BYKdb

Dataset for cluster tadcd of phylum kiritimatiellaeota

[Download (right click)] [Alignment] [Repertoires]

7 sequence(s)

>gnl|bykdb|A0A0G3EFP6 [Bacteria] Bacterial tyrosine kinase [Kiritimatiellaeota][Kiritimatiella glycovorans] (length=707 residues).
MDQPNPNQQQKDSDGGLHFLDYWRVIRARKEIILAVALLVVLVGTAYTFTLPRIYRSTATIKVNNEGTDVDVFRNEGGRS
LYNPYFLRTQQRIISSRPVLYEVIERLNLRKVWGNEDRKIPEDVALNILRRSINLSAAPDTSLISIIAEREKPEEAARIA
NQVAEVYRDMRRDVKRKEMRNAIEELRTQLQKQQTKVDEAEQEMERIRQELDVTFVGNEQSGVSVDKMRLQQLEGDRIQA
RVEMLVRKARFEQMQALEGPELLNASEYVVKDPNLSDLRKQILDTDVSLSLMSENYGQNHPEVKRLRAAREELMGKLEEA
LDGLIKGLKADYEVARANYEALEKELAGIREEERQTQRESLLPFNKARRNLEIQRSILDALKARVTQEGITLEIPRTAVE
VIEPAEPGSSPVSPNLFLNVLMSVFLGLGAGVGLAYFIEYLDTSIKTADDVERYLSLPVLGLVPQKVRPMIEEGPDSEHA
EAYRVLRTNLTFTNEGQTKGTFLCTSGGAGEGKSTTIFNLAYICAQRGEKVLLIDSDLRRPVQHRILDTDNRFGLTNVLL
RDVPVEETIKPTSVPNLHFLPSGRLPRTSLGLLESQRMKELIHNLRSKFDVIFLDSPPVIGISDASILASAVDRVIMVCQ
YRKYPRDMAMRAKQLLESSNARVSGVVLNNINVMRDDYYYYYHSYYYNYYYYRSGESAPQETETAEG
>gnl|bykdb|A0A1Z9TC99 [Bacteria] Bacterial tyrosine kinase [Kiritimatiellaeota][Kiritimatiellaceae bacterium TMED266] (length=698 residues).
MNDQSDQQSNSLHFLDYWRVISSRKELVLAVAFLVVLTGTVYTLLLPNIYAASSRISVSEDMPEINPFAVQQNYMTSYNP
YFLKTQFEILTSKPILNEVINRLNLQVEWGQDGQTLSRDVALKILKNSVSVFQQRDTSLIVINVKRDNPDEAADIANEIA
EVYRDSRLDLASRDARIAIDKIEESLSEQRQRVADAEENIQQIREDLNIAVVGGEGQFDVGEVRMQQLEGDRLFAQREMV
EKEGLLKILENLDDKDLLEQASYITFDQSVMNTIQQIQDVEVQLSSVQEDYGDNHPEVKRLKSQIITLEGTLKKRLNGLR
NGLETEYIIAKNNFESLDKVLASVRTDTIESQGAKFRPYRNALADLETERFIYNQLMSKHRQEIITLQVPRNPVDVIDIA
EPNMRPVSPNLFLNVLLSIFVGLGAGVGLAYFIEYLDRSIKSADDIENLLKLKVLGLVPQKVRPLIEEGPDSENAESYRV
MKTNLQFTNEQEEGLAHCVLSSGAGEGKSTTVFNLAYVAAQQGQRVLLVDADLRRPVQHTILGMSNRFGLTNVLLRDVPV
EEAIKATSVPNLQFLPSGRLPRASLGVLDPKKIRELIQSLKMKYDLVFIDTPPVVGISDSSIIAKEADSSILVIQYRKYP
IDMLRKALASLQAQSINISGAVLNNINVMRDDYYYYYHSYYSDYYQQSDEDNTEVQTV
>gnl|bykdb|A0A2E0R7L7 [Bacteria] Bacterial tyrosine kinase [Kiritimatiellaeota][Kiritimatiellaceae bacterium] (length=696 residues).
