BYKdb

Dataset for cluster tadcd of phylum ignavibacteriae

[Download (right click)] [Alignment] [Repertoires]

26 sequence(s)

>gnl|bykdb|A0A1G0P4D7 [Bacteria] Bacterial tyrosine kinase [Ignavibacteriae][Ignavibacteria bacterium GWA2_35_9] (length=747 residues).
MSEENKNENLVETNSLKDYINLVRNNLFPIILIVAASLIISIVYAVNARNIYKSTAALKVVKPQGSILNSPVISDFQDFG
SDRFIANEIEILKTFNTRERVAEALIDSFNTFGVKDSFFLLLNQKSDKQKGKLLPVSEIAEELFHAVSIDQKRGLDIIEI
TVESPSPYEAVLAANCYTNEYKNLNLEVNRDQLTLVKDFLLDQKQEKQNQLSQAEETLKKFQEKGGVIALDEQANKLISQ
LSDFEAQKNATQIELMASSKVLNQYRNELDKQNPRLADYLKGLSSEAYFKSLQEQLVRLEVNRDLALSTKSSLEDDSKSV
QNLNEKIIDLRNKLNDRVEEIKLGIFASSPEEVKELSQKMIEEEIKNQSLKISVTELGSIVRNYEKKFNKLPQTAIELAR
YQRSRESLEKLYTLVEEKFQEALINEQSQPGNVLIIDNARRPLLPSKPNRLLIVIIGLVLGSGLAFGYVIAKNYFDNTVK
TPEDLQKRNISVLAWIPQFEGASKNGTQDYEFIVAKKPDSMASEAFRALRTRIQLLRFDKDSLKTFLVTSSAPQEGKTLI
AINLAGSFAQSGRRTVIIDCDLRKPRVQELFNAKRIPGLIDYLFGHLSLNEVTHKAEIDNLDYITCGTIPPNPAEMLESE
PMKRFLTEMREKYDIVILDSPPIIAVTDSEILATMVDGTVLVVSADTTEFDLMEKAVEIMKKDKLTFLGTVLNNFSYKSG
YGSYYKYYYYYSENSEGKKSRSSKRKA
>gnl|bykdb|A0A1G0P817 [Bacteria] Bacterial tyrosine kinase [Ignavibacteriae][Ignavibacteria bacterium GWA2_35_9] (length=748 residues).
MNKTNNSSKNLNQSILKEYLRLIRANFSSLLIINIIIIIVATIYAITAQDIYTATTDIKITTPQGSILTSPLIPNSGNLG
FGNDLLIANEIQTVTYNYTIREQVADAVIDSVESSSPSDFALIIDDENTAKSRGKLKEYDDILDILENHVEVEQIGNLDF
ISISVESPSAKEAAVIANSYAEAYRVFNLMVNRNELTTIRKTLEEQRKEKLSDLILAENNIKAYQLKGGVIQLDAQAKNL
IDKLSNYEAQRNTAQIDLSILKGSLEKYKNELKQKDPSLITYLESKTSEPYLTSLQTQIAQLETQRDMALSGSSGSRVNS
EVINDYNNRIDELKDKLKKSVSKYQSMILSSSPEEIKDLTKKVFETEVKYQAEMSSYNQLGQIISSYEGRFNNLPGRTLD
LARLERERSVFEKLYLALEEKYQEALINEQAMPGNVFIMNYAFPPPDPNKPSRPLIIVFGVIIGFGFGFGFIYLKDFLNK
RIKTPEDIQDLGTTLLTWIPRTKRNISDPELIVFNNSDFPTIESFRALRTRIQFSKNKSEVKVLLITSSAPGDGKTMVST
NIASSFARDDKRTIIVDCDLRKPRLHSIMGESISPGLSDYLFGRTNKEGIIRNSNLAKLDYITAGTIQNNSSEVLNSIKM
VTLLQKLREDYDVVIIDSAPILAVADTELLSNFVDASILVVSANNTEMEWAKQSISLLSHGQSAFLGIVLNNYDYKFGYP
SNYKYYNYYYSSDSTDKKKPSKKIKTNI
>gnl|bykdb|A0A1G0QKB6 [Bacteria] Bacterial tyrosine kinase [Ignavibacteriae][Ignavibacteria bacterium GWC2_36_12] (length=747 residues).
MSEENKNENLVETNSLKDYINLVRNNLFPIILIVAASLIISIVYAVNARNIYKSTAALKVVKPQGSILNSPVISDFQDFG
SDRFIANEIEILKTFNTRERVAEALIDSFNTFGVKDSFFLLLNQKSDKQKGKLLPVSEIAEELFHAVSIDQKRGLDIIEI
TVESPSPYEAVLAANCYTNEYRNLNLEVNRDQLTLVKDFLLDQKQEKQNQLSQAEETLKKFQEKGGVIALDEQANKLISQ
LSDFEAQKNATQIELMASSKVLNQYRNELDKQNPRLADYLKGLSSEAYFKSLQEQLVRLEVNRDLALSTKSSLEDDSKSV
QNLNEKIIDLRNKLNDRVEEIKLGIFASSPEEVKELSQKMIEEEIKNQSLKISVTELGSIVRNYEKKFNKLPQTAIELAR
YQRSRESLEKLYTLVEEKFQEALINEQSQPGNVLIIDNARRPLLPSKPNRLLIVIIGLVLGSGLAFGYVIAKNYFDNTVK
TPEDLQKRNISVLAWIPQFEGASKNGTQDYEFIVAKKPDSMASEAFRALRTRIQLLRFDKDSLKTFLVTSSAPQEGKTLI
AINLAGSFAQSGRRTVIIDCDLRKPRVQELFNAKRIPGLIDYLFGHLSLNEVTHKAEIDNLDYITCGTIPPNPAEMLESE
PMKRFLTEMREKYDIVILDSPPIIAVTDSEILATMVDGTVLVVSADTTEFDLMEKAVEIMKKDKLTFLGTVLNNFSYKSG
YGSYYKYYYYYSENSEGKKSRSSKRKA
>gnl|bykdb|A0A1G0QLK5 [Bacteria] Bacterial tyrosine kinase [Ignavibacteriae][Ignavibacteria bacterium GWC2_36_12] (length=748 residues).
