BYKdb

Dataset for cluster orphancd of phylum metagenomes

[Download (right click)] [Alignment] [Repertoires]

104 sequence(s)

>gnl|bykdb|A0A0F9BMP5 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][marine sediment metagenome] (length=197 residues).
AGQAIALTSACPREGKTMLTLSLAMALNAMKDQRAVILDCDLRRSRIAELLNLSQGVALDSILLGQTCPLDAVRVDERFG
LHVIPVVYRDAYSPDHLSRSAFAEIIRELKTRYDYVLVDTPPVLAVADTGLLASHCDQTYMVVRWRKTRHAQIRDVFERL
YDLDINVTGTILNFVNPKKEANYRGIPYASYNEYRHV
>gnl|bykdb|A0A0F9C030 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][marine sediment metagenome] (length=504 residues).
QQHAFAMVDTIGREVLLRQLGLKTADPYASSRINQQLIDDRGKLQAKLLLYGSAHQEVRTLQQRISLAEHFLQNQRFQDA
EQARQIIQQELGPALFDMARQQCDEAVASERAISAAYEEEKQAAVSLYGTLAELQIIERDLEHLHAFHETLLDRVKDLNL
GQDKGIIRTSILTPPKTPGGPVWPNLSMIAMFSIAIGFGMGLGIVYIQDLLDDHFRSPEELRIQLGLPVLAMVGKLEPQT
NVGVDALHVHVQPNAVESEAFRTLRTALALAEGGSQRLVVSSSEPGDGKTTVISNLAVAYAQSGKRTLLIDADMRRPGLT
PMLDLKGQKGLSTILRAGLPVVQSAEANLCSSLLENLDVIPSGPRPINPTELLVGDRFSELLCWAESRYDQILVDSPPAL
VSDTAIIGRLVDGVLLTVQPHKNRRRTVIRAAESFSNLGINVLGIVINRLATEKSDDYYGYGYGYGYGYGSGYGYGHDDE
PQSDAGLSEGSTDDMPMEIVRRVA
>gnl|bykdb|A0A0F9CMN4 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][marine sediment metagenome] (length=217 residues).
DIDNPPKSLVITSAVPLEGKSTTALNLAVALAQKESKVLLIDADLRKPIIHKLLHLDNSTGLVDALLNGGHPGASVKQSK
NIDNLWVLTSGSVPSNPSELLGSSGMKALMEQVTKEYDYVVFDTPPLISVSDGAILASQADGILMVVSPGKVKGEIGRHT
KELLERIGTPVLGCVFNGVELSHRNYYYYYNYYRYYAGSAGEKKVGKREKKESNVLD
>gnl|bykdb|A0A0F9G9C6 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][marine sediment metagenome] (length=515 residues).
NTILDLQAAIGASEKGKDSGIINLSLQSEKPHYAEKVLDKVAGIYVRRNVERNSAEAQKSLEFLEVQLPEIKKQLEFAEQ
RFNDYQIQRQSINITLETQGVLEQVVKLETKLQELELKRLELGRKFKKDHPTYQGIIEQIAAVNEQKKALVGEVGNLPET
QQELLRLRRDVEVSNQIYTLLLSKTQELDIVRAGTVGNVRIIDYAEVNTSKPVKPKKALIVVMTTMLGGMLAVAIVLVQK
AMHKGVEDPNEIEAIGLPVYASVPYSDYQDKLTGFSKALKNKVSKPKSILALDNPADLSIEALRSLRTSLHFAMMEAKNN
LIAISGPSPGVGKSFVSVNLAAVLAQSGKKVLIIDADMRKGYLQTQFGLKWDDGLSDYLSGQLNLEQVIKPTAVDGLSVI
TRGQIPPNPSELLMHSNFSKLVAEVSAAYDIVIVDTPPILAVTDPAIVSAHTGTTLLVTRFGQNHIKEIELTRNRFEQNG
TDVKGVVFNGVIKKASNAYGYYGYYNYEYKSNEKS
>gnl|bykdb|A0A0F9HWF5 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][marine sediment metagenome] (length=592 residues).