MNNKADQETSSVHFLDYWRVISSRKELILAIAFLVVLTGTVYTXLLPSIYASSSRIMVSEDTPEINPFASQQNYMMYNPY
FLRTQFEILTSKPILNEVIHRLNLQNEWGKDGKVLTRDVALKILRNSVSVFQQRDTSLIVINVKRDNPNEAADIANEIAQ
VYRDSRLDLASKNARGAIDKIEESLTEQRQRVASAEENIQKIREDLNIAVVGGEGQFDVGEVRMQQLEGDRLFAQREMVE
KEGLLRILEDLNDKDLLERASYITFDQFVMNTIQQIQDIEVNLSSVQADYGNNHPEVKRLRSQIVTLEETLKKRLTALRN
GLDTEYIIAKNNFESLDKVLASVRTDTIESQGAKFRPYRNALADLETERFIYNQLMAKHRQEIITLQIPRNPVDIIDVAE
PNMQPVSPNLFLNVLMSIFVGLGAGVGLAYFIEYLDTSVKNADDIENQLQLKVLGLVPQKVRPLIEEGPDSENAESYRVM
KTNLSFTAKENVGMAYCVLSSGAGEGKSTTVFNLAYVAAQQGSKVLLVDADLRRPVQHTILGMSNRFGLTNVLLRDVPVE
EAVKATSIPNLQFLPSGRLPRASLGVLDPKKISELVNSLKSKYDIVLIDTPPIVGISDANIIAKEVDSSILVVQYRKYPL
NMLRKAVSTLQAQSIEIAGAVLNNINVMHDDYYYYYHGYYSDYYHRDDDEAEADLI
>gnl|bykdb|A0A2E0R8R5 [Bacteria] Bacterial tyrosine kinase [Kiritimatiellaeota][Kiritimatiellaceae bacterium] (length=740 residues).
MEHVDMQANESSQKTPSLEDEGIDLVELFGVLFARKILIISITLIFAIGALLYVIFATPIYKATAMVQVEESGPSMPGFD
DMAGMFEETSKSVTEIELLKSRRVIGEAVDALKLDIVAKPNLFPAVGGKFYRDHKPATDGALASAKLGAITYAWGGEQIE
VFRLELPGYLMNEPLTLRVEENNQITLQHKKSILLQGTVGQDLVANGVALSVRDLSARPGTEFTLMRQDRFQTILKLQQG
IGASEKGKDSGIILLSYQSENPQLAKEILDQIAEIYVRQNVERNSAEAQKSLDFLKVQLPEVKKQLEEAEQKFNDYQIRQ
KSVDISLETQGVLEQIVELETKLQELELRRLEMSRRFKREHPLYQGVVEQIKLVKEQKDVLTTRVTDLPETQQELLRYTR
DVQVSSEIYTMLLGKAQELDIMRAGTVGNVRIVDHAAVDLQHPIKPRKSLLVVLITLLGFGLACAYVLIVRAIHRGLEDP
SEVEAIGMPVYATIPQSDKLLKNSKSKADKGKRTSRDLLAVDHPTDLSVEALRGLRTSLHFAMLDAKNNVIVISGPSPGI
GKSFVSTNLGAVIAQGGKKVLLIDGDMRRGDLQDHLGMSFDAGLTGYLSGQYALEEVVRTTVVEGLDIIPRGIVAPNPSE
LLMHPRFSELINYASENYDLVIVDTPPVLAVTDPVIIASHAGATLLVARYGITHKKELEISQQRFEQNGVSVQGIVFNAV
QKRGGKYGSYGYNNYEYGNE
>gnl|bykdb|A0A2E1U172 [Bacteria] Bacterial tyrosine kinase [Kiritimatiellaeota][Kiritimatiellaceae bacterium] (length=698 residues).
MNDQSEQQGSTLHFLDYWRVISSRKELVLAVAFLVVLTGTVYTLLLPNIYASSARISVSEDSPEINPFAVQQNYMTPYNP
YFLKTQFEILTSKPILNEVINRLSLQVEWGKNGETLSRDVALKILKNSVSVFQQRDTSLIVINVKRDNPNEAADIANEIA
EVYRDSRLDLASKDARTAIDKIEESLSEQRQRVADAEENIQQIREDLNIAVVGGEGQFDVGEVRMQQLEGDRLFAQREMV
EKEGLLKILENLNDKDLLERASYITFDQSVMNTIQQIQDVEVQLSSVQADYGDNHPEVKRLKSQIATLEGTLTRRLNGLR
NGLETEYVIAKNNFESLDKVLASVRTDTIESQGTKFRPYRNALADLETERFIYNQLMSKHRQEIITLQVPRNPVDVIDIA
EPNARPVSPNLFLNVLLSIFVGLGAGVGLAYFIEYLDRSIKSADDIENQLKLKVLGLVPQKVRPLIEEGPDSENAESYRV
MKTNLAFMSDSDEGVAHCVLSSGAGEGKSTTIFNLAYVAAQQGQRVLLVDADLRRPVQHTILGMSNRFGLTNVLLRDVPV
EEAIKATSVPNLQFLPSGRLPRASLGVLDPKKIRELIQSLKLKYDLVLIDTPPVVGISDSSIIAKEVDSSVLVIQYRKYP
IDMLRKALASLQAQSINVAGAVLNNINVMRDDYYYYYHSYYSDYYQQNDDDQAEAKTI
>gnl|bykdb|A0A2E1U4L9 [Bacteria] Bacterial tyrosine kinase [Kiritimatiellaeota][Kiritimatiellaceae bacterium] (length=697 residues).