MNKTNNSSKNLNQSILKEYLRLIRANFSSLLIINIIIIIVATIYAITAQDIYTATTDIKITTPQGSILTSPLIPNSGNLG
FGNDLLIANEIQTVTYNYTIREEVADAIIDSVESSSPSDFDLIIDDENTAKPRGKLKEYDDILDILENHVEVEQIGNLDF
ISISVESPSAKEAAVIANSYAEAYRVFNLMVNRNELTTIRKTLEEQRKEKLSDLILAENNIKAYQLKGGVIQLDAQAKNL
IDKLSNYEAQRNTAQIDLSILKGSLEKYKNELKQKDPSLITYLESKTSEPYLTSLQTQIAQLETQRDMALSGSSGSRVNS
EVINDYNNRIDELKDKLKKSVSKYQSMILSSSPEEIKDLTKKVFETEVKYQAEMSSYNQLGQIISSYEGRFNNLPGRTLD
LARLERERSVFEKLYLALEEKYQEALINEQAMPGNVFIMNYAFPPPDPNKPSRPLIIVFGVIIGFGFGFGFIYLKDFLNK
RIKTPEDIQDLGTTLLTWIPRTKRNISDPELIVFNNSDFPTIESFRALRTRIQFSKNKSEVKVLLITSSAPGDGKTMVST
NIASSFARDDKRTIIVDCDLRKPRLHSIMGESISPGLSDYLFGRTNKEGIIRNSNLAKLDYITAGTIQNNSSEVLNSIKM
VTLLQKLREDYDVVIIDSAPILAVADTELLSNFVDASILVVSANNTEMEWAKQSISLLSHGQSAFLGIVLNNYDYKFGYP
SNYKYYNYYYSSDSTDKKKPSKKIKTNI
>gnl|bykdb|A0A1G0V7G7 [Bacteria] Bacterial tyrosine kinase [Ignavibacteriae][Ignavibacteria bacterium RIFOXYB2_FULL_36_7] (length=747 residues).
MSEENKNENLVETNSLKDYINLVRNNLFPIILIVAASLIISIVYAVNARNIYKSTAALKVVKPQGSILNSPVISDFQDFG
SDRFIANEIEILKTFNTRERVAEALIDSFNTFGVKDSFFLLLNQQSDKQKSRLLPASEIAEELFYAVSIDQKRGLDIIEI
TVESPSPYEAVLAANCYTNEYKNLNLEVNRDQLTLVKDFLLDQKQEKQNQLSQAEETLKKFQEKGGVIALDEQANKLISQ
LSDFEAQKNATQIELMASSKVLNQYRNELDKQNPRLADYLKGLSSEAYFKSLQEQLVRLEVNRDLALSTKSSLEDDSKSV
QNLNEKIIDLRNKLNDRVEEIKLGIFASSPEEVKELSQKMIEEEIKNQSLKISVTELGSIVRNYEKKFNKLPQTAIELAR
YQRSRESLEKLYTLVEEKFQEALINEQSQPGNVLIIDNARRPLLPSKPNRLLIVIIGLVLGSGLAFGYVIAKNYFDNTVK
TPEDLQKRNISVLAWIPQFEGASKNGTQDYEFIVAKKPDSMASEAFRALRTRIQLLRFDKDSLKTFLVTSSAPQEGKTLI
AINLAGSFAQSGRRTVIIDCDLRKPRVQELFNAKRIPGLIDYLFGHLSLNEVTHKAEIDNLDYITCGTIPPNPAEMLESE
PMKRFLTEMREKYDIVILDSPPIIAVTDSEILATMVDGTVLVVSADTTEFDLMEKAVEIMKKDKLTFLGTVLNNFSYKSG
YGSYYKYYYYYSENSEGKKSRSSKRKA
>gnl|bykdb|A0A1G0VGZ5 [Bacteria] Bacterial tyrosine kinase [Ignavibacteriae][Ignavibacteria bacterium RIFOXYB2_FULL_37_11] (length=744 residues).
MNKAAVQPHVQDTHTLRDYINLVKLNFVPIFLIALTGLLVAIIYAVNAPDIYKSTTVLKLSKPQGSVLSGSLLPEFQDFG
SDRFIANEIEILKSYKLRSKVANALLDSFNVSSTKNKYYMIFEDPSELKQGKFRLKTIASIVGMLPSKVSIDQKRGLDIV
EISVESPSPTESAMIVNCYAEAYKGINLSYNREQLTRVKNFLASQRDEKQSELISVEETLKNYQEQRGIVELPEQAKALI
EQSSDIQAKMNATRIDLTMTEKSLNQYKDELKRRNPEIQNYIDNLASEPYIKRMQDELAEQKSQRDRAIKDAGPNSPLVK
KAETKINEIDARLKNQLSVFKAGVLAATPEEIKTLTAKVLEEETKYQSLNASYRKLNEIGGDYDRKLSALPTSSTDLARL
TREKMAYEKLYLQVEERYQEAIISEQSVPGNVLIIDEGLVPVKPAKPNRLLIVLIGLILGFGMGIGFAFIRNYLDNTVKT
PEDIQNKNLNILAWIPQIEGLESGIKDFEFVVARKPDASASEAYRALRTRIKFSKLDKESLKVLLVTSPTSGEGKTTTTV
NLAGSFAQANFKTIILDADLRKPRVHTVFNQKRFPGFTDYFFGQATFEEVVRKTELNNLDYITAGTIPPNPSEILSSTQM
EAFIEKLKTMYDYILIDSPPVIAVTDSEILSSIVDATVLVVSANNTEMELMEKAVELLNHEQGSFIGIILNNFTYRSGYG
SYYKYYYYYSRPKDGSSKKNKLKV
>gnl|bykdb|A0A1G0X4V9 [Bacteria] Bacterial tyrosine kinase [Ignavibacteriae][Ignavibacteria bacterium RIFOXYD12_FULL_36_8] (length=749 residues).