IVITSFLKRFDVKPVRNTQIAVVSFNSKSPEMAARVANAAVQAYVDYTLTTKIKANVGASGVLRKNIQEQRKKIEESEKL
LFEYKEKFKIISLEEEKNITIQKLAAHSKNLVSAENVRIEAQSKYQVAVGMLVDGDLAGSIPEVMSNGFITKLKTDEAVL
REQLSEISRKYGSKHPKVIALNDKISTVRGMIDDEIFRVVDSMKSQYDVALRNELALKGELVRLKEESQSLGKHAVAYSV
LARDVYTNKEMYEVLLKRLKETSITGGMQTTNVRVLDEAIPPTIPFRPRRMLNILLAIVLGLFMGPVVAISFEYMDSSVK
TPEDIERYLRVPYLGPLPDFHGQESERAGGRSTMLVTSLDPKSVPAEAYRSIRTSIIFSSPDDKRTLLVTSSNPTEGKSV
TSSNLAVIMAQNGARTLLLDMDFRRPVLHKIFNVPQEKGFSNMLVGDAGVDDVITHTNVPNLDVIPSGHIPPNPAELLSS
DGIASFMDIFKSRYDRIVIDSPPILSATDPVIISTFVDEVLMVIKMGETSRELVQTAIGKLHHVKANLIGTVLNGVDTGQ
GNYYQYQYYGDRQPETEQGVFGRLRKPFLMRK
>gnl|bykdb|A0A0W8FVN7 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][hydrocarbon metagenome] (length=414 residues).
MNEQILVYKAGIFASNPAQIQQLTAKVLEEEVRYQSLLSSHKELDELVQRYEVRFNEMPKRTLDLARLQRIKEANEKLYL
LVEEKYQEAQINEQSTPGNVLIIDAARQPENPSKPNRILIIAVGLVLGLGFGFGFAFVRNYFDNTVKTPEELQQKNISLL
AWIPEMFVADKNRAPGSEFIVNKKSDSTASEAYRALRTRIRYSGVEGTIPKKLLVTSSSAGEGKTTTAVNLAGSFAQANQ
KVLLLDCDLRKPRVHKIFNDERYPGFIDYFFGQATFDELIRKTEQANLFYITGGTIPPNPAEILGSHKMEEFLAKLETHF
DLIVIDSPPIIAVTDSEILSQIVDGVMLVISAGVTEYDILYKSLDVLKMAKSQFLGAVLNKFAYRPGYGSYYKYYYYYYN
TGNGKEDKKKLLKV
>gnl|bykdb|A0A1J5SIM8 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][mine drainage metagenome] (length=279 residues).
MERIKQAILRAKNHQSSEANLAQLRPDGQGKSFKSNISKSQDELVDFRYENTRVVKLEKEHLEKNRIVAFDKSNPMSMNF
DLLRTHVLQKMEENGWRTLAITSPTPEAGKTVIAINLAMSIAQQTNRTAMLVDFDLRRPKVGAYLGMHMEKSLNDVLNGT
DQLPDVLVNPDVPRLVVLPTRNAVKNSSEILSSKKIGDLITDLRERYKSRIVIFDLPPLLVTDDAIALLPKIDCVLLVVA
NGMSTKREIEDSLRLLPAENLIGTILNKADVEPKAYYYD
>gnl|bykdb|A0A2H9T3X6 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][invertebrate metagenome] (length=616 residues).
MIGRAVARRFSPDAEAGELINTPWLWFSGYGWGGEALKIERFEMHSSLLDQPYTLVAGENGHYQLWLDDRMILTGKVGEA
AQSKDQQLRLFVSLLQARPGTRFNVTDQLLVSTVNQLSQRLSVSEKGKKTGVLSLSLTGPSRPENSRLLEAIIQRYVRQN
IERVSAEAQNSLKFLERQLPEMKKDVELAESKLHRFQQENQTVDLTMETQAVLDQAVTIDTQLAKLDMQIEQMSQRYTAN
HPVMEELQLQRQLIVDRQDKFSDQARGLPKTQQEVMRLARDVQVSTEVYTELLNKAQELKIVKASAVGNVRILDHALSGI
TPVKPKKPLIFVLAVLLGGMCGTGFVFLRDMLRQGVKTPEEIEAKTGLSVFATIPQSEQNLLLERNARKQGGGFMLAQSA
PDDLAVESLRSLRTNLSFTMMEGKDNRVMITGPSPGIGKSFVSANLALLLAESGEKVLLIDGDMRKGRLNHYFGVKRGDG
LSNILAGTAGYDAVREINKKCYLMTTGLLPPNPSELLMSHGFTELLENVSPLYDIVLVDTPPILAVTDAAIIGRKCGRTF
MVTRAEKNTASEISYAAKRLQQAKVNVKGCILNGMVYTSSCYGQYGYYHYKYGSES
>gnl|bykdb|A0A2P2C6F5 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][metagenome] (length=485 residues).
