BYKdb

Dataset for cluster orphancd of phylum lentisphaerae

[Download (right click)] [Alignment] [Repertoires]

8 sequence(s)

>gnl|bykdb|A0A1G1AKK0 [Bacteria] Bacterial tyrosine kinase [Lentisphaerae][Lentisphaerae bacterium RIFOXYA12_FULL_48_11] (length=774 residues).
MSTESEQRGIDFRVYIGIIFFRWQIIAVCFLYCLLGGVLYLSLAPKEYLASSKVMVYRDPLLEMSGNIAGAERTSLTMHT
FLLQDDKFRERAARQLAEKWGDKMGNFQKMILPVTVARERGFGSMLNISVKSADPGYGVEFLKVLLTVHSNEWRAIQMEA
SESATRKLTEELSRLEEKIKQSEDDVVEYKRLNDVARVEGRASTELRYLQALMERRSQISTELMLLEAEFPALKGMNPGI
ISDVVNLTRETGAIEPIRETSEESRRDGREVGNKDNEVQKSELPAALRNGKADNTKADDAHGWRDLRVKLFRLQQKEKEL
AANLKPEHPELKRVRDEIADIKNQLDAAAEIELGRLKDRYDALKIHLNTVEAAEYKWKAQNLLASTRQSELKRIMDVVER
FESNYKTLYTRLQDMKIQEELKAEHFYVVEAPGLRSDYVWPDPIKVLILALVLGLGSGFGLALVMQVMDNRIQSISDVEK
DLGVKFLGGVPYWVHSGLEKTIRPIVTEEHSTGAIEAYRALRTTILSELVKRNEKIVMVTSADSREGKTLTALNLAIMIA
QMEKKVLLVDMDLRRGRLHRSLGLEREPGVTDVLKEGRSLKEVIMKTRIANLNLAPTGTTVEDSAEMLQSASVVDMFVGV
QDDYDYIVVDTSPILRVTDTVILVTQGIGVVLYVARVNHTPKPMVRYSLDMLKDARVLGLVMNSIEMHKISSLYYAYQYP
NYAYYSNAYAYGYDYYYYGDRHTAGRRQGHRRSEWDRRRNAFGQWVRRTFMPME
>gnl|bykdb|A0A1G1C9Z9 [Bacteria] Bacterial tyrosine kinase [Lentisphaerae][Lentisphaerae bacterium RIFOXYB12_FULL_65_16] (length=723 residues).
MTNNPNTDTVAVQGDWSAGAAGGDGEGLLTYIRPLLMYWWIIAPLAIVGGAGALAYSYTLQPLYRASCRFEIFENEMMRI
GEQPGLRDAAFYYMNANPIDRHVVLLTSGNLDARVRTRLAKTWPGEVKMSRPVLLSVVPVKKAPQVMVDISADSYDARYS
EAYVTALVEEYRDSQREEMGLIHEETVKNLRIELAKLAADLKMERAEVAKFEAEHNVQFEAEKSESELAHMRDVLRKARS
IQTQRMIIESQLKLLTNANAATMRDVLDLTMYTTAAAAADDKGGPEWTDVSDWQKNEAELIRLNADYGQMRTVLKPGHPR
LAELQEKIAKAQREQQISAELTLKRLEARRDALRMQGEALDSAAAKIESGMNLTGADKAKYENLKSTADHLKSLHDKVFT
RIIDSSSTPTERYFSRIVEGPVSSSTPVYPVKSRLALIGMVIAGGIGMAIAFLLYYRYVRLYDLTLLETQFGLPSMGCVP
LITDETQKSDPRQLNKLSKAAPLCEAYRMIRTAAEEKLGEGKVLLFTSSEQSEGKTFTSAYTAVACTWTKTKVLLVDGDF
RRPSQRKLFSLPDSKGLAECLSDSSLDWRDLLVREVVPRLDLLQTGHADGHGAELIQLESAERLFKEFRDEYDLIIIDTA
PINPVVDTLLLAKHADGVILVVQPGKTSMTSIQRALRRLGDAPLLGYVANRITASTEKYYYDSKYGYYGHAYHYQPEKSD
QPS
>gnl|bykdb|A0A1V5GU03 [Bacteria] Bacterial tyrosine kinase [Lentisphaerae][Lentisphaerae bacterium ADurb.BinA184] (length=286 residues).