MVNNNNNTSIRANTLWDYINLIRNNIVLITIILAIIFLVTTIYAIVAPNKYTSTVSLKISPPSGNILSSRFGDLQNFGGQ
GSDRFIANEIQTIYNSTIMNEVAEAIIDSFKVKKNEDDFSLIFDKSYFQSKGTLLKSANEVAGNLYSNVKITQLNDLDWV
DIVVESQTPQEAALIANIFAKKYQKFNLLENRKQIRIIKEFLGEQLKEKQLALYAAEDAVKEYQLRKGGVQLDAQAQLLI
SKLADFESQKNTAKVNMSITKEKLNQYKNELEKRDPSISNFLANKTSEPYLQKLQEEIASLQTQRDVALASSKTANANNT
AVAELNSKINSLKDKLNKSMKEYGNQILASSPEEIKVLSQKTFEEEVTYQSLAESYNSFTNVINKYEQEFNKLPTSTLDY
ARLERRRLAEENLFNTLTEKYQEAQLNEQATPGNVLIMNTANPSRNPSGPNRMMIILMGLFIGIGFALGFVYVRNYFDKT
IKTPEDIEAQNVNVLAWIPKISHEESVGLKNPELIVAQKPDSLSSEAFRTIRTRLQFSHISKGAKLILITSSAPGEGKTT
ISTNLAASFAQANKRSVIIDCDLRKPRLYSLFGGNDSNGFLDYLFGNVQYDKIIKKSEVRNLDFVTAGSIPPNPSEILGS
PAMKSFLDKLKNDYDIIIIDSPPIMAVSDAEILARFVDICLLVVSANSSEVDWLKESVSLLRHDNVNLAGVLLNNFNYKS
GYHSYYKYYDHYTEKYKNTKKKGKLNKPA
>gnl|bykdb|A0A1G0XBL4 [Bacteria] Bacterial tyrosine kinase [Ignavibacteriae][Ignavibacteria bacterium RIFOXYD12_FULL_36_8] (length=751 residues).
MNNNKNDFDFQELEGRNFKDYLILLRKNLTPFLIILIMSIAVSIVYTLRLPDIYVSETSIKISKSGGSVLQSQPFGDFGD
LGSDRIINNEIEILKSYDLREIIAKALLDSFAQSSSKDDFKLLYKSESEFRNDNKRLLKLGEIEGVLGSKVNIEQKRGLD
VIVISAESPSPKEAALIAALYAKVYRTYNLEINREQLSYIRNFLDQQRAEKKTQLSQAEDTLRAFQEKGGMIALDEQSQL
LIQQLSQFEAQMNAAKIELVASEEVLNKYKDELSKQDPKLADYLESVTSETYITALQNQIAELQLNKDIALARLEPGIDI
SQKVKEFDVKIRELKDRLDEKIKVLKSGILASSPEAVRGISQKIIEAEVKNQSLRSSVTGLSALVNRYEERFNRLPKTTL
ELARFKRTRESSEKLFTLIEEKYQEALINEQSQAGNVLIIDNARIPSGPSKPNRHLLILIGVLMGFGLGFGFVLVKDYFD
NTIKTPEDIEKQNVNVLAWIPKVEELNGKSKNGNDFIIEKNPSSIPSETIRGLRTRVQFSKVDKDKLKTILVTSPAPLEG
KTTIALNLAGSFAQGNRKTLLIDADLRKPRLHQVFNKEKQPGLVDYLFGEVPFEKVLTVTNTKNLFLITSGMIAPNPAEM
LDSVQMENLLAKVRTEFDYVVIDSSPIVAVTDAEILARKVDGSILVVSSNKTEKDLLNLAVQLIKNDSSYLIGTVLNRFS
SKSGYGSYYKYYYYYSSDGKKKSTKKKHSKT
>gnl|bykdb|A0A1G1B9H5 [Bacteria] Bacterial tyrosine kinase [Ignavibacteriae][Melioribacter sp. GWF2_38_21] (length=744 residues).
MNKAAVQPHVQDTHTLRDYINLVKLNFVPIFLIALTGLLVAIIYAVNAPDIYKSTTVLKLSKPQGSVLSGSLLPEFQDFG
SDRFIANEIEILKSYKLRSKVANALLDSFNVSSTKNKYYMIFEDPSELKQGKFRLKTIASIVGMLPSKVSIDQKRGLDIV
EISVESPSPTESAMIVNCYAEAYKGINLSYNREQLTRVKNFLASQRDEKQSELISVEETLKNYQEQRGIVELPEQAKALI
EQSSDIQAKMNATRIDLTMTEKSLNQYKDELKRRNPEIQNYIDNLASEPYIKRMQDELAEQKSQRDRAIKDAGPNSPLVK
KAETKINEIDARLKNQLSVFKAGVLAATPEEIKTLTAKVLEEETKYQSLNASYRKLNEIGGDYDRKLSALPTSSTDLARL
TREKMAYEKLYLQVEERYQEAIISEQSVPGNVLIIDEGLVPVKPAKPNRLLIVLIGLILGFGMGIGFAFIRNYLDNTVKT
PEDIQNKNLNILAWIPQIEGLESGIKDFEFVVARKPDASASEAYRALRTRIKFSKLDKESLKVLLVTSPTSGEGKTTTTV
NLAGSFAQANFKTIILDADLRKPRVHTVFNQKRFPGFTDYFFGQATFEEVVRKTELNNLDYITAGTIPPNPSEILSSTQM
EAFIEKLKTMYDYILIDSPPVIAVTDSEILSSIVDATVLVVSANNTEMELMEKAVELLNHEQGSFIGIILNNFTYRSGYG
SYYKYYYYYSRPKDGSSKKNKLKV
>gnl|bykdb|A0A1V5TPD0 [Bacteria] Bacterial tyrosine kinase [Ignavibacteriae][Ignavibacteria bacterium ADurb.Bin266] (length=858 residues).
MKNTIPNNFKKEKSLLEIINIVYRGRIKIVISVFLSLVLAFLYIKFTPPVYESKALLKKEAAENPGQKDEFSELVKLQTS
DQLETEMELIKTNEVLSGVINELKLYVELRKVVDPNGNSYEFNNIFVDFPDSANNYTKQMSFSFPIFKNFQLLNDYTEKE
YYIKKINQNRFELWDAKGKNIITSFNDFSVSKSDSIKESNALDLSDSTKSSVQDAEGVTVITDAAKFEFSWSDAPVGSKI
YFNIKNYLKFLTRFGDAINVSRVGHTGVFELNVRSVSPLACNIIANSVIRHFREVRMEQQKQMVRYSFHFVDQQLSEVQK
KLLDAENNLSSFKGSQQIMNIDQNTQELLNYQSTLEAENLQTDLLLSDYRNKEVALKSELKSSGYFDQGFLSPSTESQSS
SPFTTLMSRLSDLELQRLELLQKRTEKHPDVVKLDEQIRLTKEQLSSYNQNTLASYRIVIDAMEKKQAKIKDLMSGFEAQ
IKRLPGQESQLARLIREKEVYEKIFNVLLNKREEMRVAELSKLQDIIIVDYPSSPFKPVLPKKLFTLIIAVFLGGFVGIV
IIFIGELSKTRLISLDDLENEFNMPILALIPIFDKSIRNKMKKSNDKKDQFVMLQTDNSGISESYRLLNTKLSHLDLKDK
TIMVTSCEENTGKTTIVANLAITLALNNKNVLIIDCDLRKGELSRRFNVFHNSSGLIDFLEKGSSPVIYTKLLKKINILP
SGGINENSSILLSSDRMKSLFEKIDTSAYNYVIIDTPPVTRVVDTLILGQYVTNAILVVRPDISMKDSVIGGIQDMNQAQ
IKILGIVANATEIQSSYRYRYSYGYGYGYGNSPKDKNGKHGVKKLSSIVRKHSKVNSS
>gnl|bykdb|A0A2E0W055 [Bacteria] Bacterial tyrosine kinase [Ignavibacteriae][Ignavibacteriae bacterium] (length=743 residues).