MTFGDFVRLTRAYVWVLIGCTVLGALLMMAKTTRDPVLYSATSSGLVVVGNATTAGEEQGNAALAEEKAGLYAFLVSSMP
VAEKVVDDLDLDVPPSEIAGRFSATVNADVNALTITAIGSTPEQARDLANGVVDAVVEYAQEVDTGESNPKRDPLTRVVP
VQPAQLPGAPFTPDYVKAAMKGAAGGLALAYAFLIARRLIDRRIRSVKHVEDATGAAVLGIIPKEDALGRTHRGVRGDLG
RAAESFRQLRTNLRFVDVDNEPRKIVVTSALAGEGKSTVSANIARLVAQAGTPVLLIDADLRRPQIATTFEIDGTVGLTQ
ALAGDVDVRDVIVGSGMANLSVLPAGRIPPNPSELLGSLRMKQFIDDLSQDHLVILDAPPLLPVTDAGLLSAFCDGALLV
QAAGRTQIEQSQQCRRILDQVGSRLLGVVLNKAPVKGASAIAYGGGYSGYGGYGGYRAEEATREAYSTAGKGRRRKLVKS
SSDKD
>gnl|bykdb|A0A380TAR7 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][metagenome] (length=631 residues).
MAERDEFTSSRSRSLLEIASRAAALGGKDETNPGSADRQALAAQAARAASLDEVVDEFLKHLDVRPTKASRVISVRFQSR
DAQLAADVANAVADTYTNRFIETKIAIAEKATGWLKGQVKALREAVARSEKAVEAFRTQSGLLRGSQVTLISEEISEINR
RLAAASADRAQATATLNEVQALQKASNIEAAQAIMESPVVQQLRIQEAAVLRELAELSIELGERHPRVINKKSELEKFRA
KIEAEMERVLKGYATAVSVATAREDSLERELNKLKSKQALANSREIELRELEREAEANRKLLETFLTRLKETTPQLDTEM
QVPGATVLSPAAVPLRSLPDKRIVLAVATIIALLLGLGLALMAERLDYGFRHAEQVSEATGLPVIAHLPVARSGRDGPEA
AMLDSQPSLFLEGIRSTYIQLALRSKRPAIRSLLVTSSMPKEGKTTLAIGLTRARAIAGHRALLIDADLRRPSVHVRLKL
AREPGLVDLLVGDASLEQVLQRDEPTGAFVIASGSAARDPSDLLGSKAVKAFLDQACESFDLVVLDSSPLMSVSDACNLA
PLAEETVFVIQWGKTGREVVKLALEKLTETQGVPRGIVLSRVDTAKIRLYGYGDAAYYDRTVREYYTRGSA
>gnl|bykdb|A0A382GX28 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][marine metagenome] (length=252 residues).
SPHAEAYRVLRTNILFAGRKDESQTTFSVVSGGAGEGKTTTMFNLAVVFAQMGDRILIVDSDLRRPSMHRYMNVSNNIGL
TNYLLGQVTIDEVIQTTELPSLHFIPSGKLPSSSMGILSSAKMKEFVTEMKSRYDYVFLDAPPIMGVSDASVLASMVDMC
VLVVQYRKYPQMMTQRAKEMVTKVGGELVGVVLNNINISQDSYYYYYSGYYYDNYYKSREKEGSAEDDTKSRKKTKLLAS
AKTGEEDEKPKY
>gnl|bykdb|A0A382PKY1 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][marine metagenome] (length=269 residues).
