BYKdb

Dataset for cluster orphancd of phylum ignavibacteriae

[Download (right click)] [Alignment] [Repertoires]

9 sequence(s)

>gnl|bykdb|A0A1G0RWW2 [Bacteria] Bacterial tyrosine kinase [Ignavibacteriae][Ignavibacteria bacterium RBG_16_36_9] (length=741 residues).
MAEEIQDDYNVHQTNTFKDYLRIIRVNWIPVSLITLAGLIVAIIYAANATDIYKSTAALKIARPQGGSVLTSPLLPEFQE
WGNDRFIANEIEIMRSFTAREMVAVSLIDSFYRDTDKSRYSILLDQKPKTGDFENDIKSVDALAISLSDVAIDQKRGLDI
IEISALSPSPFEATLIANVYSQQYKTLNLDQNRNQLTLVTNFLDEQRKEKYDDLNSAEETLRAFQERGGLIALDERASTL
ISVLSQFEAQKSATQVDLMASNKVLESLRQELKAQNPRMADYLTSLTSQKYITAIQDEIAKLEVNKQVAVSRKDGLTEES
PVIQEYDRKISELRKQLDKELEVLKAGIFASSPEEVKELTQKIIAEEVRNQSLETSIKELDKIVQGYEARFMKLPKNAIE
LARLKRNSEALEKLYLLVEQRYQEAIINEQSQPGNVLIIDEARIPLSPAKPNRKLIVIIGLLLGAGLAAGYVFVKNYFDD
TVKSPDDIEKRKINVLAWIPPFESIMAGDHSVQFIVDKLPDSIPSEAFRALRTRIQFSRINTESLKTILITSSAPQEGKT
TIAVNLAGSFAHSKKKVLLIDCDLRKPSVHKLFNRDKVPGLIDYLVGSAKLEEVLIKAEIPNLSFILSGTIPPNPAEMLD
SQEMRSFLKKLRDQFDLIILDSPPIIAVTDSEILTSMVDGTILIVSSENTEIDMMERSVELIRRENTQFLGTVLNNFSYK
SGYGSYYKYYYYYSRPDGKSA
>gnl|bykdb|A0A1G0RXP0 [Bacteria] Bacterial tyrosine kinase [Ignavibacteriae][Ignavibacteria bacterium RBG_16_36_9] (length=746 residues).
MEKFNLEKYLHGESKSIKDYILLIRNNLKYIFIISPIVISLTVIYILLAKDIYKSSATIRITKQNENVLENTGQSYDVGY
VDRFIANEIRTITDYSIREKIAEVLIDSFKSTPSKNLFYLVKSADDRGNIGHKPVMELAGLLGGAISVEQIQGTDMITIS
AESPSPLETAIIVNICALEYQKLNLAMNREKLTNIRKFLEQQREEKFAELKNAEDTLMIFQEKSGIVDLDFQSTGLISQL
SQLEAQIEVTKIELSTSDEILKQYKFFLSKQDPQLVDYLENQTSQAYINVLQQQLAELQVNKDLALSLKNPNVDISNKIK
EYDQRIEELKQKLNSAISSIKADAFSSNPEQVRELAQKLIEEEIKNNTLSVRLNQLQTITKGYEVNLKRLPKTSTELSQF
QRNRETLQQLYLLINEKYQQATINELSQPGNVSIIGEGGIPSAPAKPNRILILLFGLMLGPGLAVGLIIIKDYFDNTVKT
PEDIEKNNISFLSWVPQFKTNGESKDFNQDLVTLNKQDSPISESFRAIRARIQHSRIEEEFPKLILVTSAAESEGKTFIS
TNLAGSYVQSGKKTLLIDCDLRRPRIHKIMNVNKKPGLADYLANKAKLDEIIRNTKTNNLFYITSGTIPSNPAEVIESEV
MKNFLLEIRDFFDVIILDSAPIIAVIDAEVLANLADGTILVISADKTEYRLMKDAVELIKHNNVSFLGTVLNNFEYKSGY
GYYYKYYYNYSKYSNQRGRKKIKLKS
>gnl|bykdb|A0A1G0TD08 [Bacteria] Bacterial tyrosine kinase [Ignavibacteriae][Ignavibacteria bacterium RBG_16_35_7] (length=753 residues).