MNYREQEGNSLKDYINLIKINIIPILLISAAGLIVSVLYALTAQNIYKSTTVMKLSKPQGSILEAPLMPEFQDFGSDRFI
ANEIEIMKSYTIREKVAKSLIDTFHNIGVRDSFYWVLNQDLDLTPDSEVKTVVQLSELLSKIAVIEQKRGLDILEISVES
PSSFEAALIANSYAEAYKQQNLTYNRLQLITVKNFLEEQRVDKLNELREAEDAVKKYQEQGGIVVLDEQARALIDLISEF
ESQLNAAKIEMMSSELTLKLYNEELDRQNPEIKKYIENFAAQKELEQYQTSIAKLTVDKELAMANLNRTNKEQEIAKYYD
DKIADLNKKVDKLLEKYEASIFASSPEEIKELTLKKLEEEVKYNAYKASYNELDKIVKNYERRFNQLPERTIDLARLQRE
REAYEKLYLLVEEKYQEALINEQSTPGNVIIVDQARRATKPSKPNRMLIVLVGIVLGTGMGLGFAFVRNYFDSTVKTPED
IQNKNINLLTWIPEIEGVGSEDHKEFEFIVAKRPDSIPSEAFRALRTRIQFSKIRPDALKTILVTSSTPKEGKTTVSVNL
AGSFAYTNKRTVVVDCDLRKPRMHNVFKAQRFPGFTDYFFGQAEYEEIVRTSEIENLDFITAGTIPPNPSEILGSPQMEK
FLEKLKSLYDVVILDSPPVIAVTDSEILSRMVDATVLVASANITENDLLEKSVELLTHDHGSFIGVVLNRFMYRSGYGSY
YKYYYYYSRPDQKNKKPKAELKS
>gnl|bykdb|A0A2G6EAS5 [Bacteria] Bacterial tyrosine kinase [Ignavibacteriae][Ignavibacteriae bacterium] (length=753 residues).
MENKKVINNSLSNPSNTFNDYISLIRTNIYTILIISFVFLVGAIAYALFKNDVYQASTTLKITQNKQNILKGPSFDDLTG
TGGNNFFIANEIETIRNVTIREQVAGVVLDSFQNKADKENYDVVFRKNSFFDDSDKKIRTVESLAGALLKSVEITQKNNL
NFMEIMVESESPEEAAMIANSYAEVYRNFNLLENRKQFTIVKDFLNEQKEQKYDELLVAEENIKVYQANSGGIELNSQAK
AMINTLTKFESDKNITQMEIAIERKKLNEFKNELSERDPSLSNYFDLQSARPSIEMLQKEIASIETQKAIALSGKGSREQ
KNTLVKGLDQKLGELRKKLKTDIDAYESKVYAATPEEVKELSAKIFESEVKIQSLAAKNSQLSQVLNSYESEFQSLPAKS
LEIARLERKRQSLEKMYLVLEDKYQEALLNEQSIPGNVLILSKARAPESPAEPNRLKIAIMGLFAGLFFAVVFVYVKSFF
DKTVKTPDDLENLGLYVLGSVPRFERKVSSEGDDSEIFMSSKNEIAASEAYRAMRTRIQFSKLSEGTKAILITSSAPQEG
KTTVTVNLAAGFAQTNKKVIILDCDLRIPRIHSVFKGKSSPGFTNFLFGQVSFDEIVRKSNEVDNLYYIAAGTIPSNPSE
ILGSKQLEDFLKKLKSEFDLVILDAPPVMTITDAEILSHIVDITLLVVFANKTEVDWVTESAQILNRGEESSFVGAILNN
FDYNTGYRSYHKYNSNKYYRRADESRSKEWVKS
>gnl|bykdb|A0A2G6EB58 [Bacteria] Bacterial tyrosine kinase [Ignavibacteriae][Ignavibacteriae bacterium] (length=770 residues).
MAKQNLNGNDLQYIKDFMAEEETHSIKDYINIIRQHQFAVMIISLIILTLAVVYAVVAKDIYEASTMLKISEPQGSILDA
SSFLPEFGGGNKADRFIANEIETIKNITITEKVAREITDSFIAINNNEMFSLIVNKNYFEDGSSGLKEFDAIIKVLENKV
SVEQKRGLDFIEIKVESPSAQEAALIADTYARVYREFNLLDNRKQVSKVKDFLFNQRNDKLNELIAAEDKLKNYQLKGGV
VELSSQAQSLIETITDLEAKINANAVELSIARENLNQFKEELNKKDPTIIQYLENKSAEPYLLRLQEQIAEVQTQKDIAL
SSLGDSKSSKDVQIIKKFDEKLAELKNKLSKNVKSYQSSVLAASPEEIKTLTQQIFEEQVKAQALQASHDKLKGFLAGYE
KRFNSLPQRTIDLARYEREKLAYEKLYSLLEEKYQEALINEQSTTGSVLIMNYARVPKVPAKPNRKLIILIGLVLGLGLA
FGYALIMNYFDKAIKSPEDIEERNINLIGWVPKVVSIDSENRQRGEGFIISNKADSVASEAFKAIRTRIRYSMVEGEAKR
ILITSSTPGEGKSTMAVNLAGSFAIANKKTVIIDCDLRKPRIHGIFNEKRFPGFTDYFIGRATLEEIKRKTSTENLTIIT
AGTIPPNPSEILDSKGMAALLEKLASDFDIVIIDSPPVLTVTDAEILSRIVDETILVVSANTTDVDMMTKAVSLLKSGDK
NSFVGAILNRFEVQNSYGSYYRYAYTYARGGVEGKREKVRIKKKKQNKSK
>gnl|bykdb|A0A2H0DC71 [Bacteria] Bacterial tyrosine kinase [Ignavibacteriae][Ignavibacteria bacterium CG22_combo_CG10-13_8_21_14_all_37_15] (length=748 residues).
