CM_4_69_8] (length=822 residues).
MTLSNLPAAPLVSPPVVAPGTSHRGVTEFDLAGSDSGLDWRRILSALLRFKWLIAGFTLVGTAAGFGATRFLKPEYSAQA
KIWIDVEGRRGPDRGPAPIRPGQLLDAESWVDLLKSYVVLDQVVRDERLFVAPSSPADAQAVEGLRVADQYRPGAYRFTV
DRSGQGYTLGTADGIELERGTLGDSVGTRYGLQWAPDAGTVAPGRTVEFTLTTLRDAATGLGEALDTRMDMDGNFLRVEL
RGVYPTRITAIVNAVAQRYVQVYADLKRQKVMELTKILGEQVQHSQENLRNAEAALQRFREETITLPSDRAAAGASVAGA
GGVGAGAGAAGGTRDPVFGGFFDMQLTREEARRDREALGRLLAQAGDSGLSAEALSVVGSVQQNPELSEALKELTDKQAQ
LRAYRYKYSDEYPPVQRLLGEIATLQRQTIPGLARALAGQLAGKESELGRRVDADSRSLRQIPGRTIEEARLRRDASLAE
NLYTSLQQKYDEARLAEASTLADVRVLDSAVVPRRPVKNTAPRVILMAFVGSFALAVMGAVLIDRIDPRVRYPDQVSREM
GLTILGAVPHVRPGARPTPRNGRRVRPPEDVAVVVEALRGVCLNLVYTHGAESPMLVTITSPGAGDGKSFLAANLGHTFA
EAGHRTLLIDGDLRRGVLHRRLGARRRPGLTDFLRGEVPLEAIVQATPYPSFSLIGCGTRAYNAPELLGSQTMSQLVTAL
RPSYDVILVDSPPLGAGVDPLILGTLTGHLVVVLRTGYSHRDVAAAKLEVLQRLPVRLLGAILNAVPAGAAYRYYSYYLP
GYEAVDEEAERTSGGNKQPFVI
>gnl|bykdb|A0A1Q7JD32 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium 13_1_40CM_4_69_8] (length=798 residues).
MAHEGPSLPESARLEAIAATPRPRAPTRYDQPPRLLPAVEPDWRRIFGAIRRRRWVVLGVTLLGTVAGVVAAAKFVGPRY
LARARLWVGAAEPDPNAIRGTTPAPGAERLLGVEAWVDFVRSDAVLDTVVREVRLYLSPKTPIDGTALLGLRLKDQVLPG
RYRLEVDRDGQAFALFSAEGVVQRGERGDSVGPALGFAWVPGAAVLTPGRRIEFTLLTPHDAAELLASQLQVTTDREGTF
VTVQLTGTDPQLTAAIVKGVADRTVAVAADLRRHKVAALADILGQQVQHAQASLTVAELALKNFRVRAAGVLPAGVAAPP
PSPAFTNAFELRVAVDQHGRDRQAIDRVLAQPPDSGLSVDALAAIDAVQKSPELTQALKELTDKQAELRALRYTYTDQHF
PVQQLADAVATLERRTIPGMLRALRNNLAAREHDLGQRVDSTVRYLSNIPPLLFEQTRLEREVQVAGQLYASLQQHYDEA
RVAEASALPDVRILDAPVQPYQPIGSVAPFLVIMAFLASGGLGVLGAVLIDTLDPRFRDPGHVTQGLGLRILGALPHLSR
AGNGEGTAQAIEAMRTVRVKLQHASNGGNPLLLTVTSPGVGEGKSLVSANLALAFAYAGLRTIVIDGDIRRGALHRLLRG
SRRPGLTDHLTGRAPLEKVLQPTPYKGLSFIGCGSRMHNSPELLSAATMVDLLAALRSRYDVVLVDTAPLAAGADPYTMA
SLTTNLLMVLRAGVTDLELAQAKLESFEDLPVRVVGTVLNDVQPKGAYRYYAYYVPGYETKEEADLGPEKPVLGVPSV
>gnl|bykdb|A0A1Q7JGF6 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium 13_1_40CM_4_69_8] (length=808 residues).
MPSDPTADPEQSAPDRRLVLAAATAARLAPRRDEAPPPEDWRRVVTAIRTYRWLVIAVTGVGTLAGIIGARFLKPTYQAR
ATVWLEIPDQSAHERDQGPFQSGQLLGTATGWLDLLRSHVVLDDVVRQWRLYLKPQSAADSAALATLTVTGDVRPGRYRL
QVAAAANRFRLLDVDAKVVLQEGAVGDSVGAALGFTWVPPAAVLRPGASVQFTVATTSEAAQKLSEELRVRAGTDGNFVR
IERRGPDAAVVTRTVNAVAERFVAAAADLKRQRLTELTAILKDQLDRAETNLRAAERGLTAFRVRNAVRPSEGPAQGPDG
RRITADPTFASYVDLQVALGALAHDREAIARVVAHAADSGVAVDQLAMISAVQHASELTAALKELSDRQAELRVMRFRYA
DTHPPVRRLAQQVDTLARRVIPELGRAVVAGLAAREHELQQRIDSISRDLRSAPPVALEEVRLARDQANAEQLFSNLQQR
YQEARLAEVSTLPDVRILEPAVRPTRPVSDTAPLVIIVACIMSLGAGVLGAVLLERADPKVRYPDEVTRAIGLPILGAVP
HVQRGNGKRRAGGEDDIAKAVEALRGIRLNLQHAYGAAGPLLITVSSPGRGEGKSFVTSNLAQAFADVGYRTLLIDGDVR
LGVLHRALRGTRRPGLTDLLASRATVDQVVQGTPHPLLSFIGAGSRMHRGPELLCSVAMPRLITVMRPSYDVILVDSAPL
AAGVDPYALGTATGSMLLVLRTGVTDRTLAEAKVEVLHRLPIRVLGAVLNDVRPGAAYTYYSYSLAGSEVQEEDPGGVTS
EILLPDRS
>gnl|bykdb|A0A1Q7JK96 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium 13_1_40CM_4_69_8] (length=798 residues).
MFNDLPELPPSSPETPGRATVPAPARRRSPPMVEAAPDVDWGRYRTAIWRFRWWVLLITLLGTAAGVGASRIVRPVYVAR
ATIWIEGANEKQPGPGPAGSGDLLGATGWVDLVRSYVVVAAVVNDRQLYLTPASPSDSAVFAGFSVAPRFRPGSYRLEVD
QAGRGFTLATHDAVVLQRGAAGDSVGGALGFVWLPPAAELSPLRRLDFVVESPHEAASRLAERLRVKTDLEGNFLRVELR
GQDPRKITVIVNAVAQRFVAVAADLKRQQLTELVRILGEQLNHSQVNLSAAESALRDLLSKTVSFVADGATPVAPGLQFT
HDPGFASYFETKVNLEQVRRDRAAIERLLAQVRDSGLPVDALAAIGAVDRSTELVAALRELTAKRAELRALQQRYTEEHG
TVRRLAGEVQALEGRTIPALARVLVSELAARDAELTQRVRAASAELRQIPSLAIEDARLRREVANAERLFTSIQQRYDEA
RLAEVSTIPEVSVLDAAVEPEEPLLDPTPFLVLVSFLGSLGLAALGAVVLERADRKVRYPDQVTRTMGLPILGAVPHVSW
HDGANGDGVSRVIEALRGIRLNVLHAYGTAGPLLVTVTSPGRSDGKSFLTSNLAVAFVDAGYSTLLIDGDIRRGGLHRVL
DAARTPGLTDLLAGTAAVQQVIQQAKSYPSLAFIACGSRTRSGPELLSSTAMAGFVTSLRSRYAVILIDSPPLAAGVDAC
ALGTMTGSLVLVLRTGVSDRELVEAKLDVLERLPIRILGAVLNDVRPGGAYRSYAYSLSGYDLHDEEEPPKRILRSVE
>gnl|bykdb|A0A1Q7JSV2 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium 13_1_40CM_4_69_8] (length=803 residues).
METGDLPAALDPERPERLPSTAAPFDTIARYAPPAAGAPRDADALAELRRYLSAVWRYKWAVAGVTVLGTAAGVAGKMLL
APSYVARATVWIQVPQRPTRDEGPIWSGQLPISSGWTDLLQTNVVLEDVVRQQRLYVTPKEPGDADALTGFGIKDRVRGG
TYRLVVNDAGTAFTLEEKKAGVLQHGAAGDSVGAPLGFVWVPPAAALTRGRTVEFTVSAPYEAARALGKRLKTSLDLDGN
FLRLELGGPDAAGITAVVNAVAERFVAAAADLKRQNLTELTRILNGQLERAQANLRDAETTLKTFRVSAVTEYADGAAPV
TPNMQFPRDPVFAGLLDMKVSREQLRRDREAIARILAQGRDSGLAVDALAMIGSVEKSTALIQALRDLTGKVAELRALRG
RYTDANVAVRRVSDEVAVLEQQTIPALATKLTQEMAVQERVLAQRVDSAAGGLRRIPPLAVAETQLQRDVTLAEQVVTNL
QRRYEEARLAEVSAIPDVRLIDPAIEPQQPAASWSVLLVALAFLGSLGAGVAGAVLRDRTDRHVHYPEHVTGTMGLAILG
AVPHLERGRNGKKSGAVLQVVEAVRGIRLNVLHAHGAGPAVLTVTSPGRSDGKSFLASNLALAFADAGYRTLLVDGDVRC
GTLHRALKLARKPGLVDVLGGKASTELVVQATSYRALSFIGSGTRTHTGPSLVSSAALPRLLATLRPGYDAIIVDSPPLA
AGADAFAIGTATGSMVLVLRTGVSDRELAQTKLEVLAHLPIRMLGAVLNDVRGGLYRYYSYYLEGYEVKEEPEPAWQLVR
APE
>gnl|bykdb|A0A1Q7KE95 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium 13_1_40CM_3_66_12] (length=799 residues).
MRIAVSAYPPSNGTPVPADQLAAPFGAGRGGRLEESGAGLVQPTDWRRHGATALRYRWWILGLAALGTLGGTAAGRLLPP
RYQVQATIWIQSSEPRGGTSRGPIGANQLFESYAWGELLKSYVVLDEVARERRLYLAPQHGWAGAFAGFTVSDTYRPGRY
RVVVDGTGRNFRLAGAGGEGLQEGAIGDSVGAALGFRWVPTAAVLPAGSDLTFTVRPLRDAARQLGNALTVTMDQGGNFL
RVGLTGADPAHTAATVNAVAQRSVAVGAELKRAKLNQLGKLLDEQRQSARENLQRAESALEQLQVTVGPDLGAAPVPPGG
GPPLGTLLGPKLEQEQLRRDRDAIEQVLVQMRDSGGSPDGLAFIGAVQRSPDVSQALRELTTKQAERRALASKYTDDHPA
VQRLIGEIELLERGTVPTLAQSLIDELTARERVLAPQVAAADRDLRRIPQRAIEEARRRRDVDLATNLYTSVQQRYDEAR
LAEASSVADVRILDAAVPPQESLGNSTLRFIVLGLAAGLGLGLVGAVVGDRLDPRMRYPEQVTRQMGLPILGVLPHVKDR
GAGPNDEHVIHVIEAMRSVRLSLIHFYGGNGPVVVTVTSPGIGDGKSFLSANLALACAEAGQPTLLIDGDARRGGLHRAL
RRPRKPGLTDCLAGAAPLEGVTQTTMYPCLDFIGAGSRFRDSPELLGSPAMVELLERVRSQYRVVLVDSPPLGSGVDPYT
LGTLTGNLLLVLRTGTTNLALARTKLTVLDHLPIRLLGVVLNDVRPGGMYRYYSYLSGYATTNEREGYAVAGRQARGVL
>gnl|bykdb|A0A1Q7KG39 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium 13_1_40CM_3_66_12] (length=750 residues).
MLLRFKWVVILMLALGLGAGFAATRVLRPVYRAQANVWVDVPDRRGNGSSDARGPIRQGALLDADAWVELLRSYVVLDQV
VRDLRLYLKVKRTSDRATFDAFRVNDIFRPGDYRLSVSDDGRQYTLASAEGVDLERGTVGDSVGNRLGFRWAPPAGSLPP
GRTVEFSVVPPRDAALRLGEQLDVRMDMNGNFLALELRGPNPVLITTILNAVAQRYVEVAAQLNREKLTQLTKILEDQLT
TAKRNLDSAETALQGFRTRTITLPSDQAADRKAAADTRDPIRTSFFDMAVERDQLRRDGDAIDRLLAQGGGGDGLPTEAL
SAIGSVQHAPELSNALKELSDKQAQLRTYRYHYSEAYPPVQRLAREISELQQRTIPTLARALSAQLATRESELGRQVGAA
SRDLRQIPARDIEDVRLNRNAQLKEQTYTALQQRFDQARLAAEATLPDVRILDPAVVPQRPVKNTAPRLLFMGLLGGLGL
GVLGAILLDRADPRVRYPEHVSRDLGLPIIGAVPHLRAKEPAEVVEALRGVRLSLVHEYGPGPLLVTVTSPGPGDGKSFL
SANLALTFADAGHRTLLVDGDVRRGVLHRRFKANRQPGLVDFLLGKAGLDEIVQGTEYPRLAFIGCGTRTQRAPEVLGSP
AMTQFIADLRNQYDVILVDSPPLTAGVDPFVLGTVTGALLLVLRTGHSHRDITGAKLEVLDRLPIRLLGAVLNDVPHGAA
YGYYSYYSYYLPGYEAVDEGDRQASGARVV
>gnl|bykdb|A0A1Q7LL80 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium 13_1_40CM_3_65_8] (length=764 residues).
MAGLDDEESGLDWRRIVSALLRFKWLVLLAVALGLGGGFAATRKLPPVYSAQANVWVDVLDRRGEGGAEARGPIQQRALL
DEDAWVELLRSYIVLDQVVRDLRLYLAVKRPADQATFVGFRVNDTFRPGQYAFSVSADGREYTLDGANGVELERGMVGDS
VGRRLGFQWVPASGRLAPSRTVEFSLVSPRDAALTLGEQLSVRMEMNSNFLALELRGSNPVLIANILNAVSQRYVEVAAQ
LKREKLTELTKILEDQLRTAQGNLDDAETALERFRTRTITLPSDQTTGVESRDPRRANFFEMQVDRDQLRRDRDAIDRLL
AEAGGASGLPTAALSAIESVQHAPELSNALKELSDKEAQLRALRYHYSDAYPPVQRLAAEIAELQQRTIPTLARALSVQL
AARESELGRHVDAASSDLRQIPARTIEEARLNRNVQLKEQTYTALQQRFDQARLAAEATVPDVRILDSAIVPQRPVKNTA
SRILLMGLLAGLGLGIVGAVLLDRIDPSVRYPQQVSRDLGLPILGALPHLRAKEPAEVVEALRGVRLNLLHEYGPGPVVL
TISSPGSGDGKSFLSANLGLTFADGGHKTLLIDGDIRRGVLHRRFKGNRQPGLVDYLLGDAGHDAIVQKTAYPRLSLIGC
GTRTQRAPEVLGSPAMNRLLAELRGRYDVIVVDSPPLAAGVDSFIIGTVTGSLLLVLRTGHSHRDITGAKLEVLDRLPIR
LLGAVLNDVPRGAAYGYYAYYSYYLPGYEAVEESSGQASAPRVV
>gnl|bykdb|A0A1Q7R6Z6 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium 13_1_20CM_69_28] (length=821 residues).
MTISNLPAPLGPAPMAAPGMPQRGISVFDLDGRESGVDWRRILSALLRFKWLIATTTLVGTIAGVGATRFLKPQYSAQAK
IWIDVEGRRGPERGPTPIRSGQLLDAESWVDLLESYVVLDQVVRDQRLYVSPNAPADAQAVAKLGVADQFQAGAYRFTVD
HSGQGYTLATADGVELERGTLGDSVGSRYGLRWVPDASTVAPGRVVEFTLTTLRDAATSLGEGLDARMDQEGSFLRLELR
GANPVDITAIVNAVAQRYVTVYADLKRQKLIELTKILGEQLQHAQENLHGAEASLQRFREETITLPGDRPSVGGASVAGA
AVGGPGATGAVAARDPVFGSFFDMQISREQARRDRDALDRLLAQAGDSGLSAEALSVVGLVQANPELTQALTELMTKQAE
LRALRYKYSDAYPPVQRLLGEIATLQRQTIPTLARQLAGQLAAKETELGRRVDADSRTLKQIPARAIEEARLRRDAALAE
NLYLSLQGKYDEARLAEASTLSDVRVLDSAVVPRRPVKNTRRRVILLAFFGSFAMAVVGAVLIDRVDPRVRYPDQVSREM
GLTILGAVPHIRAGARPERSGRRVRPPEDVAVVVEALRGVCLNLVYTHGAVAPLVVTITSPGAGDGKSFLAANLGHTFAE
AGHRTLLIDGDLRRGVLHRRLGARRRPGVSDFLRGEVPIEAIVQTTPYPSFSLIGCGTRAYNAPELLGSQTMSQLLTTLR
PSYDVILVDSPPLSAGVDPLILGTLTGHLVVVLRTGFSHRDMASAKLEVLQRLPVRLLGAILNAVPAGEAYRYYSYYLPG
YEAVDEEAERASGGKGQPFVI
>gnl|bykdb|A0A1Q7T8X5 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium 13_1_20CM_4_66_11] (length=799 residues).
