BYKdb

Dataset for cluster cd of phylum metagenomes

[Download (right click)]

1 sequence(s)

>gnl|bykdb|E6PYQ3 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][mine drainage metagenome] (length=294 residues).
MSSVAIQSRRSSRLKSLYLCLSLPQFQSIGMSWHPDHPAKNGIALITLLAPRSASAEAYRLLRTSISLMPVSQKHRVIAL
TSGGPGEGKSTTTLNLAVVLATQSKRVLLIDADLRKPTIAQRLKMSATDQPGLSRYLSDSSVLPEDCVQRVTEIPGLDVM
PVQEIPPFPSELLSQGRLEELLVWARDHYDYVLIDTPPILLVTDALIIANYCDTLLVVARIGVAQRKGLFRIRHDLAKYP
SKQTGIVVNALPFSDTYYSGYGNYRKYYGTGYGKESGDYYSSGYISPAKKKKQQ
© 1998-2019