MSNNNNTNSNEVREQGLQHYYNIIVDNLFPFSLIAIVAIVVSVVYAVSSINIYKSTTVLKVSKPSGNILNSPLMPEFQDF
GSDRFIANEIEVLKSYKVREIASTALKDSFNALNQIDSFKVLVHTPSKLTNDKPKLLEVDEIASLLSTNVTIEQKRGLDI
VEISSQSPSPFEAALITNLYAQAYKTLNLEINRNQLTLVKAFLLDQKNEKLAQLNNSEELLKMFQEKGGIIALDDQAKEL
ITQLSKFEADLNLGKMELAISEKTLKQYKDELRRQDPQLTAYLENFSSEEYLKNLQTELARLEVNRDVALSSVKDKNVDT
QAIREYDAKIKELRNKLNSKIEGFKASIFASSPEEVKLMTKNVIEEEIKSKSLEIKVKNLSEIVNKYDSKFNQLPKSAIE
YARLQRGRESLEKLYILVEEKYQEAVINEQSQPGNVLIIDVARRPDKPSKPNRLLIVLVGTILGLGFGLGYAFLRNYFDN
TVKTPEDLKDRNINVIGWVPKIQSLDKSISKDLEFIIYNKPDSVPSEAFRALRTRVQFSKVDQGNMKVIHVTSSTPGEGK
SLISSNLAGSFAQANHKTLLLDCDLRKPRVHTIFGMNRQPGLVEYLFDQVNLATIIKPTKLANLDVITVGTIPPNPAEML
GSKKMQDFITHMKTLYDYIIIDSPPIISVTDSEIIAAYCDAVYLVVSANYTEFDLLEKALDILKNSNVNFVGTILNNFVF
KNSYGSYYKYYYYYYNREKEGTRSKKTT
>gnl|bykdb|A0A2H0FVC7 [Bacteria] Bacterial tyrosine kinase [Ignavibacteriae][Ignavibacteriales bacterium CG18_big_fil_WC_8_21_14_2_50_31_20] (length=751 residues).
MNNGLNNNGAGFEVEETNSLKDYVNLIKLNLIPILLITFTGLTVAIIFAIISKDIYTASTSLKIAKPNGGGILDAPLLPE
FSDFGNDRFIANEIEILKSYRLRTIVATSLIDSFNVIAQPDSFYNIFDRSIDFDREAYKLKNINDLVLMLEDTKIEQKRG
LDIVTISYESHSPFEARLITNAYADAYENLSLKYTRQQLTTVVQFLKEQRKDKYSALLEVEEKIKTFQVEGGIIALDEQA
KALIDMLSTFESQRDAAAIEMMATEKMVNSYKTEINRLNPSISKYIESFATKPKMKGLQEQIAQLEMQRDLAISDSSVTI
ESEAKLISETNKRIAELKIELNKELETYKQSIFAASPEELKELSISLLEAEVKYESLKSTISKTKEIVNQYEARFNELPK
QTISLARLTRELNANEKLYLLVEEKYQESLIVEQSTAGNVLIIDPAIRPLLPSKPNRKLIVLIGLILGMGIGFAFAFIKD
FLDNTVKTPEDIQKKNINVLGWIPKIEGITLNKEFEFIIAKKSDSIYSEAFRALRTKIQFAKIDKKSINTIHVTSSTPSE
GKTTVSVNIAGSFAQTNRKTVIVDCDLRKPRMHKVFASQRFPGFTDYFLGEATFESIVHKSELPNLDFITAGTIPPNPSE
ILGSQQMLAFIDKLKVIYDLVVIDSPPIIAVTDSEILSRIADASILVASAGETDIELMTKAVDLMRHENKSFIGVVLNKF
SYRSGYGSYYKYYYYYSHNRDNSKVKHKTTV
>gnl|bykdb|A0A2M7MN42 [Bacteria] Bacterial tyrosine kinase [Ignavibacteriae][Ignavibacteria bacterium CG_4_10_14_3_um_filter_37_18] (length=748 residues).
MSNNNNTNSNEVREQGLQHYYNIIVDNLFPFSLIAIVAIVVSVVYAVSSINIYKSTTVLKVSKPSGNILNSPLMPEFQDF
GSDRFIANEIEVLKSYKVREIASTALKDSFNALNQIDSFKVLVHTPSKLTNDKPKLLEVDEIASLLSTNVTIEQKRGLDI
VEISSQSPSPFEAALITNLYAQAYKTLNLEINRNQLTLVKAFLLDQKNEKLAQLNSAEDILKIFQEKGGIIALDDQAKEL
ITQLSKFEADQNLAKMELAISEKTLKQYKEELRNQDPQLTAYLENFSSEEYLKSLQTELAKLEVNRDIALSSSKDKNNDN
QTIKEYDAKIKELRNKLKSKVEGVKASIFASSPEEVKLITKNVIEEEIKSQGYAIKVKNLDAIVKTYDAKFNQLPKSAIE
YARLQRGRESLEKLYILVEEKYQEAVINEQSQPGNVLIIDVARRPDKPSKPNRLLIVLVGTILGLGFGLGYAFLRNYFDN
TVKTPEDLKDRNINVIGWVPQIQSLDKSISEDLEFIIYNKPDSVPSEAFRALRTRVQFSKVDQGNMKVIHITSSTPGEGK
TLISSNLAGSFAQANHKTLLLDCDLRKPRVHTIFGMNRQPGLVEYLFDQVNLATIIKPTKLANLDVITVGTIPPNPAEML
GSKKMQDFITHMKTLYDYIIIDSPPIISVTDSEIIAAYCDAVYLVVSANYTEFDLLEKALDILKNSNVNFVGTILNNFVF
KNSYGSYYKYYYYYYNREKEGTRSKKTT
>gnl|bykdb|A0A2M7ZEP7 [Bacteria] Bacterial tyrosine kinase [Ignavibacteriae][Ignavibacteriales bacterium CG_4_9_14_3_um_filter_34_10] (length=751 residues).