MRIAVSAYPPSNGTPVPADQLSAPFGAGRGGRLEESGAGLVQPTDWRRHGATALRYRWWILGLAALGTLGGTAAGRLLPP
RYQVQATIWIQSSEPRGGTSRGPIGANQLFESYAWGELLKSYVVLDEVARERRLYLAPQHGWAGAFAGFTVSDTYRPGRY
RVVVDGTGRNFRLAGAGGEGLQEGAIGDSVGAALGFRWVPTAAVLPAGSDLTFTVRPLRDAARQLGNALTVTMDQGGNFL
RVGLTGADPAHTAATVNAVAQRSVAVGAELKRAKLNQLGKLLDEQRQSARENLQRAESALEQLQVTVGPDLGAAPVPPGG
GPPLGTLLGPKLEQEQLRRDRDAIEQVLVQMRDSGGSPDGLAFIGAVQRSPDVSQALRELTTKQAERRALASKYTDDHPA
VQRLIGEIELLERGTVPTLAQSLIDELTARERVLAPQVAAADRDLRRIPQRAIEEARRRRDVDLATNLYTSVQQRYDEAR
LAEASSVADVRILDAAVPPQESLGNSTLRFIVLGLAAGLGLGLVGAVVGDRLDPRMRYPEQVTRQMGLPILGVLPHVKDR
GAGPNDEHVIHVIEAMRSVRLSLIHFYGGNGPVVVTVTSPGIGDGKSFLSANLALACAEAGQPTLLIDGDARRGGLHRAL
RRPRKPGLTDCLAGAAPLEGVTQTTMYPCLDFIGAGSRFRDSPELLGSPAMVELLERVRSQYRVVLVDSPPLGSGVDPYT
LGTLTGNLLLVLRTGTTNLALARTKLTVLDHLPIRLLGVVLNDVRPGGMYRYYSYLSGYATTNEREGYAVAGRQARGVL
>gnl|bykdb|A0A1Q7TNP7 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium 13_1_20CM_4_66_11] (length=750 residues).
MLLRFKWVVILMLALGLGAGFAATRVLRPVYRAQANVWVDVPDRRGNGSSDARGPIRQGALLDADAWVELLRSYVVLDQV
VRDLRLYLKVKRTSDRATFDAFRVNDIFRPGDYRLSVSDDGRQYTLASAEGVDLERGTVGDSVGNRLGFRWAPPAGSLPP
GRTVEFSVVPPRDAALRLGEQLDVRMDMNGNFLALELRGPNPVLITSILNAVAQRYVEVAAQLNREKLTQLTKILEDQLT
TAKRNLDSAETALQGFRTRTITLPSDQAADRKAAADTRDPIRTSFFDMAVERDQLRRDGAAIDRLLAQGGGGDGLPTEAL
SAIGSVQHAPELSNALKELSDKQAQLRTYRYHYSEAYPPVQRLAREISELQQRTIPTLARALSAQLATRESELGRQVGAA
SRDLRQIPARDIEDVRLNRNAQLKEQTYTALQQRFDQARLAAEATLPDVRILDPAVVPQRPVKNTAPRLLFMGLLGGLGL
GVLGAILLDRADPRVRYPEHVSRDLGLPIIGAVPHLRAKEPAEVVEALRGVRLSLVHEYGPGPLLVTVTSPGPGDGKSFL
SANLALTFADAGHRTLLVDGDVRRGVLHRRFKANRQPGLVDFLLGKAGLDEIVQGTEYPRLAFIGCGTRTQRAPEVLGSP
AMTQFIADLRNQYDVILVDSPPLTAGVDPFVLGTVTGALLLVLRTGHSHRDITGAKLEVLDRLPIRLLGAVLNDVPHGAA
YGYYSYYSYYLPGYEAVDEGDRQASGARVV
>gnl|bykdb|A0A2D5ZJE2 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=781 residues).
MDEHQAHGVTLADYVRIIWSRKWMVGLVATAVLAFTIFFTLRMQPVYESQTTLLIEPQDAGALSIFDPTGFMKQKILINN
ECELLRSRSLAQQVLDRAMREGWTPPPESDPMADWVEALRSRLSVSPLKDADVITIKMTAGDPDEAAYFANLFAEEYRNQ
NISQNRGELSGVRQFLEEQLHQVETRLAISEEELRSFKTKSGLVSLSDEVEWLVRQLAEFESAENAAITDQKSLERRLEH
LEGELERARAGLVEDLDDAAASPLVIQLREQLVALQIEHTSLLVRGASEDSPQIIDLESKVKQAKTRLAAETQKIVDRDL
LPGDPLLYSQGLVEKVLELRTELETARSRAAELNRFVADYATKLHSLPDKELALARKTREYTVNENTYLMMKEKYEEVRI
SEAGEIGNVRIIDAALPFLDPVRPNRRMNALLGLVVGLGLALSLAFFFEYLDTSLRTIDEVEQKLDTVVLGAVAALEEAA
EAEDESARLVTLHEPQSPMAEAYRTIRTNVGFAAVGAPLRSIAITSSGPQEGKSTTASNLAITIAQSGKRTLLLDADLRR
PVLHKLFSLKRQKGVTDHLAGNATLEEVIQKTEIEGLHVITSGSLPPNPSELLGSDAMARFIEEVGREFDQIIVDTPPVM
AVTDALLLSALLDGVIIIVEAGETLEQVAKRTKTLVETAARRCLGVVLNNVDVGGGYGRYGGYHYHYHYHEDADNKTNSR
ATSIWRAARGVAIVATFFAIAAAMWHQRRPTLAEADTVESRMVPNTEDGRIAGLEEGVVGR
>gnl|bykdb|A0A2D5ZJF2 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=864 residues).
MITTRDRATTRGTPCRTPRTIWCGPSWHPSIRHPRKVIMSRMGSQATGEGNGSQAAPAGLSPEITPPGLLEILWRRRWIV
TLVTLASIVGAFIYLMKATPIYTSTSRIYVEQSGPKVITEFEGVMTQSKNYLYTQAEIFLSTEVLRPVAEAAEDAKTRIL
SSRTRATKGSTTSVAEESVQEVGQPEQGANGALLQRRQILEGVADLLAFFAKTFNDTGGSTAVASDESEEEPDEGKQVVF
YDRLKTFQDVDNIQVFLKKELEVKVGKKDDIISVSFDSPWPDEAELIVYEVVESYRRYQSTTKQTTAGGVLKILEKARKK
ADGKWNESYEKLILSQKKHPVLSLKDDRGSFLVRGLSTLHEELAAAQSAAIVAKATYEAAEQMQGDPERLRQLVESQFGR
VGTTPFNQEKVQLHRDASQLQLELADLQRQVTSDHPAVESLESKIARIKGELEALDRTTGEAYLELARQQWLVARERETE
LDQRYRTQLVEAQELGAKATELAKLESEVSKTEKMLDILDDRIKEVDVTEKADVLNINILEYAEVEDEPSKPEKARIMGA
ALVAGLILGAGLALLVDWKDHRFRSADEITAILGVPVLGVVPSMSRKASRPDHGQQVSRASSSMIAEAYRTIRTAVYFGA
PNGEARTILVTSPSPGDGKSTTASNLAIAMAQAGQRTLLMDSDFRKPVQHVIFEMDDKQGLSSVLSGQATLDEVLRPSEV
AGLDVLRCGPLPPNPSEFINSDAFREMLEELAVKYDRVVIDSPPVMAVSDARILAAGCDITLLVLRAEKSTRKASEQARD
GLLAVGGHLLGVVVNDAHHRREGYGYGYYGGYGQYGGYYGRDRAEGRREGGRGSSGTEKGSSTG
>gnl|bykdb|A0A2V7ERC7 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=817 residues).
MPPLILPPRKSLMSVRLTPSPETPPPFTGAPYGAFPGNTGPSTGPAVVLQESEGVQWGRYFDVLKRHALLIVLLVAVGTV
WGLNAARQVRPDYETQATIWINGARGQQAGSIGTQQLLEQTSWVELLRSFAVVDAVVHQLKLNVVYKVPGDSLLFRTFQT
GTTPFYGSYVLQIDRSGRGYTLATATGRILESGTVGDSVGRKMGFFWNPDPALLPPGRLIAFSVTTPRNTSLGLLASMRS
TLPEDGQFLTISLTGTNPQRSARTVNVWAEQFVGAAIELKKRHLLEFKKMLGDQLNVAEHELNTSELLLEQFRASTITLP
SGGSPLASSGQTAGDPAFTTYFQQKATLDEVRNDRMAIERILSDARGGPINPQAFLVLPSILNNTPQLRTAIEELSSRQA
ALRTEQQYLTNANPRIKQLGEAIRVLEIETIPRIAQSVLESLRSRENQLTGRIDTQERVLRQIPSRSIEEMRLVRRVSAS
ETMYNSLKARYEEVSLAEAQTTPDLSILDYAIPPVHPTSNGARRLLILAVLASIALACAIALIRDRFDRLFRYPKEATHE
LGLIIAGTVPRFKPNRRGDFQLLTLSQAVESFRTLHLAVRYDFPGGGPISLSVASPGPGDGKSLVSSNLAIAFASAGYRT
LLIDGDVRCGTQHSTFSVSPTPGLVDYLRSATGVEGAIRTTSFSNLFLLPAGTRKNRAPELLVSDRMTALLLAARQEFEV
IIIDSPPFIAGVDAYALGAAAGSMLVVLRPGVSDRKLAAAKLDIVDRLPIRVLGAVLNGVPGGGAYRYYGTNYYYGDTRA
KEHVGNLATPKGLLLNA
>gnl|bykdb|A0A2V7EU00 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=791 residues).
MQPYGAPATPDDAAVDWRRYWAAIVRYRWWVVLCTALGLVGGFVAASVLKPQYRAQATVWIDVAKERQDATRGPIRQGQL
LEATAWVDLLQSYAVLDDVVRQRRLYLTPGARGDSLAFASFDMGERFRSGNYRLSVDASGKNFTLTAVGGVLMAVGGVVL
QRGTPGEAVGDAIGFRWTPPAAALPAGASIAFSVVTPRDAAQRLSARLGVRLDENGNFMRLELDGTDPKSIAATLNAIAQ
RLVAVAAELKRAKLTELTRILNEQLTTAARNLRDAEGSLESFRVKTITLPSEQSTPVSPGLEATRDPVFRNFFEMRIMRE
QLRRDREAVLRVLAQAPESGLAVAGLEVIGTVHNSSDLVEALKELTAKQAELRALRYRYTDEHPPVKRLQASIETLERHT
IPALAGALLEEVGTRERVLDSLVQSGGRELQQIPLRAVEEARLRREVTIAENLYTTLQQRYEEARLAEASTIPDVRVLDA
AVVPHQPIKNTAPRLILVGLFGGLGLSLLGAVMMDRLDRHFRYPQQVTREMGLAILGAVPRIKRGGNGVDPEEARQVIEA
LRTVRLNLTHAYGSAGPLLVTITSPGPGDGKSFVSGNLARAFADAGQRTLLIDGDSRRGVLHRLFKGLRKPGLTDYLAGV
VPLDAVVQRTDHPALWFIGSGSRTPDAPELLGAPPMARLLASVRTSYQVILIDSSPLGAGVDPFLLGTLTGSLLIVLRSG
TTDRELAQANLDGLLRLPIRVLGAVLNDIEPRGAYRYYSYLSGYAAEDEPTAPPQQWAVARRLPGASSPDA
>gnl|bykdb|A0A2V7F1M1 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=831 residues).
MSSQRGAQLMSELLPEPTPLRLTGPPGSLRPSRDGGGRSADSAEIRTDFKQLLMLLRRRIGLVAGIAALIVFVVALFVVL
ERPVYRSTATVRLAYPRRALTVGVEDLPAKDQRSDPLLSLIELLRGRGIVGAVVDSLALRLQPLGSRFGGSSRVVRAALR
DVRVSPGAQQDTLRLTFGGDRVTAQGLQGEAQSPYGTPLAVGSVQFTIPSPPSVKAGALAVRSREEVIDDVLKSLAVLRR
KSTDIVDVTYSDPDPLLAQRVANLLVRVFQARDAGSAQEQARSRAEFLAAQLSATDSELSIAQAELSAFRRQRMLGSSRD
KLAVEQARLTALDARLGELEAERSVYESFLTKFNTSNDSLRLDVARDLSYTPELAADPVVSRISQQVLVYRTRLDSLTTG
PLPAAPTNPDVLGLKALIRSTQEELVRAVRAHLTSIGAQSQALAALRSRTGASFQRLPATEAEGGRLERLVEDLRSTGDR
IRQDYKNARMAEAISAGDARVIDWAPLPYKAAGIPPWAKLGLGLLLGLLLGCGAAGLAESGNSLLMRPEELERALNVRDL
GVIPPLLETSASRPLRRLPIPLFISASRRPEAASRGEQATWEVVADSAPLSSAAEAFRLLYSGLLFGWGEGQRTILVTSA
APQEGKTVIAANLAVTFAREGVRVLLVDCDLRRPRLHRVFGVAPAPGLIELLKADRATLADSPGGPLRRPTKIAGLWLLP
CGALPRRTSEVLQPHQLRRLLDDLSGHFDVIILDTPPVLVSADAALLAPLADGAILVVRAGQTNRSSAERACQYLIAAGA
HFLGAVLNDPAGELARYGKYYYSYGYPTPSD
>gnl|bykdb|A0A2V7FK98 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=856 residues).
MRCTDLRHGDGVGGVPRGIGLATGRRDAAPTGRSPANTVEVRVPMSTSPLPFHSGSTVPAVAPAAPPPMGADMGFGQGFA
QPETGVDWRRVLSAVARFKWLIAVVTIVGTVGGLAATRFIKPQYMVQATLWIDQPDQRGGQDRGPIRAGQPLEPEAWLDL
LKSYRVLDQVVRDQRLFLTPKAREDAPLFETFRVAEQYRPGVYRLALDGSARTFTLSTDKGVEVEHGAVGDSIGARLGFT
WAPPAGTVPAGRTIEFSVATVRDSARALSDELEVATDPAGNFLRMHLKGADAARITSTINGIAERFVQVAADLRRQKLTE
LTKILDQQLAAAHQNLLDAEQALERFQVKTITLPSTAAGGARAAGGVPTASGASADDPAFASFFRMQVDRQQVQQDRDAL
ERVLKQAGDSGVSPEALAIVGSVQQNVQLKQALDELTTKQAELRALRYKYSDEYPLVQRRLSEVATLERQTIPTLARQLM
AELSGREAELGRRVTADARSIQAVPPRAIDEARLQRQVTLAENLFTSLQKNYDEARLAEESAVPDARILDHAVVPQDPVR
NTAPRVVFLGFAASLALGLCGAVVLDRIDPKVRYPDQVSRGLGIPILGAVPHLRNLPRGGRGNGARVPDDVNEVVEALRG
VCLNLVYAHGGRAPLLVTITSPGAGDGKSFISANLAHTFADGGHRTLLIDADIRRGVLHRRLSVRRRPGLSDFLRGEAQL
DAIVQATQFPALSLIGCGTRAYNAPELLGSPAMTSLVNGLRGGYDVVLIDSPPLAAGVDPLILSTLTGTLALVLRTGYSH
RDVAAAKLEVLQRLPVRMLGAVLNDVPAGGAYRYYSYYLPGYEAMDENSGSPRVPV
>gnl|bykdb|A0A2V7FYT7 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=821 residues).
MTISNLPAPLGPAPMAAPGMPQRGISVFDLDGRESGVDWRRILSALLRFKWLIATTTLVGTIAGVGATRFLKPQYSAQAK
IWIDVEGRRGPERGPTPIRSGQLLDAESWVDLLESYVVLDQVVRDQRLYVSPNAPADAQAVAKLGVADQFQAGAYRFTVD
HSGQGYTLATADGVELERGTLGDSVGSRYGLRWVPDASTVAPGRVVEFTLTTLRDAATSLGEGLDARMDQEGSFLRLELR
GANPVDITAIVNAVAQRYVTVYADLKRQKLIELTKILGEQLQHAQENLHGAEASLQRFREETITLPGDRPSVGGASVAGA
AVGGPGATGAVAARDPVFGSFFDMQISREQARRDRDALDRLLAQAGDSGLSAEALSVVGLVQANPELTQALTELMTKQAE
LRALRYKYSDAYPPVQRLLGEIATLQRQTIPTLARQLAGQLAAKETELGRRVDADSRTLKQIPARAIEEARLRRDAALAE
NLYLSLQGKYDEARLAEASTLSDVRVLDSAVVPRRPVKNTRRRVILLAFFGSFAMAVVGAVLIDRVDPRVRYPDQVSREM
GLTILGAVPHIRAGARPERSGRRVRPPEDVAVVVEALRGVCLNLVYTHGAVAPLVVTITSPGAGDGKSFLAANLGHTFAE
AGHRTLLIDGDLRRGVLHRRLGARRRPGVSDFLRGEVPIEAIVQTTPYPSFSLIGCGTRAYNAPELLGSQTMSQLLTTLR
PSYDVILVDSPPLSAGVDPLILGTLTGHLVVVLRTGFSHRDMASAKLEVLQRLPVRLLGAILNAVPAGEAYRYYSYYLPG
YEAVDEEAERASGGKGQPFVI
>gnl|bykdb|A0A2V7GFB5 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=787 residues).