MNNNQNNFDLQELEGKSFKDYLALVQKNLWPFLIISLVILIGTAFYVLRLTDIYVSETSVKISKSGGSILQTAPLLGMGD
LGNDRMINNEIEILKSFDLRKIVANALLDSFAQSKSKDDFKLLYKSESNFGRETKKLLQSPNIEEMLGSIVDIEQKRGLD
VIVIAAQSPSPREAALIAALYAKIYRTYNLEINREQLSFVRDFLDQQRAEKKIQLSQAEDTLRAFQEKGGIIALDEQAQT
LIQQLSQFEAQMNAAKIELIASTEVLNKYKEELTKQDPKLADYLASVTSETYITALQNQIAELQLNKDIALAKFESGIDI
SQKVKEFDLKINDLKGKLDEKIKVLKAGILASSPEEVRGISQKIIEAEVKNQSLRSSVASLSALVRKYEERFNKLPKTTL
ELARFQRTRESTEKLFTLIEEKYQEALINEQSQAGNVLIIDNARVPIKPSKPNRLLMMLVGLLIGFGLAFGYVLIRDYFD
DKINTPEDIEKKNIHVLAWIPKINELNGINLNGKDFIIENNPTSIPSESIRALRTRVQFSKLRKDALKTILVTSPAPQEG
KSTIALNLAGSFAHSKRKTLLIDADLRKPRLHSVFKKEKEPGLVNYLFGELSYEKLINATDTKNLFLITAGTIVPNPSEV
LDSTELDILLKKVREEFDYVIIDCPPIIAVTDAEILARKVDGVILVVSANKTEKNLLDLAVKLIKSEDSFLIGTVLNNFS
TKTGYGSYYKYYYYYTADGEKKTSKFKKKEKQA
>gnl|bykdb|A0A2H0Z4Q0 [Bacteria] Bacterial tyrosine kinase [Ignavibacteriae][Ignavibacteria bacterium CG08_land_8_20_14_0_20_37_9] (length=428 residues).
QAIREYDAKIKELRNKLNSKIEGFKASIFASSPEEVKLMTKNVIEEEIKSKSLEIKVKNLSEIVNKYDSKFNQLPKSAIE
YARLQRGRESLEKLYILVEEKYQEAVINEQSQPGNVLIIDVARRPDKPSKPNRLLIVLVGTILGLGFGLGYAFLRNYFDN
TVKTPEDLKDRNINVIGWVPQIQSLDKSISEDLEFIIYNKPDSVPSEAFRALRTRVQFSKVDQGNMKVIHVTSSTPGEGK
TLISSNLAGSFAQANHKTLLLDCDLRKPRVHTIFGMNRQPGLVEYLFDQVNLATIIKPTKLANLDVITVGTIPPNPAEML
GSKKMQDFITHMKTLYDYIIIDSPPIISVTDSEIIAAYCDAVYLVVSANYTEFDLLEKALDILKNSNVNFVGTILNNFVF
KNSYGSYYKYYYYYYNREKEGTRSKKTT
>gnl|bykdb|A0A2M7ITQ8 [Bacteria] Bacterial tyrosine kinase [Ignavibacteriae][Ignavibacteria bacterium CG_4_8_14_3_um_filter_37_9] (length=522 residues).