MDRDKPNAASEAYRSLRTSLERFIADKKGYSLLLTSADAGEGKSCTTANLGIAFSWTGKRVLLIDADLRRPNLHTALGEK
NAAKGLTQFFLGEVTDWREIVRPTAYENVDFIPAGRFVYEATELCSASVLRRLMQSWAEQYDLIILDSAPVGRIVDTAMI
ARGCDGVLLVSLHGKSSVPAIRHALRRLEGCNVLGFCLNAIDMPRGHGYYYGGSYGYKWRYGLYSYYYYYSNSLYGYGYD
DYYATKDAETAKKKATAGEPAEETKEAKEGEAVEEGKREEETEEKA
>gnl|bykdb|A0A1V5V8D4 [Bacteria] Bacterial tyrosine kinase [Lentisphaerae][Lentisphaerae bacterium ADurb.Bin242] (length=507 residues).
MNQMVESQEKSNSLEDFFCLTNILDTTLRYWKIWVFAAFFGLAFSFIVTKYFTPPVFMAKTTIYAGITNKASIQDGSEKE
ISISQYSQSIMMNSLLVNDYKMLLVSDRVQDKVREKMAEKFPSPEGKAPWFSVDAQYHRNTRIITILAYAHTAFQAQCAA
NITGEIFSQTVQDVLRLDNVKIIDPAKLPFQRHRPLLRLNLVLGFLSGLFLGWLAAFFLAFLDQTIKNPDQVESYLHQPQ
MGTIPWLVDQEKNNALYKCLEEHSNYDFVEALRLIRANLPYIVPLREASANAHSCRVFLITSTLSGEGKSGCTSSIAVLT
AKTGKKVLLLDADLRKSTVERIFDLSPKVGLAQILAGETTLEQSILKGIVEPTFDVLPCGPIPPNPAELLVSESFGTILK
KLREEYDYIFIDSPPALFLADPLSIAHYADAILFIVACHMAKIGLIRKTIRQISRVSSIPLSIIVNRFNRNDISCKYRYS
RYGSYGGYGGYKYAYRASSKDSSTHSN
>gnl|bykdb|A0A1V6FKM9 [Bacteria] Bacterial tyrosine kinase [Lentisphaerae][Lentisphaerae bacterium ADurb.Bin082] (length=694 residues).
MRLLLGYYNTYVRQYFWLYPTAILLFAAAAFIYLRTQVPLYRSTCQLHVSNADLRVTELRGIVDPYNAAGASFINTQIRL
MQSPEILNRAYELTGGLEGDSSKCSEPEIAQVPNTTLVNLSITSPYPEAAAKLANTIAEVYMTSVLQRRVSISITGVDLL
RDQLDDLQKSRDKAMAELLKFKEQHGIFDLEQTYTTLLSQLTELNKHCIEAEIQDVELTATLQTIEEHRADAVILMPFLL
PEGATNLGSLKSLYLSHEMRLPELLTQYNEAHQAVQTHRKVGDMIIAAEEKEIDISIQGLELRRKRSQQRVIRLNAQIAE
IRERLNSLDRIGGDYKIREAACAALDDTCRMLVNRINEIKIADATTKIENYAIFIVEPAISASQPFYPVPKKVFSTALVL
ALALAGGIAFILVSVNNKVTHIEMVSAQFGNTLANFGSVPLFTEDEHQLLKSSGEDPIDEAFRDIRTSLNLSALTRSSRV
LAISSATPSEGKTFIAANLARSFARDKKRTLLIDMDLRKPQLHKLLQDFLPPDSGKRGISNVLVGDCALSDIVIPIKELG
LDAALAGPIPPNPNELLGGGGLKKLLKDAQEKYDLVIIDTAPLLVVSDTLIIASHGVPIILATRLYTVTKPIIRHLSERL
KQVNISLAGLIANNADVPKNAYYSYKDGYGYGYGHGHGYGYGYGYGKTKERQKR
>gnl|bykdb|A0A348XG41 [Bacteria] Bacterial tyrosine kinase [Lentisphaerae][Lentisphaeria bacterium] (length=722 residues).