NLSVLGIIPSIGNPDKKRRRWLMAKNRSTSNTRGLRRRLITKEDPKSPVSEAYRSLRTSMLYSTSAKELKSILVSSAGPG
EGKTTTVANLAITYANLGRKTLLVDTDLRRPVVHKVFDLDREPGVTTYLSSATDDYASLIQTCEISNLSIITAGIIPPNP
SELLGSKRMTELVKQLENDWDMVLFDSPPMIAVTDATMISKEIDQVVLIVKVGQTDKKAFHHTINNLRNINAPLGGIIMN
AVTSKSSYGSYYYYYYQYYHYYGSEKESD
>gnl|bykdb|A0A3B0VF49 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][hydrothermal vent metagenome] (length=214 residues).
MDLVTITDPRSPRSEAYRTLRTNLSFYSLDTPLQTLVVTSPVMGEGKSSTVANLAVTMAQSGRKIVLVDCDLRRPSLHTL
FNLKAEPGFTDAILENGEPALQETAVENLWLLTAGTKPPNPADILGTPQVDQLIATLQEKADIILFDAPPVNVVTDAAVL
GAKVDGVLLVLSAGKTRREHAERAKEILKKARVNIIGATLTNAPTDSSMEAYYG
>gnl|bykdb|A0A3B0VG16 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][hydrothermal vent metagenome] (length=290 residues).
MGKVSRALDKAGAPIKPDENSFIPADVTPGSRDAVVERKKVPGGTKTSPSPAPTVNTFEGWDERLVAASRNFSGVVESFR
KLRTRILYPVEGDVPRSILIISADAQEGKSFICANLGLSLAHSVAQHALMIDCDLRRPSLAGIFGLDNSRGLVDYLRGEE
DFARLVYETGLPDLSIMPAGLPPDNPAELIGSERMAGLLNEAVNGYVDGFVLLDCPPFQAVSESAVLAQLVDKVVLVVRW
GRAGRENVKKLVEQIGRDKIIGIVFNSFEMNILDRKMQDVGYHNYYSERY
>gnl|bykdb|A0A3B0VRL8 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][hydrothermal vent metagenome] (length=282 residues).
MGKVFKALNKAMSNPDDSASPPASTPEPSIKTERQPTPAKRETPTVSVTGSMDNTSGVNNWDEKLVAFSAPSSIITENIR
HLRNRILHPPSGGPALRRVMTTSALPGEGKSMLCSNLAISMAQGLEQHALLVDCDLRRSSLAQMLAVNNSQGLSNYLQHD
RELGEVIRQTGLPKLSLLPSGPRPMNPAELLDSKRVGEMFDELSNRYDDRFIIIDTPPLPMAAETTVLAEQVDGIIIVVR
WGRAAREQVKQMTENLNKDKIIGVLYNAFEKYILRAKLTCYE
>gnl|bykdb|A0A3B0Z1H7 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][hydrothermal vent metagenome] (length=257 residues).
MSDQKVDVIPARRMPEDDLSGVRYKQTKPIKISKSQLKENRIISGMDLGVEMDAYRKLRTRVLKKMKKNNWNVLAVTSPA
PGAGKTLTAINLAISIAMEVDKTVLLIDADLRQSRVNKYFGLPETMLGLSDYLTSDISLERLLINPGIGRLIILPGGKLM
HHSSEILSSPKMKRLVEEVKSRYESRYVIFDLPPMLASDDAMGFAPLVDATLLVVEDGVANIDELKSSIELLEDANLIGT
VLNKSREPVKDYYYGKY
>gnl|bykdb|A0A3B1CXE3 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][hydrothermal vent metagenome] (length=280 residues).
MSRIERAMEKAAKIRISAERSPSVDKPPAIHRDQPCLEGIETVIDKAMTDKCIVTLAEPQSPAAEQYRKLRARILKAIAT
KDDSGNTIMITSSDKREGKTITAINLAVAMANVIDYPVVLVDADLRNPFVHRYLGIEPEYGLSDYLTGKVILSDILLRTG
IGELIILPGGLPPENPAELLSSERMKTLVNELKIRHGGGYVIFDSSPVLLTSDPLSLGSLMDGVIFIIHAALTSEKSAAQ
AISLIKGCNILGIVFNDVQNYPAKDPYPYYSADEAQSGQG
>gnl|bykdb|A0A3B1CYP8 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][hydrothermal vent metagenome] (length=293 residues).