MERQLPERVDPAVLGAPRPWAAEEVATTSPEGALDWRRIAQVVTRFKWLVFGITVAGGAAGFAATKVVRPQYLTQVTVFI
DQPDPRGNDRGGPIRSGQVLDPESWIDLLRSYAVLDRVARDLRLFLQLPKGPDPALRSLNVADQFRPGAYRLTTDAARAY
VLAKVDGAVLERGTVGDSIGRSIGFLWAPPAESLPPGHTVEFRLQTAREAALHLSDALDAHMDYNGNFLKIELRGGDPAR
ITRILNAVAERYVEVAAELKRGRLTELTSIIGDQVRTAKQSLDSAEGDLQTFRRRTITLPPDAVAAGGDTPRDPVLGDFF
EQQVQRQQVARDRAALTRVLAQPADSGLASALEVIDAVQHSPELKGALQELTTKQADLRNLRYHYTEAYPPLARKAAEVA
TLERQTIPTLVRSLIDELGTRMAELDRRIGSASQELRRIPARSVEEARLRRSVTIADNLYTSLQQNYEAAKLAEASSIPD
IRIFDKAVVPLQPVKNTAPRLLLLGFLGGLGLALAGVVLLDRFDPRVRYPEQVSHDLGLPILGAVPHLKARTGGQLTREQ
RVQLVEAMRGVCLGVSYTYGAAGPVVVAVSSPGPGDGKSFITANLAVTFADAGRRTLLVDGDLRRGAQHRLFGADRRPGL
TDVLRGDVPLEAGLRPTGYDALTLLPCGVRTSDAPELLGSAKMPELLARLRGDYDTILVDSPPLGAGIDPFVLGTLTGNL
LLVLRTGVSHREVMAAKLEVLRRLPVRLLGAVLNDVPPGAAYQYYSYYTPGYEATDEKPARLTPSVG
>gnl|bykdb|A0A2V7GRE3 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=783 residues).
MVEPSNRPAASSFHGDREPEVSVRTVRLEELLAILRRHVRLVVGVVVATVTAAGVVAYVTGPAYRAVAVIRMSDARRALT
GGVVLDPARADERFSDPLLSQAELLTSRAVAGAVVDSMPALRMVTTRDLPLSFLGEVAVPAAAGPVSLQIAFGRDSFVVR
GTSGQWSAPYGSAVESHDIRFAVLHRPDAATARLRVLSREAAISGLLARLRVKPRLNTDIVDVTYSAPDPYVAQHVLNRV
VDLFKSASAEDAQQQSTRRREFLESQLKVNDSLLADARQAVTAFRQRAGTYGSRDALAREQAGLAGVELQRQQLEAERRT
DESLLAALRDRDSSVSRKALQTALATPGVAASPSVMQLSTQLYQYERARDSLASRSTSHPDLPRLNQLVSSTEADLLHAV
QGGVQSAIASLEGRITAMNDLRARQQQLSTSEEEEARLTERVDNAQKVADELRVEYQKAKIAEAVTVGQVEIVDHAALPA
KPAGIGLPEQIALGLLLGLMLGSGGAFLAERLGSTIAQRVQVEQLGMSVIGVITHLDRDGAETGMKSPDAVVEAFRGLRL
SLVNEYGAPGPLVITVTSPGSGDGKSFVSSNLSLAFAYAKQRTLLVDADLRRGALHRVLNLRRQPGLTDFLAGDVSRAPV
VQTTSHPCLDFIASGTRRRDAPELLGSAAMTDLVTSLRSTYEVIVVDTAPLGAGVDALVLAKLARNLLMVLRLGRTDRVL
AEAKLEILRRLPLRLLGAVLNDVRDESEYRAYAYYMDGYALTNEPLFRPLAGNKQGVGSRPAR
>gnl|bykdb|A0A2V7HBX4 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=790 residues).
MRVRSLQPDYPLAPHHPGSIPTAEWTPARPRSEDFEDAEGIPWSRYVDAIRRHVLLIVGLAAVGSVLGVVAARRVRPIYE
AQATVWISTTPSSALQTGPIRQQQLLTTGSWVELLRSFAIVDPIVRDLKLNVSYKQPSDSVLFRNFEWTPATRSGAYLLK
IDGAGPKYMLSTAKGVFIESGAIGDSIGRKAGMNWLPDARFLGRGRAIEFGVTSPRNVSQFLKITLSGADPRRTARTVNA
WAEQLVNSSGDLKTRHLFEFKKILGDQLALAEAQLRTSENELEHFRVSTITLPSGVAASAGPGVTQGDPVVASYFQQKVA
LDEIRSERQALERMVSEAKGGPINPQDFLQLPTILNNAPQLRSAIEELSLRQATLRTEQQFLTDANPRIRQLAEAVRVLE
RETIPQITVAVLNSLKAREPELDTRISVGSQELRGIPARATEEARLVRQVAATENLYNSLKARYEEVSLAEVQTAPDLSV
LDTAVAPTLPTSNDAPRLLLLAVVASMGLAVGIALIRDRLDRRFRYPEQATRELGLSVAGTVPKFKANHRGEFQIAMMSQ
AVESFRTLRLALRYDFPTDAPIVVGVSSPAAGDGKSLVSSNLALAFASAGSRTLLIDGDVRCGGLHNTFEIPVTPGLVDY
LNGHAAVDSIVRSTTSENLFLIPRGTRGNRAPELLVSELMSALVHAMRLQFDVVIIDSPPLVAGMDAYALGAAAGSMLIV
LRPAVTDRKLASAKLEVLDRLPIRILGAVLNAVPDGGAYRYYGADYSYKDEVLKEPIADIATPKGLLVRS
>gnl|bykdb|A0A2V7IGR0 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=805 residues).
MTNSDNHAALARLPPSSDAGAALQPAALSLVEPGFSEVEGALDWRRVWSAVVRFKWLILAVTLLGVAAGGAATRFLKPQY
LVQATIWIDQADRRGPDRGPTPIRSGQLLEPEAWVDLLRSYIVLDQVVREQRLFLTVRPLADSVALGTFGVADQYRPGKY
RLTVDSTGQHYTLADGEGVALEHGVVGDSVGARLGFLWVPTRDALGAGRTVRFALATVRDGARHLDEALDVRAAPDGSFL
HIELRGAQPARITAIVNAIAQRYVEVAAELKREKVTELTKILDQQVESARQRLRDAEAGLRSFGVRTITLPSGRAAAGVT
GTGADRDPALTSFFDLQIEQQQAHQDRKAILQALAQARDSGLSATALEAIGAVQHNADLAQALKELVTKQADLRVLRYQY
TDAYPRVQRLTAEIATLQRQTIPALAQALAGELAAREAELGRRVETGSQNLRQIPPRAIDEARLRRDMTLAENLYATLQQ
RYEEARLAEASTIPDVRILDSAVSPQRPVKNTAPRIVLFALFASLGLAVAGAVLLDRVDPRVRYPEQVSRGMGLTILGAV
PHLRKSEAQRQGTGPLSENVAEVLEALRGVCLNLEHAYGTAGPLIAAVTSPGPGEGKSFIAANLAYTFAESGHRVLLVDA
DIRRGVLHRRLGRPRRPGLCDFLRSEAPLEAIVQSTTHPSLALVSCGTRAHHAPELLGSPAMGQFVAGLRTHYDVILFDN
PPLAAGVDPLIVGTLTGNLLLVLRTGQSDREMTAAKLEVLQRLPVRLLGAVLNDVPAGATYRYYSYYLPGYEAVDEEAQA
QPLVT
>gnl|bykdb|A0A2V7IRW6 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=811 residues).
MKKSPETDMDTGDLPARLDPVQPERLPSPAGSFDAIARYAPPAAGAPQDGDVLADLRRYLSAVWRYKWAVTGITVLGTAA
GVAGKMLLPPNYVARATVWIQVPARPTRDEGPIWSGQLPISSGWTDLLHTNVVLEEVVRQQRLYVAPQEPRDSDALAGFG
IKDRVRGGTYRLVVNDGGTAFTLEEMKAGTVQHGVTGDSVGAALGFAWVPPSAALSRGRRVEFTVSAPYEAARALGKRLK
TSLDLDGNFLRLELGGPDAAGITAVVNAVAERFVAAAAELKRQNLTELTRILSGQLERAQANLRDAETALKTFRVSAVTE
YADGAAPVTPNMQFPRDPVFAGLLDMKVNREQLRRDREAIARILAQGRDSGLAVDALAMIGSVEKSTELSQALRDLTGKV
AELRALRGRYTDANVAVRRVSDEVAVLEQQTIPALATKLTQEMAVQEAGLAQRVDSAAGGLRRIPPLAVEETQLQRSVTL
AEQVVTNLQQRYEEARLAEVSAIPDVRLIDPAIEPQQPAASWAVLLVVLAFLGSLGAGVAGAVVRDRTDRRVHYPEHVTG
TMGLAILGAVPHLERGRNGKKAGAVLQVVEAVRGIRLNVLHAHGAGPAVLTVTSPGRSDGKSFVASNLALAFADAGYRTL
LVDGDVRCGTLHRALKLARKPGLVDVLGGKASTELVVQATSYRALSFIGSGTRTHTGPSLVSSAALPRLLAALRPSYDAI
IVDSPPLAAGADAFAIGTATGSMVLVLRTGVSDRELAQTKLEVLAHLPIRMLGAVLNDVRGGLYRYYSYYLEGYEVKEEP
EPAWQLVRAPE
>gnl|bykdb|A0A2V7ISE2 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=932 residues).
MDIGFVPARVWPPLTQGSGQSVATSQRPDSQAIAAPAARRTRAPGWTVAPTCIHRLPHAAPICGMTSPAGGEGVGPCAVS
DLLSSRRDAGARHDAARPARRNRPYRSIGNGSMAFSNLPAAPLVPPPVVAPGTPHRGMTEFDLAGSDSGLDWRRILSALL
RFKWLIAGFTLVGTVAGVGATRFLKPEYAAQAKIWIDVEGRRGPDRGPAPIRPSQLLDAESWVDLLKSYVVLDQVVRDER
LFVDPSSPADAQALEGLRVADQYRPGAYRFTVDRAGQGYTLATADGIELERGTLGDSVGTRYGLQWAPDAGTVAPGRTVE
FTLTTLRDAATGLGEALDVRMDMDGNFLRFELRGPYPTRITAIVNAVAQRYVQVYADLKRQKVIELTKILGEQVQHSQEN
LRNAEAALQRFREETITLPSDRPAAGASVAGAGVGGAGAAGGARDPVFGGFFETQLTREEARRDREALGRLLAQAGDSGL
SPEALSVVGSVQQNPELSEALKELTDKQALLRTYRYKYSDEYPPVQRLLGEIATLQRQTIPTLARALAGQLAGKEAELGR
RVDADSRSLRQIPARTIEEARLRRDASLAENLYTSLQQKYDEARLAEASTLADVRVLDSAVVPRRPVKNTAPRVILMAFF
GSFALAVMGAVLIDRIDPRVRYPDQVSREMGLTILGAVPHVRPGARPTPRNGRRVRPPEDVAVVVEALRGVCLNLVYTHG
AASPMLVTITSPGAGDGKSFLAANLGHTFAEAGHRTLLIDGDIRRGVLHRRLGARRRPGLTDFLRGEVPLEAIVQATPYP
SFSLIGCGTRAYNAPELLGSQTMSQLVTALRPSYDVILVDSPPLSAGVDPLILGTLTGHLVVVLRTGYSHRDVAAAKLEV
LQRLPVRLLGAILNAVPAGAAYRYYSYYLPGYEAVDEEAERTSGGNKQPFVI
>gnl|bykdb|A0A2V7ITT6 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=817 residues).
MACRPPPRPSPRSKDPVPSIEPPQPPPDGFPEVWSGSPFRGAQPVPSAFRPEHDGVHDWQQYRGAVARYKWVVVLVSTVG
TLIGVAATRFLRPEYEVQATIWIESHDPRTEDRGPIRGDQLLQASSWLQLLRSYVVLDHVVRDLRLYVTPALPADSDLFQ
SFEVAAPFRPGAYRLAVDESGRAFTLFTTAGDSLQHAAVGDSIGNGLGFRWTARAGALLPGRVVDFTVGTPRSAAEQLAR
RLRAKTDEAGNFLSVQLTGNDARHVTAVLNAVVQRYVAVAADLKRDKLTELSKILQQQLQYAEHNLRSAEEVFEDFRVQT
ITLPADRVTPVAPGVELTRDPGVAAFFNMKVEREQLRRDREAIELALAQAADSAASWDALSVIGSVQQSPGLMQALKELT
DKQAEQRALGYRYTADFSRVGYVREQVDTLERKTIPGLARALIRELAMRESVGDARIRLASQDLRQIPPRAIQEGRLRRE
VAVAENLFTTLQQRYEEARLAEASSIPDVRVLDVATPPLVPVRNTAPGVILGAFLGSMALGLVGVVRRDRADPRVRCPEQ
VTHDIGLPILGVLPHVKVRGAGPEDEHVAQVIEAMRSVRLSLSQTHGGGGPMLVTVSSPGIGDGKSFVSANLALAYSGAG
QRTLLIDGDVRRGSLHRAMLTQRTPGLTDVLAKRAPLERVTQATSYTALEFISAGTHFRDAPELLGSDAMVELVTRLRGS
YGVILVDSPPLASGVDPYTLGMVTGSLLLVLRTGATSLELARTKLRVLDRLPIRLLGVVVNDVRPRGVYRYHSYLSGYGT
ADEAEYAMGPPRVRGVL
>gnl|bykdb|A0A2V7IWX2 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=921 residues).
MFNGVPFLCKRTNRGRALRGAIPLAPMHMTCAPPRPAGRLPEPIALQRVAPASRREHAPARAAHVLRICGATCCAYATRR
HRHAPRRRCGREAGVRSQRYRPCSGDPWSRDVESRAIRFALDMAHEGPSLPEPARLDAIAATPRSRAPTRYEQLPRLLPA
AEPDWRRILGAIGRRRWVVLAVTLLGTAAGVVAAAKFVGPRYLARARLWVGAAEPNPNALRGTTPPPGAERLLGVAAWVD
FVRSDAVLDTVVRDVRLYLDPRTPLDGTALLRFGLKDQVLPGRYRLEVDRDGAGFTLFSAQGGVVQHGERGDSVGPALGF
AWVPGAAVLTPGRRIEFTLLTPHDAAELLASQLQVTTDPEGTFVTVQLTGTDPQLTAAIVKGVADRTVAVAADLRRHKVA
ALADILGEQVRHAQASLTAAELALKSFRVRAAGVLPAGVAAPPPSPAFTNAFELRVAVDQLGRDRQAIDRVLAQQPDSGL
SVDALAAIDAVQKSPELTQALKELTDKQAELRALRYTYTDQHFPVQQLADAVATLDRRTIPGMLRALRNNLAARERDLGQ
RVDSTVRYLSNIPPLLFEQTRLEREVQVAGQLYASLQQRYDEARVAEASALPDVRILDAPVQPYQPIGSVAPFLVIMAFL
ASAGLGVLGAVVIDTLDPRFRDPGHVTQGLGLRILGALPHLSRAGNGEGTAQAIEAMRTVRVKLQHASNGGNPLLLTVTS
PGVGEGKSLVSANLALAFAYAGLRTVVIDGDIRRGALHRLLRGSRRPGLTDHLTGRAPLEKVLQTTPYKCLSFIGCGSRM
HNSPELLSAATMVDLLAALRSRYDVVLVDTAPLAAGADPYTMASLTTNLLMVLRAGVTDLELAQAKLESFEDLPVRVVGT
VLNDVQPKGAYRYYAYYVPGYETKEEADLGPEKPVLGVPSV
>gnl|bykdb|A0A2V7J3C0 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=749 residues).
TRRYRWWVLALTGVGILGGILAGRLLPPRYQVQATIWIQSSEPRGTGRGPIGANQLFESYAWVDLLKSYVVLDQVARDLK
LYLTPERGANGAFAGFEVGDTYRPGRYRIVADRTGRSFSLLGAKGEELQQGAIGDSIGAALGFRWAPAAAALHAGSDLTF
TVRPLRDAARKLANSLAVTLDPGGNFLRIGLTAEDATRGAATANAIAQRFVEVGADLKRAKLHQLGTLLDEQLRAARDNL
RRTESALEQFQVGTATFTPTVGTAAASAGRDAAFGSLFAPRLEEEQLRRDRSAIQQVLARMRDSGGSPEGLAFIGAVQRT
ADVSQALRDLTVKQADERALRARYTPEHHAVQQLRAEIAALEQRTIPALAESLSAELLARERVLAPQIAAGEHELRGIPQ
RAIDEARLRRDLELATNLFTGVQQRYDEARLAEASSIADVRILDVAVPPQEPLKDTASRLLVLGFIAGLGLGLVGAVVAD
RVDPRMRYPDQVTRQMGLPILGVLPHVKDRAAGPDDEEVAQVIEAMRSVRLSLMHFYGGNGPVVVTVTSPGAGDGKSFVS
ANLALACAESGKATLLIDGDSRRGGLHRILHRPRKLGLTDHLAGAASLEAVTQSTPFAALDFIAAGSRYRDSPELLGYPA
MVELLEHARAHYAVVIVDSSPLGSGVDPYTLGTLTGSLLLVLRTGTTNLALARTKLAVLDHLPIRLLGAVLNDVRSDDLY
RHYSYLSGYATVDEQEGYAIAGRKAHGVL
>gnl|bykdb|A0A2V7J4D7 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=793 residues).