MENKVFHNLREQENSSIKDYINLIKINFLPVLLISLTGLIVASLYAIYAIDIYKSTVVLKVAKPSGSILNSPLMPEFSDF
GSDRFIANEIEILKSEKIRSLIIKQIQDSFKVIDADSFYLVLDQDSKFFSNNKNKKKLLPYREISKLLEKVSIDQKRGLD
IIEISVESPSPFEAAFLANAYAKAYESLNLSYNRQQLVVVRDFLMEQREEKYHELILAEEKLKNYQEKGGIIALDEQAKS
LIAALSDFQSQRDASQIEVAMTQKALDQYKEELEKKNPSLTQYIESYAAEPRLKSLQEQIAKLETQRDLAIANKNVPENK
RLIKDYDESIKELKLKLDEQLKIYKTSIFALSPEEVRELSLNVLEQEVKLISAQSKKENLEKIVGKYDKKFNELPSQTID
LARYQRELSAYEKLYLLVEEKYQEALINEQSTPGNVLIIDEARRPELPSKPNRMLIVLVGLVIGVGMGAGFAFVKNYFDN
SVKTPEDIQNNDINVLAWIPQIDILEENKDFEFIVAKKPDSLHAEAYRALRTRIQFSKLDQKRGIQTLLVTSSAPREGKT
TTAVNIAGTFAQANKRTVIVDCDLRKPRMHTVFKAQRFPGFSDYFFGQSTYEEIIHKSELPNLFYITAGTIPPNPSELLS
SDQMVAFLEKLKSEFDMIVIDSPPIVAVTDSEIISRLVDAAILVVSANNTEIELMRKAAELLTHESKSFIGAILNNFSYK
SGYGSYYKYYYYYSHQSKGNGVAKVKKIDKV
>gnl|bykdb|A0A2N1VFP3 [Bacteria] Bacterial tyrosine kinase [Ignavibacteriae][Ignavibacteriae bacterium HGW-Ignavibacteriae-3] (length=745 residues).
MNGSQGNSPLNQDAHTMRDYINLIRLNFVAIALITLTGLLVALVYAINAPNIYKSTTVLKLSKPQGNILSGSLIPEFQDF
GSDRFIANEIEVLKSYHLRERVSRCLIDSFKLSPEKNKFSLIYEDARGISTTGRKLKTVEEIAVMLTSKVSIDQKRGLDI
IEISVESQAPFEAAMIANSYASSYKEINLTYNRQQLTVIKNFLAQQREEKLAQLVGVEETLKNFQEKSGIVQLPEQARAL
IDQSSDFQAKMNAAKVDLTISEKTLNNYKQELNKHDPNLTDYIENLATEPYIKKLQEQIGEQKIQRDRALASQSSNKQQM
VREVDAKISELRDKLNSQLSVFRAGVLASSPEEIKELAKRVVDEEIKYQSIVASYKKLNEIVGEYDKKMNLLPTTATDQA
RLEREKSANEKLYLQVEERYQEAIINEQSVPGNALVIDAGLVPILPAKPNRLLIVIIGLFLGIGMGIGFAFIRNYLDNTV
KTPEDIQNKNINILSWIPQIEGMEGGNKDFEFIVAKKPDASASEAYRALRTRIKFSKIDKDSLKTILVTSPTSQEGKTTT
SINLAGSFAQANFRTIIIDADLRKPRIHSVFNQKRFPGFTDYFFGQATFEEIVRKSEVNNLDFITAGTIPPNPSEILGSS
QMESFFEKLKNEYDYIIVDSPPVIAVTDSEILSSMVDGTVLVVSANNTEMELMEKAVQLINHERSSFLGVILNNFTYRSG
YGSYYKYYYYYSRPTNGAKKGRVKV
>gnl|bykdb|A0A2N1VVT2 [Bacteria] Bacterial tyrosine kinase [Ignavibacteriae][Ignavibacteriae bacterium HGW-Ignavibacteriae-2] (length=778 residues).
MVCNNAIHNFHITIFNNSYTEHQQLIKGNILENKLFQNLRDEESNSLHDFINILRLNLVIILLISVTGLIVSVYYASRTP
DIYTATALIKLQQPKGSIISGPLIPTISSFGNDRFIANELEILKSYRMREIVAKALLDSFRTANRVDTQNFMINYSKLLS
EKSDTNISQNLGSIIGILSGVSVNQKQGLDLVEISATSTSPLEAKIIANTYAKSYENLNLKYERQQLISVKNFLEKQRNQ
KLDELMQSEDNLKRFQEQGGIIAIDEQAKALIDVITDFQSQRDATQIELSISGKRLQQYNNELEKKNPTIAQYIKNAATQ
PRLENLQKSIAQMETQRDVAISNTQGASRRKELVEDYNARINELKSTLDEQLAVYKASIFASSPAELKDLSLKVLEEEIK
SKATASKFESLDDIVRRYERRFNELPRQTIDYARFQRELTSYEKLYLLVEGKYQEALINEQSTPGTVLIIDEAIQPSSPS
APNRMRIILTGFIFSLVVGFSFAFIRHYLDNTVNTPEDIQKNRLNVLTWIPKMEQLATKDEFQFIVHSKPDSIYSESFRA
LRTRITFSKIQESPVQTILITSSAPREGKTTVAVNLSGSFAQANKKTIVVDCDLRKPRIHNVFQAQRFPGFSDYFFGQAP
FEDIIHASDVPNLFYITSGTIPPNPSEILASSQMEAFLEKLRGEYDIIILDSPPIIAVTDSEILSRLVDATILVVSAHTT
EVELMRKSAELLDHEQNTFIGVLLNNFSYKSGYGSYYKYYYYYSQGGNGAAKKNRIKA
>gnl|bykdb|A0A3A0BB82 [Bacteria] Bacterial tyrosine kinase [Ignavibacteriae][Ignavibacteriae bacterium] (length=741 residues).