MSRIERAMEKAARIRGSAERSPAVDSPAAPVIHRDQPCFECECIEAVIDRALADKHIVTLTEPQSPAAEQYRKLRARILK
AAETKDDSINTIMITSSDKKEGKTITAINLAVAMAKVINYPVVLVDADLRNPFVHKYLGIEPEYGLSDYLTGRASLSDIL
LRTGIGELMLLPGGFPPENPAELLSSERMKNLVNELKIRHRGGYVIFDSSPVLLTSDPLSLGSLMDGVLFIIHAALTSEK
SASQAISLIKGCNILGIVFNEVQNYPAKDPYPYNFPEDKDAGRIAGKTKTQGA
>gnl|bykdb|A0A3B1D1Y9 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][hydrothermal vent metagenome] (length=270 residues).
MSRIEEILEKAARMREGEKNGEKSRKISPPGSKVPGVVRQARIENPNLVTIVDPDSPTAEEYRKLKSMVVKLTEMDDFRN
MLMVTSAIGGEGKSVTSLNLAITLAQEYDHTVLLVDADLRQPSLNDYLGIHSEIGLTDCLVDGVGIGSALIKTGIGGLVF
LPSGRKVSNPGELLSSNRMKEIVKELKHRYPDRYVIFDAPPVLPFAEVLSVGALLDGIIFVVREGVTPEDNMKDAVTMLK
DNNILGVVYNAAETVPLSDYYNYSHYYQNR
>gnl|bykdb|A0A3B1DET2 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][hydrothermal vent metagenome] (length=261 residues).
MGKITSALKKAAEERINRIDKITKIQERDQMVIKKIGESNVDPRIVTYFDPKALITEQYKILRTNILSLNKSKPPKTIVI
TSSLHSEGKTITSLNLAVALSQAIHKPKVLLVDADMRKGRIERYLGVDQKEGLSDILSGQKNIEDVVFHLDTENLTFISS
GEVPENPAELLSSNKMKQFLSQTRAQFDFVIIDTPPIIAVTDSGIIGAQADGIIMVVQAGRTQRGIVRRAQELLYQSHSK
VLGQVLTNIEYHLPEYIYRYL
>gnl|bykdb|A0A3B1DSI5 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][hydrothermal vent metagenome] (length=343 residues).
QVSPNFTRMMTIGGLLGFLVGAGFAFLRETFDKRFSAPEDIQQQLGVPVIGHVPNISIKRRKKNALSQLDPSVCTFHLPK
SKASEAFRAVRTSLYFSTHNANHQVLQVTSPNPGDGKSTLASNLAVSIACSGKQVLILDCDFRKPRIHEIFGLPNDVGLA
TTITEGIDGEPLAYVQNTEIPNLWCMTCGKLPPNPSELLSSSIFEQFLEVAREKYDYVIVDTPPLLAVTDPSTVAARVDA
VLITLKLKKNSRTMATRAREMLTAVNANLIGIVVNGAGHLEHYSYGYTGYGSSSYEQGYYGYDYAYSVKNDHNTTQPLPV
MYDSQKKGHLQEALYQNENNDDV
>gnl|bykdb|A0A3R1GI32 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=263 residues).
MLEEHGINVYASIPLSEWQKSRDSVKTVHGVKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQANNNVLMLTGVSPS
IGKTFVCANLAAVVSQTNKRVLLIDCDMRKGYTHELLGTNNVNGLSDILLGKGEISQCAKPTSITNFDLVSRGQVPPNPS
ELLMSERFSQLVEWASKHYDLVLIDTPPILAVTDAAIVGRHAGTTLMVARYAVNTLKEVETSLSRFEQNGIAVKGVILNS
IFRRASGYQDYGYYEYEYKSDSK
>gnl|bykdb|A0A3R1GW93 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=259 residues).
MYASIPFSTLQKGEESKTLRSGRGRANKAAPILASTHPTDLAIEGLRSLRTSLHFAMLEASNNRLMISGPSPKVGKTFVS
ANLAAVIAQTGQRVLLIDVDMRKGYLHKVFGTPAENGLSDLLVKRCDLATAINKTEFEHLDVIGRGQIPPNPSELLMHAN
FSAFLEQVSAQYDLVILDTPPLLAVTDAAIVGRQSGTSLIVTRFALNPVREIELTMRRFAQNGVDLKGAIFNGVEKRASA
KYGYADYGYYNYEYKSENV
>gnl|bykdb|A0A3R1HJ57 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=536 residues).