MMPGESIARFRSTAPTVAGPFEDPNPPPDWWRYVAAIRRFKWLVLGVTVGATALGVVGTMFLRPTYAAQATLWIQVPARQ
PREAGPIWQAQLPISTGWMDLLQSYAVLDDVVRGQRLYLHAKVPGDSDILATLRIKDHVAPGKYRLVVEDTGDAPHFTLY
NARSKTPVQTGVAGDSVGPDMGLAWVPPRAVLAGPREVDFTLDPPYEAALGLARNLKVAADLDGNFLRMELGGHDPAQIA
ATVNAVAERFVAVAAGLKRDNLTELTRILGDQLAQAQANLRQAEASLKSFRVGAVTTVAAGAGSVTESSQYPRDPMFAGL
VDLKVNLDEVRRDRTAIERLLAPSTDPTVEVPVDALSMVGSVQRSTELVQGLRDLTSKQAELRALRAHYTDANPPVRRLA
SEVDELAHRTVPALAASLVAELRVRESELVQRVDAASSSIQKIPPLAVEESRLQRGVTLAEQTVTNLQARYEEARLAEIS
AIADVRLLDRAVEPQVPVGHMRAILIFLAFWGGLGVGVAGAVLLDRTDRKVHYPEHVTRAMGLSILGAVPHVDWRNGNRD
AAATQVIESLRGVRLNVVHRHGTAGPVRLTVTSPGKSDGKSFVASNLALAFADAGYRTLLVDGDVRRGRLHHTLSAARRP
GLTELLEGSAPQDAAVQATRYKNLSFISCGLRSHAGPALLSSVAMARLLDALRASYEAIIVDSPPLAAGADGLALATVTG
SLVLVLRTGVSDRELTETKLGALHHLPVRVLGAVLNDVRPGGAYRYYSYYLEGYEVHDEPAAADVHVLRGPER
>gnl|bykdb|A0A2V7JTZ5 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=805 residues).
MSVRSLQPDYPLAPHHPGSIPTAEWTPARPRSEDFEDAEGIPWSRYVDAIRRHVLLIVGLAAVGSVLGVVAARRVRPIYE
AQATVWISTTPSSALQTGPIRQQQLLTTGSWVELLRSFAIVDPIVRDLKLNVSYKQPSDSVLFRNFEWTPATRSGAYLLK
IDGAGPKYMLSTAKGVFIESGAIGDSIGRKAGMNWLPDARFLGRGRAIEFGVTSPRNVSVFLVNAVHASLPEDGQFLKIT
LSGADPRRTARTVNAWAEQLVNSSGDLKTRHLFEFKKILGDQLALAEAQLRTSENELEHFRVSTITLPSGVAASAGPGVT
QGDPVVASYFQQKVALDEIRSERQALERMVSEAKGGPINPQDFLQLPTILNNAPQLRSAIEELSLRQATLRTEQQFLTDA
NPRIRQLAEAVRVLERETIPQITVAVLNSLKAREPELDTRISVGSQELRGIPARATEEARLVRQVAATENLYNSLKARYE
EVSLAEVQTAPDLSVLDTAVAPTLPTSNDAPRLLLLAVVASMGLAVGIALIRDRLDRRFRYPEQATRELGLSVAGTVPKF
KANHRGEFQIAMMSQAVESFRTLRLALRYDFPTDAPIVVGVSSPAAGDGKSLVSSNLALAFASAGSRTLLIDGDVRCGGL
HNTFEIPVTPGLVDYLNGHAAVDSIVRSTTSENLFLIPRGTRGNRAPELLVSELMSALVHAMRLQFDVVIIDSPPLVAGM
DAYALGAAAGSMLIVLRPAVTDRKLASAKLEVLDRLPIRILGAVLNAVPDGGAYRYYGADYSYKDEVLKEPIADIATPKG
LLVRS
>gnl|bykdb|A0A2V7KQV7 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=806 residues).
MASDATLPPNQPALVPFQTGFQAAAAPAPMSDWARVFAAARRYKMLVATVTVVGSLAGLVIGKFLKPVYQAQATIWIQSS
EQDHDRGRADQGPIQSAQLLGTSGGWLDLIRSHVVLNDVVREARLYLAPKSRADSAALATLTVFGDVRPGTYRLEVDQTG
QHFTLRDVAENAVLQQGSVGDSVGGLLGLAWVPPAGTLRPRAVIRFTMTALSDVALELSQSLRIRATADGYFVRLERRGH
DPVLITTTVNAVADRLVAVAADLKRERRTELSSILHEQRDRAKANLSSAELALTQFRVRNAVRPSEGPAEGPDGRRITAD
PTFASYVDLQVAIDGLARDREAITQVVARARDGSVPVDELSMIGAVQRSSALAAALKDLADRQAELRVLRFRYADTHPPV
RRLAQQVDTLARYVIPELGGALVAALAAREHELQQRIDSIARALRGAPPVALEEIRLARDQANATELFSNLEQRYNEARL
AEVSTLPDVRILERASRPARPVVNATPLVLLLALVVSLGTGVGGAALLDRADPKIRDPEQVTRAMGLSILGAVPHVHRNG
NGNGNGNGRAHAETDDTGALEALRGIRLNVQHAYGAAGPLLITVTSPGRGDGKSFVTCNLALAFAQVGYRTLLIDGDVRC
GALHRLLKAARRPGLTDVLANEVTPDQVVQSTPYAHLSFIGGGSRLHRGPELLCSEALPRLITAMRPHYDAILVDSPPLA
AGVDASALGAVTGSLLVVLRTGVTDRMIAEAKVELLRTLPIRMLGVVLNDVRPGVAYSYYAYSLEGYSVREEDPDGRAGT
LLPRRS
>gnl|bykdb|A0A2V7KS68 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=808 residues).
MLIRHMMTSRHLPALRSDTASPARAERASVSTRALRPEAAAFPDDEHGPDWRRVGSALLRFKWLVLAALLAGLAAAFGAT
KVLRPAYKAQANVWVDVPGRAEGDRSADNRGPIRTAALLEADDWIELLRSYIVLDQVVRDLRLYLTVKRPAERAIFSTFN
VADDFRPGLYRLRASADGRSYTLSNKDGVELERGTVGDSVGRRLGFLWQPSSLPRDHAVEFSLAAPRDAATGLGNALDVH
MDINGNFLAVELSGQNPVLIANILNAVTQRYVDVAAQLKREKLTELTKLLENQLNTARSNLDDAESALQHFRTRTITLPS
EQAGPSATETRDPIRSNYFDMEADRDQLRRDREAIEGLLPAGGGPLPADALSAIESVQHAPELANALKELGDKRAELRTL
RYHYSDAYPPLQRLAGQVAQLEQQTIPTLARGLAAQLAARESEIGRQVDAASTDLRQIPARTIEEVRLRRNADLKEQTYT
SLQQRFDQARLAAESTVPDVRVLDPAVVPQRPVKNTTPRLLLLGLIAGLGLGMVGAVVLDRVDPKVRYPEQVSRELGLPI
LGVLPHLRTKEPAEVVEALRGLRLNVIHEYGTAEAAQPLIFTVTSPGPGDGKTFLSSNLALAFAEGGHRTVLVDADIRRG
LLHRRLKANRQPGLADYLLGETTADEIVQQTAYPRLSLIACGTRTQRAPELLDSDAMVTLLTRLRGEYDVVLIDSPPLTA
GVDPFVLGTLTGALVLVLRTGHSNRNITGAKLDMLQRLPVRLLGAVLNDVPRGGAYGYYAYYSYYLPGYEAVEERDGARQ
TGPVVVTE
>gnl|bykdb|A0A2V7KWV9 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=788 residues).
MTDLPSAPRSQLPARPALSSIDLAADSGGAPDWRRHGTAVWRHRWWILGLTVLGTIGGVGASRVLPPRYLVQATIWIQSS
EARGTPDRGPIGANQLLAPTAWGDLLKSYVVLDAVARERRLYLQARPRDLPALAGFAVADQFTPGRYHLTIDHDGQTFHL
QREDGTELEQGAVGSPVGRTLGFIWTPTTAVLTPGREVRFVVSPLRDAAKKLADNLNVTLDLSGNFLRVALTSPNGTDAA
ATVNAVADRYVAVATDLKRVKVTELSRLLNEQLQAAEANLHKAERALEDFRVRTIMLPAEPVAGSAARTSPVSEFLTRRV
QEDQLRRDQDALAQVLAQGPDSLGFSERLAAIGAVQGSADLTRALTELTTKRAERRALLYRYTDDHPAVQRVTTDLEQLE
HQTIPGLIRGLVAELATQRRALASQLETGGRELQGIPQRAIEDARLRRDVSIAENLFTSVQQRYSEARLAEASSIADVRV
LDAAVAPETPVKNTAARLLILGLFAGLGLGVVGAVVVDRFDPRVRYPAQVTTDMGLRILGALPHVKKRAGASDDESGPLV
IETMRGVRLSLIHAYGTAGPLVVTITSPAPGDGKSFVSANLALACAQAGQRTLLIDGDTRRGALHRVLGGVRRPGLTDFL
AGNVSFEALIQTPNFGSLQFIGAGSRIRESPELLGSPRMVELLVRLRAMYPVIIVDSPPLGAGVDPYTLGTMTGAMMLVL
RTGATNLDLARTKVAMLENLPIRVLGAVLNDVRLGQMYGEYYGYMAGYGTTTEDGGTRIARRRLQGAL
>gnl|bykdb|A0A2V7KXK7 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=820 residues).
MRDGERHRACVAHPCMEPKEPHEMSGSNGEGTRIPVLRSESSLDTIRMKSLTTPSAPPPPPAEHSDWQRYFNSVMRHKWF
VIVVTLVGTALGIVATRFLDPRYTAKAILWVDVAVGRDRGVQSDQLLDSRGWEELVVSNAVLDTVVKERRLFIHPETPQD
SAALTTFDITDRVAPGDYRVVVDKAGRAFRLELEDGTVVQRGRVGQPVGESVGFDWTPTAAMLKPGTTVKFGVSAITDAS
ASLAKSIKTRLDPDGNFLRLQLKSTSAAGAAATLNAISARIVAVESEMKRRKFEELAGVMDEQHQHAKEALDQADEALRN
FRVRTADRPLVTQAPGGGLTVEGSGVVTQLRTDMDQQRRDRQQILSLATRAQSSSVPVQLWNSIPSVQNDPVMKGALDEL
GLKQAQLRQLRLQYTDSAAPVRQLQSDLTTLEHQQIPSLARILAGTLGEVVATTKPRADTAIGQLRAAPSIALEGSRLER
EQRLAEEQFNNVDGEYQKAKLGLISALPDVRVLDPAQEPRRPAADFGPLLILLAAMASFGLAVMGVTLRDKMDPKVRYPE
QITGRMQLPILGAVPHVSWRLGANGDGPAQVIEALRGLRLRVLHAHAGEGPLTLTITSPGIGDGKSFVSLNLALSFADAG
YRTLLVDGDTRRGVQHKALKTPSTPGLTDVVAGRVALDAALRLTSYPGLTFLSSGTRMQRAPERLLSQNMRDLMSKLRSM
FDVVIVDSPPLGAGADPLVLGTLTENLLLVLRTGQSDINLASTKLEVLNALPVRVIGAVLNDVRSSGVYRYYMYSSAEYE
LVDDEGQTREALPSILGGRT
>gnl|bykdb|A0A2V7L1V3 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=816 residues).
MTMSHLPLPPGSTPPVMVPPSAPPATTGWGGPESEGGVDWRRVYSAVMRFKWLICAVTVLGTVAGFGLARFVRPQYGAQA
TIWIDATERERWGQAQDRGPIRQGQLLDPQSWVDLLKSYVVLDTVVRDQRLFVSPKSRADEDVLASLRVTGQYRPGTYRL
KVDSDRRSYTLSTAPENQVVERGTVGDSIGIKLGFVWAPAAGALPADRTIEFRLATFRDAARSLADSMSAQLDPQGNFLR
LELRGPDAPRITAVVNAVADRYVLVAADLKRKKLTELTKILGEQLQSAEDKLRGAEAALERFRERTITLPADRPAPVALG
APGGAGGGSQGQVGEADPKFGTFFTMQFDRERIQQDREALQRLLQARDSAGLSADALAVVGSVQGNPDLAAALTELTSKR
ANLRALRYRYSDQYPPVQRLVGEIGTLERQTIPALARVLLDQLAAREAELGRRLGADSRSLQQIRARAIEEARLRRTKTM
SENLYTMLKERYEEARLAEASTIPDVRILDAAVVSREPVSAMGGRLILLGFCGSFGLAVVGAVLLDRVDPRVRYPDQVSR
EMGLAILGAVPHLRTLPHAGRHGRARVPEDVNQVVEALRGVCLNLVYAHGGRAPLLVTVTSPGAGDGKSFLAANLGHTFA
DGGHRTLLIDADIRRGVLHRRLSARRRPGLSDFLRGETPLDAVVQATPYPSLSLIACGTRAYNAPELLGSPAMSELVTGM
RSGYDVILIDSPPLAAGVDPLILGTLTGTLALVLRTGYSHRDVAAAKLEMLQRLPVRMLGAILNDVPAGGAYRYYSYYLP
GYEAADENSGSRRVPV
>gnl|bykdb|A0A2V7LFN9 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=798 residues).
MTTGSLPARLDTPKAEDRNAVARPAPALPPDAGDWLADAQRYLRSVRRHKWLVLSLTLFATAAGIELSVYALPPNYAARA
TVWIQVPAHQARDEGPIWSGHLPISSGWIDLIRTNIVLEEVARRERLYLVNVSGDSAALTSFAIKERVRPGTYLLAVDTV
GTGFTLTDDAGAVLDRGAVGDSIGAALGFAWVPPEGVLLAGHVVEFTVTTPAEAATRLRRELKVSSDMDGNFLRLELTGP
DAAGVTGTVNAVASRFVAAAADLKRDNLTQLTGILGAQLEQAQARLRSAETALQRFRVTAVTEYAEGAAPVTPNMQYPQD
PVFAGLLDLKVRRGDLLRDRAAIKRILAQGPESGLMVDALATLASVERSTELSQALRDLTAKQAVLRALRVRYTAEAPAV
RRVAAEAATLERQTIPQLATGLARELERRAAELGQRADSVARDLRRIPPLAVEETRLQRDVTQSAQTVANLQQHYEEARL
AEASSIPDVRFVDPALEPQEPTENWAPVLVLFTLITGLGAGVGSAVALDHRDRRVHDPEDITRTMGLTILGVVPHLERKR
RAKQPEDGLPVLEAMRGICLNVLHSHGVGPVIVTVTSPGRADGKSFVASNLAVAFADAGYRTLLVDGDVRCGRLHRTLKL
PRRPGLTDLLQGRASKEQAVQLSAYGMLSFLGCGTRTHDGPALVSSAALPRVLAGLRSSYHAIIIDSSPLAAGADAFALG
TGTGTLLLVLRTGVSDGGLALAKLEVMSRLPIRVLGAVLNDVRGGSLYRDYSYYLEGYETQDEPDEARGQVLRAPEYP
>gnl|bykdb|A0A2V7LJS2 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=799 residues).
MSQPHPNDARAASDSVADRGELDAPVSTVRLDDLFAVLRRHIRLVLGVTAAAMMAAGYVAYVTGSVYRAVAVIRLSDPRR
AFTGGVVDDPALLADGRYADPLLSQVELLKSRTVAGGVVDSMPMLRVVLRKSSPSLLDRVLRRRFSPNLLGVVAVRPDAA
ADSLSLTFERDGFLVGTGPARRRAAYGTVVEVGGVRFAILRRPEVRQGVLRVLSRDAAISALLTELRVRPRMRTDIVDVA
YSAPDPARAQEVVNRVVDVFRAASAEAAQGQSRLRREFLEAQLRVNDSLVADAQDALTAFQRRARSDGSGQTSGREQTEL
PGLELQRQQLLAERRTDETLLKALQDSSTSRRAIQTALSTPGVAPSPAVVQLNTQLFQYEIARDSLASLSPSHPDLPRLN
LLISSTEAKLLRAVQAGVQGAIASLDGRIAAINDLRARRAGNLQHVAQEARLTERVENARKVADELRTEYQKAGIAEAVT
VGQVEIVDHATLPMKPAGIGLAEQLALGLLVGLILGAGGAFVAERVGSSIARRVEVEHLGLSVLGIVPRWGRETDKKGPG
SADAAVEAFRGIRLNVLNAHGAAGPAVVAVTSPGSGDGKSFVSSNLALAFAYANHRTLLVDADLRRGALHRALQLRREPG
LTDLLAAAASPEQVVKATSHPSLDFLASGSRRGDAPELLGSARMADFMTKLRSSYGVIVVDTPPLGAGVDAFVLASLAGS
LLLVLRLGRTDRELAEAKIDLLRQSSTRVLGVVLNDVREGSEYRAYSYYMDGYEFTGEPLFQPLGDATKRGRPPVTARQ
>gnl|bykdb|A0A2V7LMU1 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=884 residues).