MNNEANQQPSSLHFLDYWRVISSRKELILAVAFLVVLTGTVYTLLLPNIYASSSRILVSEDSPEINPFAVQQNYMSTYNP
YFLRTQFEILTSKPILNEVIYRLNLQSEWGKNNEILKRDIALKILKNSISVFQQRDTSLIVINVKRDNPDEAADIANEIA
QVYRDSRLELASKSAREAIDKIEESLTEQRQRVANAEENIQKIREDLNIAVVGGEGQFDVGEVRMQQLEGDRLFAQREMV
EKEGLLRILEDLNDKDLLERASYITFDQFVMNTIQQIQDIEVNLSSVQADYGDNHPEVKRLKSQIVTLEETLKKRLSALR
NGLDTEYIIAKNNFESLDKVLASVRTDTIESQGAKFRPYRNALADLETERFIYNQLMSKHRQEIITLQVPQNPVDIIDVA
EPNMQPVSPNLFLNVLLSIFVGLGAGVGLAYFIEYLDTSVKSADDLENQLKLKVLGLVPQKVRPLIEEGPDSENAESYRV
MKTNLSFIANENEGMAHCVLSSGAGEGKSTTVFNLAYVAAQQGVKVLLVDADLRRPVQHTILGMSNRFGLTNVLLRDVPV
EEAIKATSIPNLQFLPSGRLPRASLGVLDPRKIRELVQSLKSKYDLVFIDTPPIVGMSDANIIAKEVDSSILVVQYRKYP
LNMIRKAVETLQAQSIDIAGAVLNNINVMRDDYYYYYQSYYSDYYQRDDDDAEADLI
>gnl|bykdb|A0A2E3TL68 [Bacteria] Bacterial tyrosine kinase [Kiritimatiellaeota][Kiritimatiellaceae bacterium] (length=695 residues).
MIEENNENKNNPHFLDYWRVLRSRKELILAITFIVVLTGTIYTLLLPNVFSSSSRISVSEDKPEINPFQAELMYERYDPY
YLKTQFEILQSKPILNEVIYRLNLQEKWGKDGSLSREVAYKILKNSLSIFQQRDTSLIVINVKRNNPNEAAEIANEIAQV
YRDSRIELVTKNTRNALDKIDESISQQRIRVDEAEENIQKIREELDIAVVGGEGQFDVGEVRMQTLERDRLAAQREMVEK
KGLLDILNNIGDEDLAEQASFITFDQFVVDIVRSMELLEVELSALDADFGKNHPEVKRLVFQKNSLEKNLKQRLDALRNG
LQTEYSIAKSKFDGLDQVLKSVRSDSIETQGAKYRPYRNALADLETERFIYNQLLAKHRQEIITMQLPRNPVNIIDVAEA
NLRPVSPNLFINVLISIFAGLGAGIGLAYFIEYLDTSVKTVEDVENKLKLKVLGLVPQKVRPLIEEGPDSENAESYRVLK
TNLDFSSNHEVGGAYSVISAGAGEGKSTTVFNLAYVAAQQGMKVLLMDADLRRPVQHIILGMSNRFGLTNVLLRDVPAEE
AIKATSIPNLQFLPSGRLPRASLGVLDPKKIRELINSLKSKYDLVLIDTPPVVGLSDASIIGKETDGSILVVQYRKYPLD
MINKAKLSLIAQDIDITGVVMNNINITRDDYYYYYHTYYSDYYGSSDEETQEGSI
© 1998-2019