MNVSAIKAQVGDTFTVTKYSTLGMINQLQGNLVVAENGKDTGVLSLSYTGEDRDKIRDILDSITRNYLEQNVQRKSEEAA
KSLKFLAEQLPEVRTRLDAAENKLNAYRQQQDSVDLSLEAKSVLDTMVNIDAQLNELTFKEAEISKLYTKVHPAYRTLLE
KRKTLEDEKARLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITEASTVGDVRIVDAAIAQPGMVKPQRAL
IILGSIILGLMLSIMGVLLRSLFNRGIESPAVLEEAGIGVYASIPLSEWQKSRDNATVRGVKAAKRNKQSQLLAVGNPTD
LAIEAIRSLRTSLHFAMMQASNNVLMLTGVSPSIGKTFVCANLAAVISQTNKRVLLIDCDMRKGYTHELLGTTNNNGLAE
VLTGQAEITRCAQKTSVPNFDLIPRGVVPSNPSELLMSERFAELIAWASKNYDLVLIDTPPILAVTDAAVVGRHAGTTLM
VARYAVNTLKEVETSLSRFEQNGINVRGVILNSIFRRAAGYEDYGYYEYEYKSDAK
>gnl|bykdb|A0A3R1QQP6 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=193 residues).
MPSEGKSTISINLAQLLAGQGSRVLLLDADIRNPGATRAMARHASEGLLEVLLEGRSVQDVLLRDEKTRLAFLPTVVKQR
VPHSSELLTSAQMHKLLAEASNAFDYIIVDLPPLGPVVDARAMAGRIDGFIFVTEWGKTARRAVRNTVENEVHIRKKCLG
VILNKVDTEKLKLYRAYGSSEYYHSRYTRYYHD
>gnl|bykdb|A0A3R1RAJ9 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=272 residues).
MEMLDDGLLTADDVEARLGLPTLGSVPLLMSIADRKDRHMPPTEYLLARPLSGFAEAFRSLRTSILYARLGQAVKVVTVT
SALPGEGKTTTSVCLAISAAQAGSRVVVVDCDIRRRNVSRLLGVTAEKGLLDVLDGSTPLNQAVLQDETSGAWILPLAKR
EFTPHEVFNTPAMHDLLKQLRAQFDLVILDTAPLLAIAETRVLASQSDAVVFLTRWRKTPAKASNAALQTLRQSDAKIAG
VVLTLVDVNEQARYGYGDPGYYYSSYKNYYAT
>gnl|bykdb|A0A3R1RKC9 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=321 residues).
MGNVRLIDTADVDRTKPVKPKKALIVLVATLLGAFLAIALVMLRKALNRGLESPEAIEQLGLPVYASIPYSTLQKAEEDK
NTRGQGRANRAAPLLTTSHPTDLAVEALRSLRTSLHFAMMEASNNRLMISGPSPQVGKTFVSANLAAVIAQTGQRVLLID
VDMRKGYLHKMLGAPVENGLSDVLAKRCNLETAIHKTAIAGFEFMSRGQIPPNPSELLMHANFSALLEQVSGMYDLVILD
TPPILAVTDAAIVGRQSGTNMIVTRFALNPVREVELTIRRFAQNGIDLKGAIFNGVEKRASAKYGYGGYGYYQYEYSSDK
T
>gnl|bykdb|A0A3R2EVW0 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=233 residues).
MRLNEALLAARNPADLAMESLRSLRTSLHFAMMEAKNNIVMITGPGPGLGKTFVSTNFAATLAMGGKKVLVIDADLRKGY
MQKVMGQEMGAGLSAYLAGQTEMMQVISKTGFDGLDFVCRGAVPPNPSELLMHPRFKALLDWASEHYDFVIVDSPPILAV
TDAAIVGQHVGASLLVARFAKTAVKEVEVAIRRFEQNGVVIKGILLNAVEKKASSYYGNYGYYQYSYGDKAKA
>gnl|bykdb|A0A3R2KBB7 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=184 residues).