MNSATTDRAYSRRHRPNAPRCIRYGALIALNCGISADGLRRRTGIGLATCSAHDTTLCGATPRATRRGTPSMTLSHLPLP
PSSPPPVIVPPSSKSLSTEWGGAESEGGVDWRRVLSAVLRFKWLICGVTILGTAAGFGVARFVRPQYGAQATIWIDATER
ERWGQGQDRGPIRQGQLLDPQAWVDLLKSYVVLDQVVRDQRLFVSPESRADEPLVATLQVTGQYRPGAYRLKVDSDRRTY
TLATVEGQVVERGTVGDSIGTRLGLAWAPAASTLPTDRAVGFGLSTLRDAARSLADSLSAQLDAEGNFLRLELRGPDAPR
ITAVVNAVAERYVQVASDLKRKKLSELTKILAEQFQSAQGNLRSAEAALERFRERTITLPSDRPPPVALGAPGGAGGGAQ
GAELDPKFGTFFNMQFDRERIQQDREALQRLLAQVRDSTGISPDELAVVGSVQANPDLAAALTELTSKRANLRALQYRYS
DQYPPVQHLTGEIATLERQTIPALARGLLDQLTARDAELGRRLGADSKSLRQIPARAVEEARLRRSVTMAENIYTMLQQR
YEEARLAEASTIPDVRILDAAVVSRQPVRDLAGRMILLGFCGSFGLAVVGAVLLDRIDPRVRYPDQVSREMGLTILGAVP
HLRTLPHGRHGRGRVPEDVNQVVEALRAVCLNLVYAHGGRAPLLVTITSPGAGDGKSFLAANLAHTFADGGHRTLLIDAD
IRRGVLHRRLSAHRRPGLSDLLRGETPLDAIVQATPYPSLSLIACGTRAYNAPEMLASPAMSQLVNGMRSGYDVILIDSP
PLGAGVDPLILGTLTGTLALVLRTGYSHRDVATAKLEMLQRLPVRLLGAIMNDVPAGGAYRSYSYYLPGYEAMDEERGSG
RVPV
>gnl|bykdb|A0A2V7LN90 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=796 residues).
MTTGDLPVPFEPVRTEVVARYPPPPLRPDSEPLAEWRRYLMAARRYRWMVLGVTLFGTAAGVGLSLLLPPTYLARATVWI
QVPSARARDIRDRGPIWQGQLPITSGWMDLLQTNVVLEDVVRRHRLYLTPRQPGDTDALATFGIKPHVRPALYRLVVDSI
GKTFTLSDKKHLVQLHGTVGDSIGAELGFAWVPPSGTLTPGRLVDFTVVAPYEAAKLLAKRLKTSADADGNFLRLELGGS
DPAEVTAIVNLVAERFVAIAADLKKENLQQLTGILSGQLERARDKLQSAEAGLKRFRVGAVTQYADGAAPVTPNMEFPRD
PAFAGLLGMKVNREELRRDRDAIGRILAQRPDSGLAVDALATIGAVQKSTELSQALHDLTVKQAELRALRTRYADANPAV
RRVAAEVAELERRAIPGLATSLTREMAFREAELAQRVDSAATDLRRIPPLAVEETRLEREVTRGEQAVASLQTLYEEARL
AEVSAIPDVRLVDPAVQPEEPAENWRPLLIALAFLASLGAGVTGAAVLDHTDGRVHYPQQVTGAMGLPILGAVPHLARNG
GTRKPDGVMQVVEAVRGIRLNVQHAHGTGPVVVTVTSAGRSDGKSFLASNLALAFADAGSRTLLVDGDIRCGRLHRVLKL
ARKPGLTDLLAGDATPEQVLQGTAYRTLTLLAAGTRTHAGPALIGSAALPRALAALRPGYDVIIVDSSPLAAGADAFALA
TATGSMLLVLRTGVSDRELAQAKLEVLQYLPIRVLGAVLNDVRLGGVYRYYSYYLEGYEATDEPAGAEGEVLRGPE
>gnl|bykdb|A0A2V7MEK4 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=798 residues).
MTTGSLPARLDTPKAADRNAVARPAPALPPDAGDWLADAQRYLRSVRRHKWLVLSLTLFATAAGIELSVYALPPNYAARA
TVWIQVPAHQARDEGPIWSGHLPISSGWIDLIRTNIVLEEVARRERLYLVNVSGDSAALTSFAIKERVRPGTYLLAVDTV
GTGFTLTDDAGAVLDRGAVGDSIGAALGFAWVPPEGVLLAGHVVEFTVTTPAEAATRLRRELKVSSDMDGNFLRLELTGP
DAAGVTGTVNAVASRFVAAAADLKRDNLTQLTGILGAQLEQAQARLRSAETALQRFRVTAVTEYAEGAAPVTPNMRYPQD
PVFAGLLDLKVRRGDLLRDRAAIKRILAQGPESGLMVDALATLASVERSTELSQALRDLTAKQAVLRALRVRYTAEAPAV
RRVAAEAATLERQTIPQLATGLARELERRAAELGQRADSVARDLRRIPPLAVEETRLQRDVTQSAQTVANLQQHYEEARL
AEASSIPDVRFVDPALEPQEPTENWAPVLVLFTLITGLGAGVGSAVALDHRDRRVHDPEDITRTMGLTILGVVPHLERKR
RAKQPEDGLPVLEAMRGICLNVLHSHGVGPVIVTVTSPGRADGKSFVASNLAVAFADAGYRTLLVDGDVRCGRLHRTLKL
PRRPGLTDLLQGRASKEQAVQLSAYGMLSFLGCGTRTHDGPALVSSAALPRVLAGLRSSYHAIIIDSSPLAAGADAFALG
TGTGTLLLVLRTGVSDGGLALAKLEVMSRLPIRVLGAVLNDVRGGSLYRDYSYYLEGYETQDEPDEARGQVLRAPEYP
>gnl|bykdb|A0A2V7MFS9 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=794 residues).
MNPLPLPAVRGQTAAPALRRASPPHTPSLPDGGEPGPDWRRIASALLRFKWLLVLTLTMGIGAAFAAIRLLRPVYRAQAN
VWVDVPDRRGEGPSDARGPIRQGALLDADAWVELLRSYIVLDQVVRDLRLYLEVKRPADRPSFSGFGVADAFRPGAYRLS
VSDDSKTYTLAAAEGVDLERGTVGDSVGRRLGFRWVPGPESLSPGRTIEFSVVQPRDAALRLGEQLDVRMDLNGNFLALQ
LQGTNPVLISSILNAVSQRYVAVAAQLKREKLSELTKILEDQLTTAQRNLDDAEAAQQRFRTRTITLPSDQQAGQAAAAG
TRDPIRASFFDMQVERDQLRRDRDALQRLLTQGGDSGLPTDALSAIESAQRAPELSNALKELSDKQAQLRAYRYHYSEAY
PPLQRLVSEIAQLQQRTIPTLARTLASQLASRESELGRQVDAASHDLRQIPGRAIEEVRLNRNAQLKEQTYTALQQRYDQ
ARLAAEATVPDVRILDPAIVPQRPIKNTAPRLLLMGLLAGLGLGVVGAILLDRVDPKVRYPEQVSRELGLSILGAVPHLR
AKDPVEVVEALRGVRLNLMNEHGPGPLLVTVTSPGPGDGKSFLSANLALAFADGGHRTVLVDGDIRRGVLHRRFKANRQP
GLVDFLNGEVGHDQIVQPTPYPRLALIGGGTRTQRAPEVLGSQAMTELIAELRGQYDVILVDSPPLTAGVDPFILGTVTG
SLLVVLRTGHSHREIAGAKLEVLERLPIRLLGAVLNDVPRGAAYGYYAYYSYYLPGYEAVDEGDGRRTSGPQVV
>gnl|bykdb|A0A2V7MR23 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=822 residues).
MTISNLPAALVPPAATPPALPQRGVSPFDLDGPEGGLDWRRILSALLRFKWLIATFTLVGTVAGVGATRFIKPVYSAQAK
IWIDVEGRRSPDRSLAPIRPGQLLDAESWVDLLRSYVVLDQVVHDQRLFVGSAARADTQAIDRIRVADQYQPGAYRLSVD
RSGQGYTLSTADGVELERGSFGDSVGTRYGLRWAPDASTVPPGHTVEFTLTTLRDAATSLADALDTWMDIDGNFLRIEMR
GPDPVRITTLVNAVAQRYVTVYADLKRQKLIELTKILGEQLQHSQDNLRSAEAALQRFREETITLPGERPVTGGASVAGP
VVAGAAPGTGPAGARDPLFGSFFEMQISREEARRDRDALQRLLAQQGDSGLSVEALSVVGLVQQNPELSQALTELNNKQA
ELRSLRYKYTDEYMPVQRLLGEIRTLQRQTIPTLARTLAGQLAAKEAELGRRTDADSRTLRQIPARAIEEARLRRDAGLA
ENLYTGLQAKYDEARLAEVSSLSDVRVLDSAVVPRRPVKNTAPRVILLAFFGSFALAVLGAVLIDRIDPRVRYPDQVSRE
MGLTILGAVPHIRPGARPERSGRRVRPPEDVAVVVEALRGVCLNLVYTHGAVAPLVVTITSPGAGDGKSFLAANLGHTFA
EAGHRTLLIDGDLRRGVLHRRLGARRRPGVSDFLRGEVPLEAIVQATPYPSFSLIGCGTRAYNAPELLGSQTMSQLLTTL
RPSYDVILVDSPPLSAGVDPLILGTLTGHLVVVLRTGFSHRDVASAKLEVLQRLPVRLLGAILNAVPAGDAYRYYSYYLP
GYEAVDEEAEQASGGKGQPFVI
>gnl|bykdb|A0A2V7MS64 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=798 residues).
MIGELPSPRPENDPRTTTTVIQPHGTRPVSIASAQEPPPLAQWPRYVSAALRYKWLVVGATLVATAAGVGASFLLAPEYV
ARATVWISISAHPAPRDQGPIWSGQLPISTGWTDLLRTNVVLEEVVRARQLYLTPKEPADSDLFSGFRAADRIRPGRYYL
VIDATGHRFALQDKHKTELQHGATGEPVGTALGFLWTPPAEKLTPGRRVEFDVDAPYEAARKLGKHLKTSLDLDGNFLRL
ELAGDDPVQITDIVNTVGQRFVAAAADLKRQNLTELSRILGDQLDKARTELTSAEQSLKQFRMSAVTEYTEGTASIAPNM
QFPHDPVFAGLFDMKVNREELRRDRAAIDRILAQGSDADLAVDALTMIGSVQKSTELAQALRDLTSKQAELRAIRSRYTD
ASPAVQRIALDVKTLQRQTIPSLATQLASELGLRETELAQRINAASTGLRRIPPLAVEEERLVREVTLRDQAVSNLTARY
QEARLAEVSAIPDVRLIDPAVQPEDPAASWTKILIALALLGGLSAGIAGAVVLDQNDKRVQYPEEVTGALGLTILGAVPH
LERNGNGRAKAGALEAVEALRAIRLNLLHAHGAGPTVVTVTSPGHSDGKSFVASNVAVAFADAGFRTLLIDGDVRKGVLH
RTLKAPRLPGLVDVLMGKVPVAQAIQSTTYRTLSFLPSGTRTQIAPVLVSSAPLPRLLAELRPNYDAVIVDSPPLAAGVD
ALALGTATGAMVLVLRTGYSDREMAQNKLQALTHLPIRVLGAVLNDVRGSRYKYYSYYLEGYEARDEQPASRLMRAPE
>gnl|bykdb|A0A2V7MVP8 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=798 residues).
MAQDPLLIPESARVDEVAPLLERRPARPYAEPPRPLAAGEPDWHRILGAIRRRRWLVLAVTLLGTAAGVVAAVRFVGPRY
LARARLWVGAAEPDPNALRGTTPLPGTDRLLGVEAWVDFVRSDAVLDTVVRDARLYLFPRTPADSAALVAFGLKARVVPG
RYRLEVDRQARGFTVVAVGGGVVQRGAVGDSVGPALGFAWVPGKTVLNPGRTIDFTVYTPHDAAELLAGELQVTTDPGGS
FVTVQLTGTDPHLTTAILRGVANRTVAVANELRRHKVAALADMLGQQVQHAQTSLTAAELALKDFRIRTAGVLPAGVVTP
PPSPAFTNAFELRVTRDQLGHDRQAIDRFLAQPDSGLSADALVVIDAVQKSPELMQALKELTDKQAELRALRYTYTDQNF
PVQQLADAVATLEHRTIPALLRAVRDNLAVRERDLGQRVDSTVRYLSNIPPLLFEQTRLEREVQVAGQLYASLQQHHDEA
RVAEASAVPDVRILDAPDQPYRPLGSLAPFVLIMSFLASAGLGVLGAVVVDSLDPRFRDPGHVTRDLGLRILGALPHLSR
AKNGEATTQAIEAMRTVRVKLQHACNGGSPLLLTVTSPGVGEGKSLVSANLALAFAYAGLRTIVIDGDIRRGALHRLLRA
SRRPGLTDHLTGRAPLEQVLQATPYKDLSFIGCGSRMHNSPELLSATTMVDLLAALRSRYDVVLVDTAPLAAGADPYTMA
SHTKNLLVVLRAGVTDLELAQAKLESFDDMPVRVVGSVLNDVRPKGAYRYYAYYVPGYETKEEADLGPEKPVLGVPGD
>gnl|bykdb|A0A2V7N0A9 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=848 residues).
MQMRPTAFRGRRRRPRWYRACSAALVPNAGPEPAPRPSPGKFETHTMPSQLTVPPQEGTPDRRLGAAAAAAGPVRRSEAA
PLPDDWRRVVAAIGTYRWFVVAVTAAGTLVGAVAAHFLKPTYQARATVWVEVPNPAARERDQGPIETGQLLGTATSWLDL
LRSHVVLDDVVRQWRLYLKPQSPADTAALATFAVPGDVRPGRYRLQVDATGHSFRLLDVDENAVLEQGAVGSNLGVGLGF
AWLPPAASLRGGARVEFTVATTSEAAQKLAEELRVRAAQDGNFIRIERRGPDRRVVTGTVNAVAERFVAAAAELKRQRLT
QLTAILKDQLDHAQDNLRAAEAALMAFRVRNAVRPSEGPAQGPDGRRITADPTYAGYMDLQIAASGLARDREAIAQMLVH
APDSGIAVDQLAMIGAVQRSSELIAALKELTDRQAELRALRFRYADTHPPVRRLAAQVDTLARRVIPGLGRALIAGLAAR
ERELRQRADSITGVLRRAPPAALEEVRLARDQANAEQLFSDLQHRYQEARLAEVSTLPDVRILERAVQPTRPATNTAPLL
VVVACLTSFGAGVLGAALRDRADPKVRSPEEVTRTMGLLILGAVPHVHRGKDMGDDGVKAVEALRGIRLNVQYAYGAAGP
LVLTVSSPGRGEGKSFVTSNLAQAFADVGCRTLLIDGDVRLGALHRALRRARRPGLTDALAGRVTADQTLQATDHAFLSF
IGAGSRMHRGPELLCSATVPQLITALRPGYDVILVDSAPLAAGVDPYALGVATGNMLLVVRPDVTDRAIAEAKVEVLQRL
PVRLLGAVLNDVRPGLAYNHYSYSLAGYEMQEEDSGREAGPILLPDSP
>gnl|bykdb|A0A2V7N4L3 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=802 residues).
MTPSPFPLIRNQPTGSVASAAPPPSSAGLRRGSPEGPPEGHEAGPDWHRIASALLRFKWVVILAVLLGLGAAFAATRVLR
PVYRAQANVWVDVPDRRGENPSDARGPIRQGALLDADAWVELMRSYVVLDQVVKDQRLYLETKRASDRGNFVAFRVDDTF
RPGDYRLNISDNGRTYTLASAEGKELERGTVGDSVGNRLGFRWVPAAGSLPPGRTIEFSLMTPRDAALRLGEQLDVRMDL
NGNFLALELRGANPVLISNILNAVSQRYVAVAAQLKREKLTELTKLLEDQLTTAQRNLDEAETALQRFRTRTITLPSERS
PSAAVSGDTHDPRAGFFDIQVERDQVRRDREAIDNLLAQGWDSGVPTAALSAIGSVQHAPELSSALKELGDKEAEVRTYR
YHYSDAYPPLQRLLAQVGELQQRTIPSLARALSSQLAARATELGRQVDAASPGLRQIPGRTIEEARLTRNAQLKEQTYTQ
LQQRFDQARLAAEATVPDVRILDPAIVPQRPFKNTAPRLLLMGLIAGLGLGIVAALVLDRADPRVRYPQQVSRDLGLPIL
GAVPHLRAKEPAEVIEALRGIRLSVLHEHGPGPLVVTITSPEQGDGKSFMSANLAMSFADAGHKTLLVDGDIRRGVLHRR
FKLSRQPGLVDFLLDEIGKDQIVQKTAYPHLALIGCGTRTSRAPEVLGSTAMNDLLTEMRGQYDVIVVDSPPLAAGVDSF
VLGTVTGTLLVVLRTGHSHRDITGAKLEMLDRLPIRLLGAVLNDVPRGAAYGYYAYYSYYLPGYEAVDESKHGRRTPAPT
VV
>gnl|bykdb|A0A2V7NJW1 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=957 residues).