KGGIIALDDQAKELITQLSKFEADLNLGKMELAISEKTLKQYKDELRRQDPQLTAYLENFSSEEYLKNLQTELARLEVNR
DVALSSVKDKNVDTQAIREYDAKIKELRNKLNSKIEGFKASIFASSPEEVKLMTKNVIEEEIKSKSLEIKVKNLSEIVNK
YDSKFNQLPKSAIEYARLQRGRESLEKLYILVEEKYQEAVINEQSQPGNVLIIDVARRPDKPSKPNRLLIVLVGTILGLG
FGLGYAFLRNYFDNTVKTPEDLKDRNINVIGWVPKIQSLDKSISKDLEFIXXXKPDSVPSEAFRALRTRVQFSKVDQGNM
KVIHITSSTPGEGKTLISSNLAGSFAQANHKTLLLDCDLRKPRVHTIFGMNRQPGLVEYLFDQVNLATIIKPTKLANLDV
ITVGTIPPNPAEMLGSKKMQDFITHMKTLYDYIIIDSPPIISVTDSEIIAAYCDAVYLVVSANYTEFDLLEKALDILKNS
NVNFVGTILNNFVFKNSYGSYYKYYYYYYNREKEGTRSKKTT
>gnl|bykdb|A0A2M8FIB1 [Bacteria] Bacterial tyrosine kinase [Ignavibacteriae][Ignavibacteria bacterium CG_4_9_14_0_2_um_filter_37_13] (length=352 residues).
SAIEYARLQRGRESLEKLYILVEEKYQEAVINEQSQPGNVLIIDVARRPDKPSKPNRLLIVLVGTILGLGFGLGYAFLRN
YFDNTVKTPEDLKDRNINVIGWVPKIQSLDKSISKDLEFIIYNKPDSVPSEAFRALRTRVQFSKVDQGNMKVIHITSSTP
GEGKTLISSNLAGSFAQANHKTLLLDCDLRKPRVHTIFGMNRQPGLVEYLFDQVNLATIIKPTKLANLDVITVGTIPPNP
AEMLGSKKMQDFITHMKTLYDYIIIDSPPIISVTDSEIIAAYCDAVYLVVSANYTEFDLLEKALDILKNSNVNFVGTILN
NFVFKNSYGSYYKYYYYYYNREKEGTRSKKTT
>gnl|bykdb|A0A3A0BD75 [Bacteria] Bacterial tyrosine kinase [Ignavibacteriae][Ignavibacteriae bacterium] (length=752 residues).
MENNPTGNFINQYQLNNGTEDSGRDTLRDYLVILRMHWVAIALIFAAAMCVTIVYILTATNYYSTTTSIKINKPQESILS
SSIFTDFGGQQADRFIANEIDLMQTYPIRQKAAKFILDTLQTIEDKSALYYLYSDPENISQGFRTVESMAKLLSDIVAID
QKRGLDVVTLVAESPSPIEATIISNLYARAYSEYSLELSRKDLTNTISFLVKEKDRKMRDLNNAEASLEDFQKRSGLINL
DVQSEQLVNSISELDKAKGYAQVEITGNQTKYNELSAEIKKIDPQLVTFLEGELSGKYVTDLQAKISELELQKSIELSNT
QTQAVRDKIIGDYEQRLQPLRNSLNEKVMKLEEALYVQTPEERRELIQELLLAGVQRSESKSRLNIISGMLGKYEREFSL
LPSQALELAKIERQRLSSEKLYLLLEEKYQEALINQNARIGNVLITDPARVPSQPSKPKKTIVLLAGVLIGLGLGFGYAF
GRNYLDRSIKNPEEIEKKGVTILAWIPSIDTLKEFKGGSPDELVVLNKSTSTAAESFKALRTRVQFSKLEEKPLKSILVT
SSIPGEGKTFVSSNLASSFAIDNKKVLLLDCDLRKPRLHNVFAADRFPGLSDYLFSHVELEDIIRDSQNENLKFITAGTI
PPNPSELLGSVQMKKFLELLENKFDMIVIDSPPLISVTDSEILFAVTDGGILVAKAQKTPIDVVMKSANTVNNINPRNFL
GCVLNDFNVKGSYGYYYNYYYYYSKPEQKANA
>gnl|bykdb|A0A3D6B6N8 [Bacteria] Bacterial tyrosine kinase [Ignavibacteriae][Ignavibacteriales bacterium] (length=757 residues).