MEQKRNGVSLVDLQSYLAMGLRHFRLMVLLMCLALAAGLAYYIFKRPVFHARSLVQVEYEHRPFTDDDLWSDAEMEYVLR
QLNSPHILERALAEFGIEASYSTIRSKYIKQMRSETNSEGNIVVRVWATSPELANNAVSTAIDVFYRYRSEKRKLQRKQQ
ILVYTEEMGRMLRDMTEFNDRMRAFVMSSRLPEVEASMERLKQVPEQLQQVRTRLAMLERAQSELRKENKTVAERLSIIA
TLDVGRTLKPGEGISSLGDGEEDGVLEVDNDVIVTPWMSQSRITGWEEDHKALEELAVKREELLTQNYLALHPKIAALDN
EIKELREGLEGMLNGASDQLEWEISKLEAHRTDLEKKIPMNRAAMNNYEAIMWEFEQLGVTEFPWKEKYLEMARKIAELE
YAAETPFATRLEYMGILDRSRHAVSPNRGKLLVMSLGMGLALCVAFVFVIEYLDHTISRVDKAEQVLSMRGLGIVPQLPS
SLTDVNEIPLLTDGESEFGRARSSVRETFRVIRANIMESRDFEGDRQVIMVTSSIPKEGKSLVSSNLALSFASVGEKTLL
IDADIRRRSLSRTFNRGSGRGLSDVLKNYTTLDDACVLTDHDYLHLLAAGTLTSQAPELLAGANFTQLMQELRQRYQRII
LDTPPILGLSEACEVLRCVDGVVLVIWSAYTPMHQVKDSTALMRANGARFFGFVLNRLDLSGAKNYYQYYYYSDYYYRSY
SS
>gnl|bykdb|A6DFD0 [Bacteria] Bacterial tyrosine kinase [Lentisphaerae][Lentisphaera araneosa HTCC2155] (length=708 residues).
MNQQINENEFSQDIEFLQYLKVLLHYWWIISPISLIGAGAMMAYSMTLPKKYRAECRFEIFENQAIQVAERIKDDYWEED
PMEKHMLMLRSSKLNTPIRNSVLEKFPKLKQINLTSFQLNLNPVKGAQYDLIDISVDSHNKEASLEYLKQLIPAYENLRV
NTNSGEVEASREQLEQKIQSLDKQIDDVEKEIIEFKTRHNFVFVSTKTEFDQKYISNLLEKANKNQFILDILKPELIRLD
KETSLASEVFDQIIEIVGHGNNRLSIGQTGLEQDIQQWKDHKLSRFRIEAQLKIMLKKYKLSHPKVIAVTDELEIIEVEQ
EVFRKNILSGLRGKVKTLEAQNRNYLLRADRIEDTFGQNANVISTLEGFVNKQQRLNDLRASLHETLVSISSSGGDKYFT
RMLREPFLYDGPVSPQQSKYIIKGFVVCFGISSALILFNFFLKIKRYNFSRISRENHLPCLATIPHFPAKFAKQNPFFLN
EISKSSVLAESYRSLRLFMDKNMDGKIVLFTSSGPSEGKTCTSLNTALCSSWTDKKVLLIDGDFRRVTLRKIFPNKSKEG
LMDYLKNDTMNIEKYIIKKPVGDLDYLPAGTSDEYVTELIDGKKIKELFSELKNKYDLIIIDSAPAIRVIDTVHLAEVAD
STVIVVRAGKTLAPNVSATVKRLPKEKLLGFVVNGFRSQDTKYTGTVHSPNGYGYTYGYKGYNYKKEY
>gnl|bykdb|A6DSE4 [Bacteria] Bacterial tyrosine kinase [Lentisphaerae][Lentisphaera araneosa HTCC2155] (length=716 residues).
MKQNHSDEIEKEIDLLSYFLVVLRYWWIIAPITALGGVAAYFLAQALPPKFEADCRFEIIQNKVSQLSEDVDDKALNAVK
SRKYSLLDRHIVLLKSEKLNKSVEKVILNNFPDLRELKLLKKKIFEVEITPVKGAAQSMLDISIVSPDVSASKEYLLKLL
GEYAKMRVEENRLTTETTRLALENEEKSIDTKIKKQSDFILDYKIDNNYVFMSTKNEFDKEYISELFSKSNQKKLQLGVL
EANIDELELSNMEDSKFSSVIDALMSIQGDQKSEFVFKDVSEWKSRQVILGSYIAEYDILLEKFKPGHPNMEELQKKIDI
ITKEIQAYRKNIVRLIKSRVETLKVEYKSYIARAIELEKTFANSGVLINEIESLEGRLDQLNELKSNIRSKLILLNENVD
DKYITRIIREPFAEENPVFPSIPKFTLAGALLFNLASSFLVIILFYGKSKRYNFAKVINDYQAPILSVIPKFASSLAKKN
PQFLNELPKNSVLAESYRSLRLNIEQKSSGKLIMFTSFGPAEGKTTTSLNTALCCAWTDKKILLIDADFRRSTLRKSFPE
MPHKGLLDFLKSDDHDIEDYIISKASGKMDYLPAGNNDEYVTELLDGKKMETLLTHLRNTYDLVIFDTAPAVRVVDTVHL
AEKTDGTIIVARMGRTYPKDVEATLNRLPKDKVVGIVMNDFKQSDLKFTSQSENNAYGSNAYAYSYNSYSTYKDSY
© 1998-2019