MLVVHDEHPDVGPRPGLDCEQVRHLLREIRRDARGRLARLRFRPGWRHADDSPGGAGGRAVCDLPHADAESGPVRPLQLH
LSGEAVKGDCCANDTGFPCVPLAQQPLQRARQVTAACVGSRADCITSRSRRGAGRYQDCGIACRPPPRPSPRSKDPVSSI
EPPQPPPDGFPEVWSGSPFRGAQPVPSAFRPENDGVHDWQQYRGAVARYKWVVVLVSTVGTLIGVAATRFLRPEYEVQAT
IWIESHDPRTEDRGPIRGDQLLQASSWLQLLRSYVVLDHVVRDLRLYVTPALPADSDLFQSFEVAAPFRPGAYRLAVDES
GRAFTLFTTAGDSLQHAAVGDSIGNGLGFRWTARAGALLPGRVVDFTVGTPRSAAEQLARRLRAKTDEAGNFLSVQLTGN
DARHVTVVLNAVVQRYVAVAADLKRDKLTELSKILQQQLQYAEHNLRSAEEVFEDFRVQTITLPADRVTPVAPGVELTRD
PGVAAFFNMKVEREQLRRDREAIELALAQAADSAASWDALSVIGSVQQSPGLMQALKELTDKQAEQRALGYRYTADFSRV
GYVREQVDTLERKTIPGLARALIRELAIRESVGDARIRLASQDLRQIPPRAIQEGRLRREVAVAENLFTTLQQRYEEARL
AEASSIPDVRVLDVATPPLVPVRNTAPGVILGAFLGSMALGLVGVVRRDRADPRVRCPEQVTHDIGLPILGVLPHVKVRG
AGPEDEHVAQVIEAMRSVRLSLSQTHGGGGPMLVTVSSPGIGDGKSFVSANLALAYSGAGQRTLLIDGDVRRGSLHRAML
TQRTPGLTDVLAKRAPLERVTQATSYTALEFISAGTHFRDAPELLGSDAMVELVTRLRGSYGVILVDSPPLASGVDPYTL
GMVTGSLLLVLRTGATSLELARTKLRVLDRLPIRLLGVVVNDVRPRGVYRYHSYLSGYGTADEAEYAMGPPRVRGVL
>gnl|bykdb|A0A2V7NPD1 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=820 residues).
MAFSNLPAAPLVPPPVVAPGTPHRGMTEFDLAGSDSGLDWRRILSALLRFKWLIAGFTLVGTVAGVGATRFLKPEYAAQA
KIWIDVEGRRGPDRGPAPIRPSQLLDAESWVDLLKSYVVLDQVVRDERLFVDPSSPADAQALEGLRVADQYRPGAYRFTV
DHAGQGYTLATADGIELERGTLGDSVGTRYGLQWAPDAGSVAPGRTVEFTLTTLRDAATGLGEALDVRMDMDGNFLRFEL
RGPYPTRITAIVNAVAQRYVQVYADLKRQKVIELTKILGEQVQHSQENLRNAEAALQRFREETITLPSDRPAAGASVAGA
GVGGAGAAGGTRDPVFGGFFETQLTREEARRDREALGRLLAQAGDSGLSAEALSVVGSVQQNPELSEALKELTDKQAQLR
AYRYKYSDEYPPVQRLLGEIATLQRQTIPTLARALAGQLAGKEAELGRRVDADSRSLRQIPGRTIEEARLRRDASLAENL
YTSLQQKYDEARLAEASTLADVRVLDSAVVPRRPVKNTAPRVILMAFFGSFALAVMGAVLIDRIDPRVRYPDQVSREMGL
TILGAVPHVRLGARPTPRNGRRVRPPEDVAVVVEALRGVCLNLVYTHGAASPMLVTVTSPGAGDGKSFLAANLGHTFAEA
GHRTLLIDGDLRRGVLHRRLGARRRPGLTDFLRGEVPLEAIVQATPYPSFSLIGCGTRAYNAPELLGSQTMSQLVTALRP
SYDVILVDSPPLGAGVDPLILGTLTGHLVVVLRTGYSHRDVAAAKLEVLQRLPVRLLGAILNAVPAGAAYRYYSYYLPGY
EAVDEEAERTSGGNKQPFVI
>gnl|bykdb|A0A2V7P8B1 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=800 residues).
MTRVTEPLPSDSRAASGPFAEREEVEASASTVRLEDLFATVRRHIWLVLGVAAGVVAAAGGVAYVTGSVYRAVAVIRLSD
PRRAFTGGVVEDPALLADGRYADPLLSQVELLKSRTVAGGVVDSMPMLRVLLRKASPSLLDRVLRRRFSTSLLGSVAVAA
DAPADSIELAFDQDGFVVGRPPGRRRAPYGTVVEVGGVRFAVLRRPDAARGLLRVVSRDAAISQLLTELRVRPRVRTDIV
DVAYAAPDPSRAQQVVNRVVDVFRAASAEAAQGQSRLRREFLEAQLKVNDSVVADAQAALTALQRRARSDGWGQSSGREQ
TEVPGLELQRQQLLAERRTDEDLLAALQDSSTSRKAIQTALSTPGVAPNPAVVQLNTQLLHYEMARDSLVSLSPTHPDLR
RLSLLIPPTEAKLLRAVQAGVQGAIASLDGRIAAINDLRARRAGNLQHDADEARLTERLDNARKVADALRTEYQKAGIAE
AVTVGQVEIVDHATLPTKPAGIGLVEQLVLGLLVGLMLGAAGAFVADRMASAIARRVQVEHLGLSVLGVVPRWGRLGNKK
GPKSAEATVEAFRGIRLNVLNAHGATGPVVVGVTSPGSGDGKSFVSSNLALAFAYGNHRTLLIDADLRRGALHRTLKLPR
QPGLMDLLVGHATPEQVVHRTAYQSLDFVASGSRRRDAPELIGSARMTEFMSGLRSRYGVIVVDSPPLGAGVDALLVASL
AGSLLMVLRLGRTDRELAEAKLELLRAQPIRVLGAVLNDVREGSEYHAYSYYLDGYELGDEPLFEPLVSRPRGTTPVAGR
>gnl|bykdb|A0A2V7PBY9 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=885 residues).
MKWATNGAQEGQRRYPSRTKVHRRDVHPCTQLRHGGGRLGVARGIGLAVRRWDDTHRAPLRRALPTRGLPSMSISRLPIP
HGAPPPAAAPPPAPPAVPGTYAGFAEPEGGVDWRRVVSAVMRFKWLICGVTFLGTLAGFGAARFVKPQYGAQATIWIDAS
ERERRADDRGPIRQGQLLDAQAWVDLLKSYVVLDQVARDQRMFVSPKSRADARFLTTFQTAGQYRPGAYRLSLDADRQSY
TLATVEGRVLEQGRVGDSIGTRLGFAWAPTAATLPPDRAVEFELLTLRDAARSLADSLRTELDLEGNFLRIEMRGPDAAQ
ITAIVNAVAERYVQVAADLKRTKLSELTKILADQLQRAQGTLRSSEAALERFRVRTITLPTDRPPPVALGAPGGAGGGGG
SANGEASAQFGTFFNMQFDRERLQQDREALERVLAQAGDTAGLSPDALAVVGSVQSNPDLVGALGELTSKRASLRALRYK
YSDQYPPVQRLIEEITTLQRQTIPTLARGLLAQLTAREADLGRRLGTDSRTLRDIPARAIEEARLRRDVSLSENLFTMLQ
QRYEEARLAEASTIPDVRILDAAVVSRRPVQDLAGRLIVMGFCGSFGLAVVGAVLLDRIDPRVRYPDQVSREMGLAILGA
VPHMRTLAHGRGRGRIPEDVNQVVEALRGVCLNLVYAHGGRAPLLVTVTSPGAGDGKSFIAANLAHTFADGGHRTLLIDA
DIRRGVLHRRLSARRRPGLSDFLRGEAPLDAVVQATPYPALSLIGCGTRAYNAPELLGSPRMSELVTGMRSGYDVILFDS
PPLAAGVDPLIVGTLTGTLALVLRTGYSHRDVAAAKLEVLQRLPIRLLGAILNDVPAGGAYRYYSYYLPGYEAADEEAGS
RRVPV
>gnl|bykdb|A0A2V7PFU2 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=791 residues).
MNPRPLPAIRSQSAPVLRRANASAAPSLPEAESGPDWRRLASALLRFKWIVLLMVLLGLGGAVAATRLLRPIYRAQANVW
VDVPDRRGDPHADTRGPIRQGALLDADAWVELLRSYVVMDQVVRDLRLYLDVKRLGDRPSFAGFSVSDDFRPGEYRLNIS
DNGRQYTLTSAAGLTLERGTVGDSVGSRFGFRWVPAPGTLPAGRSVEFAVMPPRDAATRLGEELQVQMDMNGNFLALELR
GTNPMLISKILNAVTQRYVEVAAQLKREKLTELTKILEDQLTTAKRNLDEAEDAQRRFRTRTITLPSDQQRPGAAAETRD
PIRASFFDMAVERDQLRRDRDALERLLTQAGGLQTDALSAIKSAQDAPELSNALKELSDKQAQARTYRYHYSEAYPPLQH
LAAEITELQERTIPTLARALASQLADRESELERQVNSASNDLRQIPGRAIEEVRLNRNVELKEQTYTQLQQRYDQARLSA
EATVPDVRVLDPAVVPQRPVKNTAPRLLLMGLVAGLGLGVLGAIVLDRADPRVRYPEQVSRDLGVPILGAVPHLRAKEPV
EVIEALRGLRLNVLNEYGAETPVLFTVTSPGPGDGKSFLSANLALAFADGGHRTLLVDGDIRRGTLHRRFKANRRPGLVD
YLRGEAGIGRELIVQQTPYPQLAFIGCGTRTQRAPEVLGSPAMAQLLAELREQYDVIVVDSPPLTAGVDPFILGTATGSL
LLVLRTGHSHRDVTGAKLEMLDRLPIRLLGAVLNDIPREAAYGYYAYYSYYLPGYEAVDEGAGRTSGPRVV
>gnl|bykdb|A0A2V7PX99 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=808 residues).
MSNSPSWPVERAGPEVALQPVPDRGTAAAHGRAYEPPTPEPSDWQRMLAAAMRRRWLVILVTLAGTAAGVIGSRFLDPRF
AARAVLWIEAAGRAPGRDGGSIVDEALVQTPSWGELVTSGAVLEDVVRELRLYVTPKSPADAPVFAGFGLGKMVRPGRYE
LVVDRGARYELLDQNGALVERGAVGDSVGRSVGFSWAPSSSMLLEGRRITFNVSSPYEATQGLVKALRLKQDPGGSFLRI
ELKGTDPALTAATVNAVAGRTVTLAAELKRRKYAELAKILGEQAQQAQQALHASDAALASFRVRTAGVVQRGAPTVSPTM
DGKGDPVYSRAFELRLNIEQLRRERRVIEKALADQPKSGLPVEALAVLPTVGTSPELNTALQEINQKEADLRALRTRYTD
ASAPVQQARSDLDALEQRTVPALARKLAADLSAREAALTPQVDSAFGYMRTVPPLALEEDQLKRAVAGAEAFSATVNQRY
EAARLGLISSSPDVRLLDSAVQPGKPSLDLGPLLIALSFLTSLGLGMVGAVVLDRADPRVRTPEQVTRGMRLPILAALPH
VSLRQAPGASLRSAEVIEALRGLRVRVLHSQGVEGPLLLTVTSPSVGDGKSFLSVNLALSFAYAGYRTLLIDGDVRRGTQ
HRVVDAASEPGLTDVLAGQAAAEAAVQQTGYPNLSILSCGTRMYRSPELLLLPTLRETIARLRTTYQIIIVDSPPLVAGI
DPLVLATVTGNLLVVLRSEATDLELAAAKLSVADTLPVRTIGAVLNCVRGHGAFRYYTYDLADYAEPDPAVAATRRDGWR
HILGGRSS
>gnl|bykdb|A0A2V7Q7N9 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=828 residues).
MQARGPPLVPTLRCWEPVNQETLRGMTTGDLPVPFEPTRAEFVARNRPPPPPPDPEPLAEWQRYLLAARRYRWLVFGVTL
LGTAAGIGLSLLLPPTYLARATVWVQVPSGHARDARDRGPIWQGQLPISSGWMDLLQTNVVLEDVVRRQRLYVTARRPGD
SDALATFEIKDRVRPGVYRLVVDTAGNTFTLTDTKHLVRLHGTVADSVGPALGFAWVPPSGVLTPGRTMEFTVTAPYEAA
KLLTKRLKITADADGNFLRLELGGSDPGEVTAVVNMVAERFVSVAADLKKQNLQQLTGILGGQLERARDKLQSAEAELKR
FRVGAVTQYADGSAPVTPNMEFPRDPVFAGLVGMKVNREELRRDREAIGRILARGPDSALAVDALATIGSVQKSTELSQA
LHDLTTKQAELRALRTRYADANPAVRRVAVEVQDLERRTIPDLAASLTREMQFREVELAQRVDSAASNLRRIPPLAVEET
RLEREVTRGEQAVASLQTLYDEARLAEVSAIPDVRLVDPAVQPEEPTENWRPVLIALAFLASLGAGVAGAAVLDHTDRSV
RYPQQVTGAMGLPILGAVPHLNRNGGRRKPDGVMQVVEAVRGIRLNVLHAHGTGPIVVTVTSPGRSDGKSFLASNLALAF
ADAGSRTLLVDGDIRCGRLHRVLQLARKPGLTDLLGGEAAEEQVLQATAYRTLTFLGSGTRTHAGPTLISSAALPRALAA
LRPGYDVIIVDSSPLAAGADAFALGTATGSMLLVLRTGVSDRELVQAKLEVLQYLPIRVLGAVLNDVRPGGVYRYYSYYL
EGYEAKDEPAEAAGQVLQAPEQVLPAPE
>gnl|bykdb|A0A2V7Q8M6 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=913 residues).
MDIALVLDNGRPHSYAQFGPHCRDPAAWPGLPHGFSNNRSCGAGRPRSERTKLHPFFGCDCTELRHQLNRSAGRARYRTC
HTLSRDETQFSEASPRATPRGTRSMSMSHLPLPPGSTAPVMVPPSPPPPTAGWGGADSEGGVDWRRVFSAVLRFKWLICA
VTVLGTTAGFGVARFVRPQYGAQATIWIDATESERWGQGQDRGPIRQGQLLDPQAWVDLLKSYVVLDQVVRDQRLFVSPK
SRVDEAVLATLQVTGQYRPGVYRLKVDSDRRSYALATVEGQVLERGTVGDSIGTRLGLAWAPAATTLPADRAVEFALSTL
RDAARSLADSLSAQLDEKGNFLRLELRGPDAPRITAVVNAVAERYVQVASDLKRKKLTELTKILAEQLRSAQGNLRSAEA
GFERFRERTITLPGDRTPPGALGMAGGAGGGQGAESDPKFGTFFGMQADRDRIQQDREALQRLLAPASDSSGLSADALAV
VGSVQGNPDLAAALTELTSKRASLRALRYRYSDQYPPVQRLVAEIATLEHQTIPALARGLMDQLAARETELGRRLGTDSR
SLRQIPARAIEEARLRRTLSMAEDLYTLLQKRYEEARLAEASTIPDVRILDAAVVSREPVSSAGGRMILLGFCGSFGLAV
VGAVLLDRIDPRVRYPDQVSREMGLAILGAVPHLRTLPHAGRHGKGRVPEDVNQVVEALRGVCLNLVYAHGGRAPLLVTV
TSPGAGDGKSFLAANLAHTFADGGHRTLLIDADIRRGVLHRRLSARRRPGLSDFLRGETPLDAIVQATPYPSLSLIACGT
RAYNAPELLGSPPMSELVNGMRSGYDVILIDSPPLAAGVDPLILGTLTGTLALVLRTGYSHRDVAAAKLEMLHRLPVRLL
GAILNDVPAGGAYRYYSYYLPGYEAADENSGSR
>gnl|bykdb|A0A2V7QBC3 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=893 residues).
MPQRRRFAARIGQQRPRASRATPFRPHQGASVPPGDCTELRHQSHRSAGSARYRTCHTSSANEPQFSEATPSATWRGTRS
MTMSHLPLPPGSTSPVMVPPSPPPPTTEWGGADSEGGVDWRRVFSAVLRFKWLICGVTVLGTTAGFGVARFVRPQYGAQS
TIWIDATESERWGQGQDRGPIRQGQLLDPQAWVDLLKSYVVLDQVVRDQRLFVSPKSRADEGVLATLQVTGQYRPGVYRL
KVDSDRRSYALATLEGQVVERGTVGDSIGTRLGLAWAPAASTLPTDRAVEFGLSTLRDAARSLADSLSAQLDEKGNFLRL
ELRGPDAPRITAVVNAVAERYVQVASDLKRKKLTELTKILAEQLQSAQGNLRSAEAAFEGFRERTITLPGDRTPPVSLGV
PSAAGGGQGAESDPKFGTFFGMQADRDRIQQDREALQRLLAPTSDSSGLSADALAVVGSVQGNPDLAAALTELTSKRASL
RALRYRYSDQYPPVQRLVAEIATLERQTIPALARGLMDQLAAREMELGRRLGADSRSLRQIPARAIEEARLRRTLSMAED
LYTLLQKRYEEARLAEASTIPDVRILDAAVVSREPVSSAGGRLILLGFCGSFGLAVVGAVLLDRIDPRVRYPDQVSREMG
LAILGAVPHLRTLPHAGRHGKGRVPEDVNQVVEALRGVCLNLVYAHGGRAPLLVTVTSPGAGDGKSFLAANLAHTFADGG
HRTLLIDADIRRGVLHRRLSARRRPGLSDFLRGETPLDAIVQATPYPSLSLIACGTRAYNAPELLGSPPMSELVNGMRSG
YDVILIDSPPLAAGVDPLILGTLTGTLALVLRTGYSHRDVAAAKLETLQRLPVRLLGAILNDVPAGGAYRYYSYYLPGYE
AADENSGSRRVPV
>gnl|bykdb|A0A2V7QDU7 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=785 residues).