MVKKSRDKDKHNIDILKEFIGIIRVDWIYVLLIFLGVLLTTVFYVLNARNIYESTTVIKITKPQGSILTSSPIPEFQDFG
FLSDRYISNEIEVLKSFSIRSLTAKTLLDSAEANGNISSFYHLLNDPDDLSKGLKNEFEIAKMLKQVVQVVQKKGLDVVD
LSVESPSPYEAAIICNAYAKTYSDYSLEFSRLDLTNIINYLNTEKEKKFRDLKLSEAALEDFQQREGVVQLDVQADELVR
SLSAIDKEKTMTSIELAANEKKYSELSQKIDEIDPKLKVYLESEISKGYLPELQKQIAQLEIERELQLSIISNDRVRQKA
KEEYDRKISSLQESLDKNVKSLDAGMYVMTPEERREMVWELVKTGVMVNSDRIKNRVLGNYVNEYETRFNKLPSQIIEYA
RLERDKLTNEKIYILLEEKYQEALINQNARIGNVTIIDPAFESLLPSKPNRVFLLVSGAVFGLILGIGFVITRNYLDKSI
KTPDDLENNGYSILAWIPSIDIKEKSDLSSPDEFIVASDAKSSISEAFKVLRTRVQYAKIEEEPLKTILITSTIPGEGKT
TVAINLAGSFALDGKNVLLIDCDLRKPRVHSVMGVNRYPGLTDLLFGNNDLSEVIRPTKFDNMHFIPSGTIPPNPSELLG
SLQMKKTLENLKTQYDIIVLDSPPSISVTDSEILFKITDGTLLVVQSLKTPMDAFSKVYDRFNSFSEPNLLGTVLNNFSY
KRNYGYYYNYYYYYSSGEKPN
>gnl|bykdb|A0A3D6BED1 [Bacteria] Bacterial tyrosine kinase [Ignavibacteriae][Ignavibacteriales bacterium] (length=739 residues).
MSNPNLNDTDVDESQSSTLKDYLILFSANIKPVSAILIASLIISIIYAISARDIFKTSTALKITKPGGSILQSPLMPEIS
DYGNDRFIANEIEILKSNNIRERIAKILLDTLLKSNDPKSFHLLLTDEFGEDSRPKTVPEIAGVLGSAVQIEQKRGLDII
DISVESQAPKEAALIANVYAKEYLTYNLEISRDQLTFVREFLANQRLEKKEQLNDAEEILRSYQERGGIIALDQQAQTLI
QQLAQFEAQKNATQIEIEASSEVLKQYRDELSKQDPKLADYLASATSETYIKALQDQIAELQIRRDLALAKTDTKTDFSD
QLRDYDNKIKDLKGKLAEKIKVLKAGIFASSPEEVKNLSQKIIEEEIKNGSLKTTLNELNLVVKKYDERFNKLPKTSIEL
ARFERNRESLEKLYTLVEEKYQEAVINEQSQPGNVLIIDDARVPYSPAKPNRALIIIVGLLIGAGLAFAYVFLKNYFDNT
VKTPEDLQKRNINVLAWLPRVDELLLKESSKVDFIILNKPDSVTSESFRALRTRIQFSRPDKETLKTIVVTSPAPQEGKT
FVTINLAGSFAQANKKVLLVDCDLRKPRVHRVFDIAKEPGLIDYLVGDKTLEEITHTGEMPNLSFISSGTIPPNPAEMLD
SRQMDEFLALVRGMYDYIIIDSPPIIAVTDAEILSKKVDGAVLVVSSEITEYQMMERAYQLIKHDNTTLIGTVLNNFDTR
SAYGTYYKYKYYYYYASKK
>gnl|bykdb|A0A3N5Q7G8 [Bacteria] Bacterial tyrosine kinase [Ignavibacteriae][Ignavibacteriales bacterium] (length=716 residues).
VLIIATALIVSIIYAVNARDIYKSTATLKVVKPQGNILYSPVIPEFQDFGNDRFLANEIEVLKTFNTRERVAKSLIDTYN
DVASKDSFYILLDVSSAFQETKARLLSTDDIAERLSSAVSIDQKRGLDIIEISAESPSPYEAMLVANSYANEYKTLNLEV
NRNQLTIVKNFLLEQRNEKQTLLNEAEETLRKFQERGGVIALDEQANNLIAQLSNFEAQKNAAQIDLMASDKILAQYKRE
LAEQNPRLADYLKGLSSEAYFTSLQEQLVKLEVNRDIALSNNNPIENRNKIVSDYDEKIKELQNKLNSKVDEIKTGIFAS
SPAEVKELSQKIIEEEVKNQALKISVSELEIIVKSYESKFNNLPKTAIELARYQRSRESLEKLYTLVEEKYQEALINEQS
QPGNVLIIDNARKPSNPSKPNRVLIIIIGLILASGLAFGYVLIKNYFDNTVKTPEDLQSRNIPVLGWVPQFEIEGRNGMT
GNEFVVSSKPDSMAGESFRTIRTRIQLTKLDKDSLKTILITSSAPQEGKTVVGINLGGSFAQSNRRTLIIDCDLRKPRVH
EIFRDKRVPGLIDYLFGQAQLKDIIHKADINNLEYITCGTIPPNPAEMLESEKMREFLADMREKYDIVILDSPPIIAVTD
SEILSTMVDGTILIISADTTEVELMERSVELMKNDKSSFIGAILNNFSYKSGYGSYYKYYYYYSENPPGGKNKSKV
>gnl|bykdb|A0A419EVC1 [Bacteria] Bacterial tyrosine kinase [Ignavibacteriae][Ignavibacteriales bacterium] (length=756 residues).
MIRRGKVDNNNFQRVQEGSSLKDYLFLIRNNLVPIILITLAGLAVAVIYAINAPNIYKATTSLKVSKPQGSILESPLIPE
FQDFGSDRFIANEIEILKSYSVRERVANAMLSYYKDSSIKDSFYIIKNKDYGKDRTVKSPVKSVQQITDMLTSVVSIDQK
RGLDIVEISVESQSPYEAALLANEYATAYNQMNLQTNRAQLTNIKNFLEEQRKGKQGELSRSEDSLRRYQQQGGIIALDE
QAKSLIDQLTNFEAQKNSTNIELTVARNNLAQYRDELKKQDPRLADYLQSFAAEPYLKSLQEEIAKLETNRDIALASKGQ
YTSNSKVIADYEAKIKSLKDKVTEKMSVYKAGIFASSPEEVKSLTQKIIEEETKVKAATASLQELNDVVRSYDAKFNSLP
KATIELAKLERDRTANEKMYLLVEEKYQEAIINEQSQPGNVLIIDYARIPYKPAKPNRMLIVIVGFIFGLGMGLGYAFIK
NYFDNTIKTPDDIENRNINVLAWIPTIEGLGQNGNSDYEFIVAKKPDSIPSEAYRALRTRVQFSKLEKDAIKSVLITSST
PQEGKTITAVNLAGSFAQANKKTLLLDCDLRKPRLHAVFKNNRYPGFTDYFFGQATYSEIIRPSGTNNLYIITAGTIPPN
PSELLGSHQMLEFMEKLRREFDIIIIDSAPVIAVTDSEIISRIVDATILVVSSNITEVDVMEKSVNLLKHEQKTFIGVLL
NNFTFRSSYGSYYKYYYYYSRPNENGRKKSKKLDSV
>gnl|bykdb|A0A419H3A3 [Bacteria] Bacterial tyrosine kinase [Ignavibacteriae][Ignavibacteriales bacterium] (length=744 residues).