MMNNNNNGSGNPAGNQNFNIEKYLLSGTKSAKDYILLFRNNLKNIVIISLLILIIAAAYAILAKNIYTSAASIRITNPYK
NVLEDGRQNTDNAFLDRYIVSEIGVIGNYATRKKIAQALIDSFEVSKHKDMLPLISAQKGSSSHKSVNQIAGMLGGIISV
EQNQGTDVVFISAESRSAFETALIANCAALEYQKINTAVSREKLTNLRKFLDDQAQEKLAELRSIEDSLMRFQEKGGIIS
FDVQSTNIIGQLSNLDAQKEAIKIQLSTSNEVLKQYKFFLKKQDPQLVEYLEGQTSQAYINALQQQLAELQVNRDIAMSI
KSSDVDVSSKVKEYDTRIADIKQKLNSTISTIKAEAYSGNPDQVRDLAQRLIEEEIKNSSLSVQLDQLEKATGKYEGNLR
RLPKASTVLSQYQRERESLQQTYLLLNERYQEAMINEASESGNVVILNPAVIPDSPSKPNRLLILLIGLILGPIIAFALI
LIKDHFDDTVKTPDDIEKEEIKFLTWIPHLKSNVKDNGFSPGLVVLDENDSPVSESFRVIKARIQQSSVDPDLSKIILVT
SPAEGEGKSFVSANLAGSFALSNKKTLLIDCDLRRPTIHTKMGVDKKPGLVDYLSRKVALETIIRSKTNTLSFITAGTNL
SNPAELLESKAMKNFLQEVKDIFDVVIIDSAPIVAVIDSEILAKLVDGTILVISADKTENRLMKDAVDLIKRDKATFLGT
VLNNFKYKSGYGYYYKYYYNYSNSSDHKSKKSYKLKS
>gnl|bykdb|A0A3N5L0V6 [Bacteria] Bacterial tyrosine kinase [Ignavibacteriae][Ignavibacteriae bacterium] (length=767 residues).
MENQPTNRNSLNTIETNIKSSHSIRFYFNLILRNKVPIILSLVVGIIVSYFYAYSQEDIYSSASLMRLAKPKENVLEGKI
FSDIEGELPERFINNEVEILKSFAIREKTARSIIDSFKVLKDKQSFALICMNRANCMEPKSVNQVASLLTGYIEIAQKRG
LDIVSIKAESPSPQEAALIANCYAETYADYSLKFNRGHLTLNREFLEKQVQGKYDDLLKSEDRLTTFLRSQNIVELNAQA
NALINTMTSIETQHNGAAIDLQTSGRTVSEIKSELDKIDPKATDFIASKITDPYVAQLQQEIAKLEIQRDLVISGNEELL
KDAKSLSSLNNKIADLKKNLDIKIEILKTGASANTPDGRRILESKLFDAQLLNDQSKIKERLLKDFKGKYEAQFNKMPEQ
TIEYANLERERKSDEKLYLMLLEKYQEALINEESQPNNVKIIDYGKTPKEKSKPNRFLIIMIGVLVGLSIGYGFALFRNI
LDVSVKSPEELENIGISLIGWVPTFMRISRNGSRNAPSEQELILSYNTDSAPAESFRTLRTRLQFSKLEPEPIKTILITS
SIPREGKTIISANLAASFALSNKVLLLDCDFRKPRIHNIFNQKRYPGLCDFLFGTVGFEEIIRDTQFDNLSLITCGTIPT
NPAELIASKHMQTFLNLVKPKFDYIIIDSPPLATVTDAELLSSYADGTVVVSLANKTRLDLLINTIETLNKINDSFIGVI
LNNFDYQATYGSYYKYYYYYYGSEKGKESGEKVTKAAKGTTKSSLKP
© 1998-2019