MSHDVTHSQGLRSPSLDGAPAGFLPGAGAAELVDILRRRLWSILGCTVLCVGAAVLYVVLARPSYRAEAAIRMDDRRQPI
PTLDVLALYRGNELSTEIEMLGSRTLAEDVVAALGLQLEITKPRAVLREEVFASVRVTRDAPAATYRLEPADSDGFVVRN
DSSEAVLGRTVPGKPLTFAGVELEVSPHALGLGPVAFSVVAFDDAVRGLRKALSIKRRNREANIVDVGYRGTDPQLVQAV
PNLLATRFIIDRQKTQQTETRSTGAFLRDQTAKLARQLRASEDSLERFRVVEHIVSLPQQASSGVTQFAELQAQRNALDA
ERRALEQLLSSTASSVAGSTQSTPIAFPTLLRNEVAASLLSALAQTEDRRSELLSRRSPQDADVQVLTRRIEDLRAQLRG
IAATYLQGLSNQVVAIDLTLAKSNAQLQTIPAKEIRLAQLERNVSGLAQIYTQLESRLKESEIAAAAEDPSVRLVDAALL
PREPVSPRRAFSIVLALLGGLTLGLGAALTREHLDRAVHTRHDLLAVTGRPVLGIIPHADGEMWSARLARGKGPGRARRR
PIGAGSRAELAEAFVRLATNVSFAGPNGPPQVVTVTSALRGEGKTTSAVNLALASANGRRVLLIDADLRCGTIHALFRLS
RTPGLAEVLAGWMPLENAVRRMDTGDGTHVDVLPAGSAVNNASQLLWRADLDGLLVRLRAAYDLIVIDSPPMNVVADATL
LAPQSDAVIVVARAGRTAPEALNFTLEQLRSVHALVWTVLNDIDYRRDRVYGRAYGQRASYLETE
>gnl|bykdb|A0A2V7QN41 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=815 residues).
MSRERSRLPEVASVDGTWLRAPAPSTADVASRTGPPGETDWQHYFGAVRRRKWTVIGVTLLGTALGLFASRLLHPPYSAT
ALLWFETKDRAAAARDPRTASEADELLNPSGWIDLVESNAVLEEVVRQRRLYLRPGNPVDSSVLATLRLDGTPLPGAYRY
SVDREGRTFSLQNGGRVVQTDSLATTVGQGLGFSWSPARGLVAPGHAVDFALNTPADAARQLKTTLSVTTDVDPALMRAG
TDANFLRIQLTGSRPAELAATVNAIADRVVVVAADLKRIKLVELGRILDEQRQHALRGLRDAEAAQRDFRIRSAGVLRQG
APPVSATLRGGGDPVFERSFDTKLALDSVQRDRQALQRALAQTGDSGPPIEALQAIGAVQKSAELSLALQEVTQRQATLR
ALRYRYTDASDPVQRVRGEVRTLLQTTIPTLARGLDADLAAREEALSRRADAAFGYLHDLPPLALEEARLQRDVAIAEQL
FTTVQQSYNQTQLAAVSTLPDVRILDRATAPDRPDRDLTPLLVCASFVVSLGLAVFGVVMLDELDHKVRYPEHVTHQMRL
SILGAVPRFDWRQLGNGKTAEAAAPVVEALRGLRLRLSHAGGSGPLLVTVTSPGVGEGKSFLSCNLALAFADAGFRTLLI
DGDVRRGGQHRMLGLHREPGLVDFLAGDLPFETVVQATRHPGLSFIGCGARRPSAPELLSSDVMTELIDRVREECGVVLV
DSPPLAVGVDPYVLATRTGNVLIVLRAGVSDLDLAAAKLDVLDTLPVRVLGAVLNDVRPYGAYRYYTYDAAAYAEANGAA
SQRRGGSAGVLWGQS
>gnl|bykdb|A0A2V7QPD8 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=923 residues).
MASMADGSRPSTEGLTPSWASGMDIAVVLDFRLTPPYAGFGPTCREVAAARILRITTAKSASLAVAAGTRPAPRCIRLRE
AVHRFAACGRCGLRAARYRTCHGKTRRRATRRGPANTVEVRFPMSTSPLPLHAGSTVPAVAPAAPLPTGADMGFGQGFAA
PETGVDWRRVLSAVLRFKWLIAVVTIVGTVGGVAATRFIKPQYMVQATLWIDQPDQRGGQERGPIRSGQALEPEAWLDLL
KSYRVLDQVVRDQRLFLTTKAREDAPLLETFRVAEQYRPGAYRLAVDGSGKAFTLSTDKGVEVEHGAVGDSIGARLGFTW
APPAGTIPAGRTIEFSVATVRDSARALSEGLEVNNDPAGTFLRMHLKGADAVRITSTINAIAERFVQVAAELRRQKLTEL
TKILDQQLAAAHQNLQDAEKALERFQVSVITRPSQVPKAGPGDDPAFKNFFTMQVDREQARRDREALERVLAQAGDSGVS
PEALAIVGSVQQNADLKQALAELTTKQAELRALRYKYSDQYPLVQRRLSDVATLERQTIPTLARRLLAELSGREAELGRR
VAEDTRSIQAVPPRAIDEARLQRQVTLAENLFTSLQKNYDEARLAEESAVPDARILDHAVVPQDPVRNTAPRVVFLGFAA
SLALGLCGAVVLDRIDPKLRYPDQVSRGLGIPILGAVPHLRNLPRGGRGGGARVPDDVNEVVEALRGVCLNLVYAHGGRA
PLLVTITSPGAGDGKSFISANLAHTFADGGHRTLLIDADIRRGVLHRRLSVRRRPGLSDFLRGEAQLDAIVQATQFQALS
LIGCGTRAYNAPELLGSPAMTSLVNGLRGSYDVILIDSPPLAAGVDPLILSTLTGTLTLVLRTGYSHRDVAAAKLEVLQR
LPVRMLGAVLNDVPAGGAYRYYSYYLPGYEAMDENSGTPRVPV
>gnl|bykdb|A0A2V7R2W8 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=793 residues).
MAGDSLMPSRSTAPLAVTNEPEQPQQPEWLRYLSAVRRFGWLVVAVTLAVTGLGVVAAVLMPPSYVAQAIVWIRVPNKEP
RNEGPIWQGQLPISSGWMELLQSYAVLDYAVRSRRLYLHPGLPGDSDVLGTLAIKEHVLPGEYRLVVDDTAPRFALFAVS
SLDPVARGGAGDSVAPDLGLAWVPPAAALAPGREVTFTLDAPYEATLKLADQLKVSADLDGNFLHMQLGGRDPVAIAATV
NTVAERFVAVAAGLKRDNLGELTGILGAQLAQGQAALRSAEDALRAFRVGAVTTLAEGAGSVAQNTQYQRDPLFAGLVEM
KVSLDEVRRDRAAIDRLLRQGIDSGVSVDALAMVGAVQRSTELVQALRDLTAKQAELRALRGHYTDDNPPVRRAAAEAEA
LGRRTIPALASSLAAELRVRETELAERVATASTGLQQVPPLAVEEARLQRNVTLAEQAVTNLQQRYEEARLAEVSSIPDV
RLLDRAIAPHRPVGHIGAILIALAMVGGLGLGMTGAVVLDSTDRRVRHPDDVTRAMGLAILGAVPHVDWRNGKRDAAVAQ
VIEALRGIRLNVVHRHGSAGPVRLTITSPGKSDGKSFVASNLALAFADTGLRTLLVDGDVRRGRLHRTLGAARRPGLTDL
LEGSVGWDQVVQATPYKNLSFISCGLRSQAGPALLSSATMARLLDGVRTSYDAVVVDSPPLAAGADGLALATVTGSLVLV
LRAGVSDRELTETKLGVLTHLPVRVLGAVLNDVRPGGAYRYYSYYLEGYEAHDEPDAAQARVLRGPVEEPVTR
>gnl|bykdb|A0A2V7R3Z8 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=1014 residues).
MIGPQSGAQQGEAIDLRHVQVHEHEVECAALQQVEGFLPPAADGYVVAFVAQNRRAALAQRVFVIDHQNPHPGLGFRPDG
EHGRRLASLDGGGHAVMSKRCRHRGRPRFPVDPPLRRVRANLSRGRSGTDSPHNDGKILSSARRGGVVARTKVHPAPGCG
APICGMWTVGAPHRAVSDLPQGRGDAAPPGAAPPTHVEVRFPMSTSPLPLHAGATVPAVAPSAAPPMAADLGFSQGFAQP
ETGVDWRRVLSAVARFKWLIAVVTIVGTVGGLAATRFIKPQYMVQATLWIDQPDQRGGQERGPIRAGQPLEPEAWLDLLK
SYRVLDQVVRDQRLFVTPRAREDAPVFEAFRVAEQYRPGVYRLALDGSGKTFTLSTDKGVEVEHGAAGDSIGARLGFVWA
PPAGTVPAGRTIEFSVATVRDSARALSEELEVATDPAGNFLRMHLKGADAVRITSTINAIAERFVLVAADLRRQKLTELT
KILDQQLAAAHQNLLDAEKALERFQVKTITLPSTAVGGSRGAGVPSAGASADDPAFASFFRMQVDRQQVQQDRDALERVL
AQAQASDSGVSPEALAIVGSVQQNVQLKQALDELTTKQAELRALRYKYNDAYPLVQRRLSEVATLQRQTIPTLARQLMAE
LSGRDAELGRRVAADTRSIQLVPPRAIDEARLQRQVTLAENLFTNLQKNYDEARLAEESAVPDARILDHAVVPQDPVRNT
APRVIFLGFAASLALGLCGAVVLDRIDPKVRYPDQVSRGLGIPILGAVPHLRNLPRGGRGGGARVPDDVNEVVEALRGVC
LNLVYAHGGRAPLLVTITSPGAGDGKSFISANLAHTFADGGHRTLLIDADIRRGVLHRRLSVRRRPGLSDFLRGEAQLDA
IVQATQFPALSLIGCGTRAYNAPELLGSPAMTSLVNGLRGGYDVVLIDSPPLAAGVDPLILSTLTGTLALVLRTGYSHRD
VAAAKLEVLQRLPVRMLGAVLNDVPAGGAYRYYSYYLPGYEAMDENSGSPRVPV
>gnl|bykdb|A0A2V7R603 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=835 residues).
MRRSVASPAAPRYPPCSADLAMSRERSRLPEVASVEGAWMRAPALPAGDVVSRAGAPGETDWQHYIGAVRRRKWTVIAIT
LLGTALGLFASRLLHPPYSATALLWFETKDRAAAGRDPRTASEADELLNPSGWIDLVESNAVLEEVVRQRRLYLRARDPA
DSSGLATLRLDGTPVPGAYRYTLDREGRTFTLQNGGRVVQTDSVGTPAGQGLGFSWSPPRGLVAGHSVDFALSTPADAAR
QLMKTLNVSTDVDPALMRAGTDANFLRIQITGSRPAELAATVNAIADRVVVVAADLKRIKLVELGRILDEQRQHALGSLR
AAEAAQRDFRIHSAGVLRQGAPPVSASLRGGGDPVFERSFDTKLALDSVQRDRQALQRALAQTGDSGPPIEALQAIGAVQ
KSAELSLALQEVTQRQATLRALRYRYTDASDPVQRVRGEVRTLLQTTIPTLARLLDADLAAREEALSHRADAAFGYLHDL
PPLALEEARLQRDVAIAEQLFTTVQQSYNQTQLAAVSTLPDVRILDRATAPDRPDRNLTPLLACASFVLSLGLAVFGVVM
LDGLDHKVRYPEHVTHQMRLSILGAVPRFDWRHLGNGKTAEAAAPVVEALRGLRLRLSHAGGSGPLLVTVTSPGVGEGKS
FLSCNLALAFADAGFRTLLIDGDVRRGGQHRMLGLHREPGLVDFLAGDLPFETVVQATRHPNLSFIGCGARRPSAPELLS
SDVMTDLIDRVREECGVVLVDSPPLAVGVDPYVLATRTGNVLIVLRAGVSDLDLAAAKLDVLDTLPVRVLGAVLNDVRPY
GAYRYYTYDAAAYAEGNGAIGQRRPGSAGVLWGRS
>gnl|bykdb|A0A2V7RQ86 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=787 residues).
MERQLPERVDPAVLGAPRPWVAEEVATTSPEGALDWRRIAQVVTRFKWLVFGITVAGGAAGFAATKVVRPQYLTQVTVFI
DQPDPRGNDRGGPIRSGQVLDPESWIDLLRSYAVLDRVARDLRLFLQLPKGPDPALRSLNVADQFRPGAYRLTTDAARAY
VLAKVDGAVLERGTVGDSIGRSIGFLWAPPAESLPPGHTVEFRLQTAREAALHLSDALDAHMDYNGNFLKIELRGGDPAR
ITRILNAVAERYVEVAAELKRGRLTELTSIIGDQVRTAKQSLDSAEGDLQSFRRRTITLPPDAVAAGGDTPRDPVLGDFF
EQQVQRQQVARDRAALTRVLAQPADSGLASALEVIDAVQHSPELKGALQELTTKQADLRNLRYHYTEAYPPLARKAAEVA
TLERQTIPTLVRSLIDELGTRMAELDRRIGSASQELRRIPARSVEEARLRRSVTIADNLYTSLQQNYEAAKLAEASSIPD
IRIFDKAVVPLQPVKNTAPRLLLLGFLGGLGLALAGVVLLDRFDPRVRYPEQVSHDLGLPILGAVPHLKARTGGQLTREQ
RVQLVEAMRGVCLGVSYTYGAAGPVVVAVSSPGPGDGKSFITANLAVTFADAGRRTLLVDGDLRRGAQHRLFGADRRPGL
TDVLRGDVPLEAGLRPTGYDALTLLPCGVRTSDAPELLGSAKMPELLARLRGDYDTILVDSPPLGAGIDPFVLGTLTGNL
LLVLRTGVSHREVMAAKLEVLRRLPVRLLGAVLNDVPPGAAYQYYSYYTPGYEATDEKPARLTPSVG
>gnl|bykdb|A0A2V7S9K3 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=846 residues).
MSLAGTSTCCRRTTAYASSPRRAVRQRPAVGRGSPRPGAAGGIGLAVGNRVPELLPSGAAPQLTHAVPLVAPAGNGLRLD
PLAAAGEPFLDWRRSWAAALRYRWWVVGFMGLGVLGGLAASRFLPPRYLAQATIWIQTSEPRATDRGPIGANQLLEASAW
VDLLKSYVVLDDVVRELRLYLRVDPRRSPVFAEFTVSDEFRPGQYRLVVDQAGRTFRLEGRGGAELQRGAVGDSVGQALG
FRWAPSATLLAPGTELPFVVTTLRDAAKHLGEALTVAIDPSGNFLGISLTDANGTAAAKTVNYVAQRYVLAASGLKRSKL
TELARLLDEQLQSARGNLQRAEAALEQFRTRTITLPPDPGATGTAAPPKGSPLGDFFDLQVEQGQLRRDQQAITQALDQM
RDSGASVEGLGFIGAVQRSPELSDALREVTTKRAELRALRYRYTDDHPTVRRLAAEIDVLEHQTIPVLVRTLLTELGTRQ
RLLASEVAAGGRALQAIPQRAVEEARLRRDVAIAENLYSSVQQRYDEARLAEASTVADVRILDAAVAPQDPVKDMTRRLI
VLGLVAGFGLALVGAVVADRLDPRVRYPDQVTNQMGLPILGVLPHVRNRAAGPDDEHVAHAIEAMRSVRLSVSHAYGAAG
PMVLTVSSPGAGDGKSFVAANLALAFAEGGRRTLLIDGDVRRGGLHRALRAHRRPGLTDFLAGRVPLEETIVATSYADLQ
FIGAGTRFRDSPELLGSVAMVELLTCVRSSYGVILLDSPPLGSGVDPYTLATLTGSLLLVLRTGATNLDLARTKLGMLDH
LPIRLLGVVVNDVQPGGAYRYYSYLSGYATADEGTASAAHRLRGVL
>gnl|bykdb|A0A2V7SG67 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=808 residues).
MPSDPTADPEQSAPDRRLVLAAATAARLAPRRDEAPPPEDWRRVVTAIRTYRWLVIAVTGVGTLAGIIGARFLKPTYQAR
ATVWLEIPDQSAHERDQGPFQSGQLLGTATGWLDLLRSHVVLDDVVRQWRLYLKPQSAADSAALATLTVPGDVRPGRYRL
EVAAAANRFRLLDVDAKVVLQEGAVGDSVGATLGFTWVPPAAVLRPGASVQFTVATTSEAAQKLSEELRVRAGTDGNFVR
IERRGPDAAVVTRTVNAVAERFVAAAADLKRQRLTELTAILKDQLDRAETNLRAAERGLTAFRVRNAVRPSEGPAQGPDG
RRITADPTFASYVDLQVALGALAHDREAIARVVAHAADSGVAVDQLAMISAVQHASELTAALKELSDRQAELRVMRFRYA
DTHPPVRRLAQQVDTLARRVIPELGRAVVAGLAAREHELQQRIDSISRDLRSAPPVALEEVRLARDQANAEQLFSNLQQR
YQEARLAEVSTLPDVRILEPAVRPTRPVSDTAPLVIIVACIMSLGAGVLGAVLLERADPKVRYPDEVTRAIGLPILGAVP
HVQRGNGKRRAGGEDDIAKAVEALRGIRLNLQHAYGAAGPLLITVSSPGRGEGKSFVTSNLAQAFADVGYRTLLIDGDVR
LGVLHRALRGTRRPGLTDLLASRATVDQVVQGTPHQLLSFIGAGSRMHRGPELLCSVAMPRLITVMRPSYDVILVDSAPL
AAGVDPYALGTATGSMLLVLRTGVTDRTLAEAKVEVLHRLPIRVLGAVLNDVRPGAAYTYYSYSLAGSEVQEEDPGGVTS
EILLPDRS
>gnl|bykdb|A0A2V7T933 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=793 residues).