MNKAAVQPHVQDTHTLRDYINLVKLNFVPIFLIALTGLLVAIIYAVNAPDIYKSTTVLKLSKPQGSVLSGSLLPEFQDFG
SDRFIANEIEILKSYKLRSKVANALLDSFNVSSTKNKYYMIFEDPSELKQGKFRLKTIASIVGMLPSKVSIDQKRGLDIV
EISVESPSPTESAMIVNCYAEAYKGINLSYNREQLTRVKNFLASQRDEKQSELISVEETLKNYQEQRGIVELPEQAKALI
EQSSDIQAKMNATRIDLTMTEKSLNQYKDELKRRNPEIQNYIDNLASEPYIKRMQDELAEQKSQRDRAIKDAGPNSPLVK
KAETKINEIDARLKNQLSVFKAGVLAATPEEIKTLTAKVLEEETKYQSLNASYRKLNEIGGDYDRKLSALPTSSTDLARL
TREKMAYEKLYLQVEERYQEAIISEQSVPGNVLIIDEGLVPVKPAKPNRLLIVLIGLILGFGMGIGFAFIRNYLDNTVKT
PEDIQNKNLNILAWIPQIEGLESGIKDFEFVVARKPDASASEAYRALRTRIKFSKLDKESLKVLLVTSPTSGEGKTTTTV
NLAGSFAQANFKTIILDADLRKPRVHTVFNQKRFPGFTDYFFGQATFEEVVRKTELNNLDYITAGTIPPNPSEILSSTQM
EAFIEKLKTMYDYILIDSPPVIAVTDSEILSSIVDATVLVVSANNTEMELMEKAVELLNHEQGSFIGIILNNFTYRSGYG
SYYKYYYYYSRPKDGSSKKNKLKV
>gnl|bykdb|I0AMF0 [Bacteria] Bacterial tyrosine kinase [Ignavibacteriae][Ignavibacterium album] (length=874 residues).
MEQNKNNEEYIPLRFSNKNVPKREKTLVEIFQIIAKNKKILFATVGVLLIAALIYSFTATPIYEASATLKKEGNPNDRRL
GSGTDISTLLSLQSTDEIETELELIKTFKVASEVAKELDLYVNVKEIKWNSNDKNYEINKTFVEMNDPSFIGKNSRKFRI
PEKFKIKFERAEDLLLGDFSIVKKSNDKYELIDLLSGNKISESTIEKPKYDGFSPLDTIPGFTIKRDTSVVYIIPMNDKV
NIEFSWNGAPVKSEFIFTVNDINQTAIGVSKSIKVSRVGKTNIFNLGYSSSSAYAAALITNTVVDKYREARMDQKKQTIR
YSYNTVDKQLVEVQEKLQEAEKILSDFKSSGQIMSIDASSQEIVGFLSRLEAEKVSTDLLLSDYKNKVADLQTQLSQKGF
FDQSYLNPRGEGEGMSPFAELMRQLSNLELQRIELLQKRTENHPDVKAVDEQINSVKQKLSSFNENTITAYQIMIGTLEK
KLLKINDMMSKYEAKLQSLPAQENKLAQILRQKATYEKIFTILLDQREAMRVAELSSPQDISIVDEAKIPTDPSWPKKSF
IVLISLVLGSFLGILLIFTIELKKTKYVNLDELEEEFKIPILSLIPRLPKEIVKVVDNNPEHKVALLTVQDDGLRETYRV
LKTKLFQNLNPETKLLMVTSCEEDSGKTTVVANLAASLAQEGKRVLLIDCDLRKGDLSGLFGLGKETKGLLDYLLNDSPP
KIYTRASKNIDIIPSGGLSSDSGTLLDSARMRLLFRSLDTTQYDLIIVDTPPVTRVVDPLVLSHSLHNAIVVVRPEHSLL
ETVRWGISELLNAKINVKGLVINAADIENSYYYKHRYGYGYGYGSKNGNGKAKDAKKIKPEFQLKFKDQITHKN
>gnl|bykdb|I6ZVA1 [Bacteria] Bacterial tyrosine kinase [Ignavibacteriae][Melioribacter roseus] (length=743 residues).
MNNNDNNFYQENNSLKDYINLIRLNIGSIVVISLTALIVAVVYALNAPDIYKSTTTLKITKPQGSILDAPLIPEFQDFGS
DRFIANEIEILKSYSLRNQVAETLSDTFKLSRDKDKFELIVDREDRNTKPTLMPIEDIVELLESEVDISQKRGLDIVEIT
VESRSPYEASLIANCYAEAYKKLNLTYNRQQLTAIKEFLAQQREEKLAELSAVEEALRTYQEQKGIVELPEQARALIEQT
TDFESKMNATKIDLTIAENNLKQYKAELAKQDPNINDYIESFATEPYIKNLQLQIADLQTQKDRALSSYKDSPRRSEIIR
EFDAKINDLKEKLNNQLTVYRAGILASSPEEIKELTRKVLEEEVKYQSLKASYEKLSEIVADYDKRLNKLPTSSIDLARL
TREKQAYEKLYLQVEEKYQEAIINEQSVPGNVMIIDPAIVPTIPSKPNRLLIVFAGLVIGVGLGLGFAFLRHNFDNTIKT
PEDIQNRNINILAWIPHIEGIETNPELEFIVSKKPDASASEAYRALRTRIKFSKIDKDSLRTILVTSPRSQEGKTTTAVN
LAGSLAYANNKTIIIDADLRKPRLHNVFGHKRYPGFTDYFFGQVGYEEIIRTTDVNNLSYISAGTIPPNPSEILGSDQMI
NFIKKLKGEYDYVVIDSPPLIAVTDSEILAQLVDATILVVSANFTETDLLEKSVEILRRDNSTFIGTVLNNFNYRSGYSS
YYKYYYYYSSPTNGSKKNRVKAN
© 1998-2019