MTPRPLPAIRGQSAPAVLRRGGTSDRTSLPEEEAAPDWRRIGSVLLRFKWVVILMLALGLGAGFAATRVLRPVYRAQANV
WVDVPDRRGNGSSDARGPIRQGALLDADAWVELLRSYVVLDQVVRDLRLYLKVKRTSDRATFDAFRVNDIFRPGDYRLSV
SDDGRQYTLASAEGVDLERGTVGDSVGNRLGFRWAPPAGSLPPGRTVEFSVVPPRDAALRLGEQLDVRMDMNGNFLALEL
RGPNPVLITTILNAVAQRYVEVAAQLNREKLTQLTKILEDQLTTAKRNLDSAETALQGFRTRTITLPSDQAADRKAAADT
RDPIRTSFFDMAVERDQLRRDGDAIDRLLAQGGGGDGLPTEALSAIGSVQHAPELSNALKELSDKQAQLRTYRYHYSEAY
PPVQRLAREISELQQRTIPTLARALSAQLATRESELGRQVGAASRDLRQIPARDIEDVRLNRNAQLKEQTYTALQQRFDQ
ARLAAEATLPDVRILDPAVVPQRPVKNTAPRLLFMGLLGGLGLGVLGAILLDRADPRVRYPEHVSRDLGLPIIGAVPHLR
AKEPAEVVEALRGVRLSLVHEYGPGPLLVTVTSPGPGDGKSFLSANLALTFADAGHRTLLVDGDVRRGVLHRRFKANRQP
GLVDFLLGKAGLDEIVQGTEYPRLAFIGCGTRTQRAPEVLGSPAMTQFIADLRNQYDVILVDSPPLTAGVDPFVLGTVTG
ALLLVLRTGHSHRDITGAKLEVLDRLPIRLLGAVLNDVPHGAAYGYYSYYSYYLPGYEAVDEGDRQASGARVV
>gnl|bykdb|A0A3D4VBZ5 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonas aurantiaca] (length=816 residues).
MSGQQIQSVTPQAVALEPYQEGTPPGDWGGGTAEGAPEPKGPSLRRYLAAVNRFKWLVLVFAILGGAGGYAATRFIEPEY
EVQATILLEQGTGVNNGAGRGPIQAAELLQASGWQDLLRSYAIADPVVIGLGLFVTPAVVADSVLFRTFRVDQSRLRPGD
YKLTIAGERYVLNLQPGVEVEKGVVGDSIGRPVGFQWQPVAGQFGRRTEVVFNVQTPREASRALIKKLALSLQDGSSFLF
LRMNGPDAQRSAATLNAWVEQFVTVATQYKKQNVVQVAGILEGQREYAAQELASAEAALEGFRVRTVTEPSERQTIQPGI
EMTNSPVFENYFRDKILADNYRRDREALERILQSGRSGTAITREAVLSVPAVNADPAAENLRRALEERAARELELRRLRE
TYTDEYQRVKDAQAALVALRDTVVPRSLDAYLGELRLREQTLNSTIEQSSKDLKGIPSRTIEEQRLKRQVEVAARVYESL
NMKAAEAKLAEASTIPDVSILDAAVPPLSPTRNTAPMIILGAVGAALALGLLLAIVLDQLDKRFRYPEQATDDLGLFVLG
VVPVIGGKGRRNADQAAQVVESFRTIRMNVRYAADPTRPLTMTITSPGPNDGKSLISSNLALSFAESGLRTLLIDGDIRR
GELAKTFKIHSRPGLVEYLEGSALLAEVLNPIASHANLTIMPAGVRRKRAPELLATPRLTQLISQMAGEYDVVVVDSPPL
GAGYDAFALATATGNMALVMRAGVTDRKMAEAKMATVDTLPIRVMGAILNGIKMTGAYQYYSYYQDYAAEDEQPERLSAG
SGSSRPVALSGGVSDA
>gnl|bykdb|A0A3D4YTR6 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=809 residues).
MLLRTRVYPSPSDFAIAPSNAGSPSPAPYKGGPQRMDGPSDSEGIPWSRYIDAISRHSLLILAIALLGSLVGLYAARQVR
LSYDADATIWINTTPNGTQQTQTGPIRQPQLLTSVSWVELLRSFAVVDPVVRDLKLNVSYTPADSALYANFVWTPATRSG
AYALKIDEHGRSYVLSTATGTVLERGAVGDSVGRKIGMSWLPDRRLLGANSIFKFAVSSPRNTSASLVAAVHATLPEDGQ
FLKITLTGSDPRRTARTVNAWAAQLVSSSGDLKKSHLLEFKRILGDQLALAEGQLRSSEDELERFRVNTITLPHGATPIG
PGAGQVDPVVGNYFQQKAALDEVRSEREALERMIADAKGGPIDTQGFLQLPTILNNAPQLRSAIEELSLRKATLRTEQQF
LTDANPRIKQLAEAVRVLETETIPQITQAVLNSLKAREPELGARIDVGSQELRAIPARATEEMRLARRVVASESLYNTLK
ARYEELSIAEAQTTPDLAVLDTAVGPNFPTSNDAPRLLLLAVAASIGLAFGIALILDRLDPRFRYPEQATHDLGLSITGT
VPRIKANGRGDIKLELMSQTVEAFRTIRLALRYDFPDGLPIVLGVTSPARGDGKSLVASNLGLAFASAGSRTLLIDGDVR
CGGLHNTFGIPVTPGLVDYLHGLASVESIVRSTASKNLFLIPRGTRRNRAPELLVSDLMNSLVHAMRLQFDVVIIDSPPL
VAGIDAYALGAAAGSMLIVLRPARTDRKLAAAKLDVLDRLPIRILGAVLNAVPGGGAYRYYGADYEYKGDSSTEPIADLA
TPQGLVLRA
>gnl|bykdb|A0A3M2BJA6 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=794 residues).
MEKPTFEGGYVDDEISLRDIWNLLRRNQWLIFLCVLLVTGGAAAYSYFAVPVYESATTIRIEEERANLPVLDILQELSSG
SQVETEMEVLRSRTLAEDVVDSLNLQVEIIEPRGVSRAVLLDRLVAERWAPEGEFLIEPGGDAFRITDEETLESLGEVSE
RLPAALAGVTFTLTEAARDYPRIRVRVLPFDKAVTKLQKALSVSRPNRDAGIVTVRYESSDTLLVHEVPNRLAASFISRR
QRIQKTEASSTVRFLEDQIDTLARQLAAAEERLVAFREEGQVVSIEAEANAQVTELARLQADRNAIDAERSALQELMDEI
DREATTADPAGPSPYRRLLSFPTLLKNQSTSELLRSLTEVENQRSVLLQRRTMADDDVQQFTQRIRELEAQLRTVATTYL
QGLTNQVQSYDQTLEQFAAQLEVIPQKQVQLARLEREEKVLSELFTLLQTRLKEAQIAQAVEDASIRVVDPAILPSEPIK
PKTVLNIALGLILGMMLGVGLAFTREHMDDTVHTREDLVEATGGAPIMGMIPRIRQRGLRPSKTSAAANGASHLGERLVA
GRDPRNPVSEAYRSLRTNITFSNPDRPPKTIVFTSPLPQDGKSTSAANLAITLAQQGTRVLLVDADLRRGVLNNVFDLPR
EPGLSDVITGQAKLSEALRVVDLGESGRMHFLPTGTLPPNPAELLGSERMKTLLRHLEEQFDAIILDSAPLTVVTDAAVL
GTNAEGVLLVARANVTERGAIRYSVDQLKHVRAPILGVVLNDIDFRRDSRYSSSYGRYGYYYQYYYGDNGKKKK
>gnl|bykdb|A0A3M2BLV5 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=794 residues).
MDRQPDLRPPLDSELLSASPHLSDYIQVVTRRLWLVLLIFAVTTASAIWAVSRQKTLWRSEMAVQVTDPLERARSLTSPT
RVSGMDIFVDPMQSQIEVLQSRSIAERVADELGLRLRRRGTNTVRSELFSDAVVTDEAEPGWYELRYSADGASAALVHAP
TGDTVGTADAGEVLEAPGLRFVLKRAPEEFRTYLLEVVPSVAQVASEVRLVGTAREQTNIIDIYLTHEDPELAPKMLGAA
ARALSEFGARQVRERAESDLEFAEAQLDSARNNLQRSFQKIREFKETEAFTNLTAEEQQLVQRRQDALERLQQLDDQRQA
LQNLMVDIQAAGVEGVDIVAFLAALPQGVNPQITAIAEDIRDKQDEIQRLLTEERVTPDHPRVQAIRTQLARDEGSLRDA
VDRHLQGIDREMAEVRTELDRIQEAQRRFPQLQNRYDELDLQRSIDREMVLYLQSQLYQAQILAQGAGDGFIDVVDPPGA
PIEVTPRGKINLMLGALLGLILGVGAAFFLEYLDRTVRTSADVETLLGIPVLGIIPRLRKVDEEDDRRAGLPLIVALDPL
DPAAEAYRNLRMNLMFMSTEDEPIRTILFSSPGPHEGKSTTAVNFAVMLAQQGQRVLLIDADLRRPSLHRAMDLLREPGL
TNLLVGDAEAREAIRPNVLPNLDMLPSGPFPPNPSELLNSKAMQRLLEELQGKYSHIIVDSPPVLAVTDAALLGAHTDGV
VLVLRSGETEQRAAERAVEQLRRVGVRVFGAVLNEVSTSNAEESYYLQYYYGYHPREETGWQRLRSGLSRARFW
>gnl|bykdb|A0A3M2G624 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=820 residues).
MYFGNGKNYPVEVTTSSYLEADFDVRKYVRMLWRRRYIVLLLFVLIFGFSTYRALTQKVTPVYRSTVYLEVDEKETNIRL
LPQFSSVRQQSIYWGSPEGKIIAEVLSTSVIEEVVQMLDLDKAVHSISPNLSFSMTNIQSHNAPLGTYRVHILDNQHYVV
YDTANRELGRGISGVPFQHEFFEFTISNIEGPPQSEFYFTLYPLQRAVNSVRAATHAQATTRAAIQDNVAGGGIAGAASA
KRSRKDAAIQDAGIVQVDVYWQDPETATQIANALADVIRHRELEDKRLEHTKTREYIERQLNTYTQKLKASEEALQTYKE
QNRIYELDAIARDVTYKVFDIEAEISQIQAERERIKLFREKVTSGLQPEDYLLISAIPFQDEEGYGYWDVLSQLTSQLME
LEIQLPLKLEEMTENHPDIIALKNQIQQVRLRLQQQVDARLTMLDSREESLRLQLLPYQQQLETFPLKEVELARLEREFR
LNEEIYSLLTRQHEQTRLAEAAIVNDIQVLDYASIPTAPIGGGPNRQKAILLGALLGIGVGLGVAFLLEFLDNTIRETDE
IERHIQLPVYGMIPQIESIKNGRRTHKAKARFETLVTHLAPKSIPSEAFRSLRTNIQFFDLSRQSEAILITSAVSEEGKS
TTCANLAITTAQVGRKTLLIDGDLRKPVIHHLFEAPSEPGLTDVLLGRYTWQEVIHSTSVPGLDIICSGTQPPNPSELLS
SPELKSLITTLKEHYDMILFDSPPVIPVADSVALSTNVDGVLLVVSAGKTDRHALQRTRDLLHNVNARIMGAVLNNVRIN
EIYGYQKHYYYYDTKKPVKV
>gnl|bykdb|A0A3M2G737 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonadetes bacterium] (length=782 residues).
MYFGRMVPSDSAPKLQAPISTSNGAYHSENPIHEYFQIIVRGRWIILVVFTLVMAATMIYVLRNKPRLVYSTTATIALKN
KSGNLNPYPVYRDPAKINNELVILKSRRLAETIADSLLKRVYIDPETKNEKLHIIHRRVESNGHVDYEPLNKRSVVRRLQ
SSASFSPIPQSDIIQISVKSTHPEEAKLIANLFAETYYQWNVERSRTELIGTRKFLEKQLEQKRERLYQAEDSLRKYMEA
SNVMTDDAGATATIEKIAQLEATRSALEIDIQAFAEKIKSYEDKLGSKSNVNVIAEQNDPYITQLQEQIANLEVQRDVTI
TQNPALAGQEAYIEKMAEINAQIEALRSKLQQRTEEYRKSILKDENLTASDILELRTSIFAAQMEMQTLKTKKEILDSTI
ADYERKIKTLPQKSIDYARLVRQRSSAEKLYLLVEQHYNEASIAEQSEFGNVEIIESAETPTKPINPPKPLRTVFLGGFL
GLGLGLGIVFVREFFNTQIRTPEDIKKRGYTLLSVIPSMSLDNANRKKRKSKSVAENPQLLTFANPRSTVAESYRQLRTY
VQFSKTDTPVKTIMVSSANPSEGKTTTASNMAVAFATMGKKVLLIDCDMRKPQLHNRFSLDREPGLSNIFFYTAAVEKIC
HKTSVDNLDVICSGIIPPNPAEILSSTRMIEFVKEMRDQYDLIIFDTPPILRVADPSIVSTLVDGVILVVASGKTPAGGL
NFAVETLVKVKANLLGIVLNDFDPKKAYGGYYYGNYYKYYYYSSYYGSDRDKKKQRSIKLKS
>gnl|bykdb|C1A5W1 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatimonas aurantiaca] (length=816 residues).
MSGQQIQSVTPQAVALEPYQEGTPPGDWGGGTAEGAPEPKGPSLRRYLAAVNRFKWLVLVFAILGGAGGYAATRFIEPEY
EVQATILLEQGTGVNNGAGRGPIQAAELLQASGWQDLLRSYAIADPVVIGLGLFVTPAVVADSVLFRTFRVDQSRLRPGD
YKLTIAGERYVLNLQPGVEVEKGVVGDSIGRPVGFQWQPVAGQFGRRTEVVFNVQTPREASRALIKKLALSLQDGSSFLF
LRMNGPDAQRSAATLNAWVEQFVTVATQYKKQNVVQVAGILEGQREYAAQELASAEAALEGFRVRTVTEPSERQTIQPGI
EMTNSPVFENYFRDKILADNYRRDREALERILQSGRSGTAITREAVLSVPAVNADPAAENLRRALEERAARELELRRLRE
TYTDEYQRVKDAQAALVALRDTVVPRSLDAYLGELRLREQTLNSTIEQSSKDLKGIPSRTIEEQRLKRQVEVAARVYESL
NMKAAEAKLAEASTIPDVSILDAAVPPLSPTRNTAPMIILGAVGAALALGLLLAIVLDQLDKRFRYPEQATDDLGLFVLG
VVPVIGGKGRRNADQAAQVVESFRTIRMNVRYAADPTRPLTMTITSPGPNDGKSLISSNLALSFAESGLRTLLIDGDIRR
GELAKTFKIHSRPGLVEYLEGSALLAEVLNPIASHANLTIMPAGVRRKRAPELLATPRLTQLISQMAGEYDVVVVDSPPL
GAGYDAFALATATGNMALVMRAGVTDRKMAEAKMATVDTLPIRVMGAILNGIKMTGAYQYYSYYQDYAAEDEQPERLSAG
SGSSRPVALSGGVSDA
>gnl|bykdb|W0RI74 [Bacteria] Bacterial tyrosine kinase [Gemmatimonadetes][Gemmatirosa kalamazoonesis] (length=823 residues).
MSANLPPLPAGSDAPLPVPAAEHALQPYDPAAYAPPAAPADEAGGALSVGRFMAAMSRYKWLVAALVVLGLGGGFVATRF
IDPEYEVNATIFSSGSGNEKPSMINPAQLTGNAGWRDLFQSFAIIDPVVQKLSLYIQPAKASDSLLFATFQIDPVKKQFR
PGTYTLKTERGRFSLTDKVGFTHEVGTVGDSVGRSAGFAWVPPARLLGTRSREVEFTVLTPREASRDVQKRLAITIKQAS
PVIGLTLTGTAQQKPAATMNAMLTQFVDVATELKKREMVASTTTLNTQLDEASKGLQAAEQAFEDYRVKTIAEPSETPTV
ISSDPKSQNMAVGQPIFNAFFTRKTEVDQLKRDRESLERLLGQIKAPGSTLAPEILLTVPTLANDPGAAGVKQTVDELTH
ATVDLRVKLQTLTDSNPLVVDARRNIAELHDRVLPQRLTDYIATLRTRESQYGQELQTATHELQGIPERTIQTGVLARER
DVRAEIYTKLRTASAQAQLAQQSAVPDVKILDTAITPLAPSSNTAPTFIGGGLFAGLVIGIGLAFLLDLLDNRFRYPEQA
RVDLGLEVLGVVPVVDQSGRQSPEQIAQIVEAFRSLRMNVRYAAGAGSQRSVVFGITSPGPGDGKSLVASNLALSFAEGG
WRTVLIDADTRRGQLNATFDTPAVPGLVEYLEGTSLFGEVCYPTRHDNLTIIPSGTRHRRAPELLATPRMQQLVASLAAE
FDVVIIDTPPLGAGTDAYAIGTACGQLAVVLRSNRTNLKMAKAKLAVLAQLPVTLLGAVLNEVRTDSGMYQYYSYDPDYV
LPEETPALSAGGGGGTSVAVREG
© 1998-2019