MVTSSGPEEGKSTVTANLAAAYAQADKKVLLIDGDLRKPTAHKTFSLSNRAGLSSLLSQQAELEDVVQDSGVANLSIMTS
GPIPPNPAEMMASNRMSAVLQELRQRYDMILFDTPPLLAVTDAQIVASKSDGVIMVVSYGKVKRDIAAKAKANLDRVGAK
MLGVVLNNVKRKASEGYYYYYYGN
>gnl|bykdb|A0A3R2KDF2 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=348 residues).
MARDMQVTTEIYTQLLNKTQELDIVRAGTVGNVRVIDSADANIEKPVKPKKMLIVLIATLLGGLIAVAYVLVRKAMNRGV
EDPEVIEQLGIPVYASIPLSKGQSQIEGTLKGNNRASTGSLLLAVNNPADLAVESLRSLRTSLHFATLEAKNNILMISGP
SPAVGKSFVSSNLAAIIAQTGQKVLLVDADMRKGYLNKMFRMDVSNGLSDLLAGKIDLNKATHSTEVDNLHVITRGQIPP
NPSELLMHSNFTRFLEQVSSQYDLVIIDTPPILAVTDAALVGRQAGTSLIVTRFGVNAAKEIAVTKRRFEQNGIVVKGAI
FNAVERKASAYGYGSYSYYQYEYASDKK
>gnl|bykdb|A0A3R2KDK8 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=416 residues).
MLDTIVSVESQLNELTFREAEISKLYTREHPAYRALMEKRATLEQEKGKLNKRVSGMPKTQQEIIRLTRDVDAGKEIYMQ
LLNKQQELSITKASTVGNVRIVDPAVTQPNPVKPRKTLIVLLATFLGGMLSVAIVLLKTMLHKGIETPEQLEQDGINVYA
SIPLSEWQQKKDRETLLSSKRKSNTRSNSLLAVGNPADLAIEAIRSLRTSLHFAMLESKNNVLMISGASPNIGKTFVSIN
LAAVIAQAGQRVLVIDADMRKGYSHTLLGVGWQNGLSDILSQQTTFENAIRKTEIEGMDFIPRGQIPPNPSELLMRARLK
EMIDWASKNYDIVLVDTPPILAVTDAAIIGHHVGTALMIARFSMNTVKEIEVSVRRFEQNGIDIKGVILNAVEKRASSYY
GGYGYYQYEYRSSDKA
>gnl|bykdb|A0A3R2TTF1 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=798 residues).
MKTTHYNQLQKDKSINVLDVLAHLLYHWKWFALSILLFGSYYYYQYAKSPFIYRSAETIIIKTPMNTPRTARISRTNEAY
NSISVASEILQLKSKELMRQTVTRIGAEMSYTVGAGLRRKELYTGSPIKVIVPQKKPEDSFSFTVTPVGGKELVLSNWSE
GDATLEVDATLDKPVNTPFGQVIVQSALKPNKVLPQQEIKVEKFALEGMVNYFISTISITQMEEDASLLQIVAEDTNPLR
ATALIAEMINVYNEVALQDKNQIGVNTANFIRERLAIIEQELGSVESSIEDLRTQNQGMDASTVGTAYFEDSRLYQSERN
KVETDINLAQMMRGYLADGSKKNDLIPNNTGLVDASVETQINDYNTTLLRRNRLIEGSSDANPVVQDLDRALQAMRGNIG
RAVDNAIGGLKIKAGNMKKEENVARGKAMQVPQKQRVMLSVERQQKVKEELYLYLLNKREENAINQAMTEDNIRVIDPAI
VSFDAVAPSKMRKLGLGMAIGFILPAIVIMTLSILDTGVRRRQDIEEAIDVPLLGEIPLANNKRTSQNNILVSAMGRDPL
TEAFRILRTNMSFMAREGKHPQTITLTSFIPGVGKTFTSLNLSSTLSFLNKKVIVVDMDLRKGTLSERMGIIHGKGLSHY
LSDVNLELEEIIHYNLHGKNVDYISIGMEAPNPVELLLSKRLDQLISDLRNRYDYIIIDGVPTGIVADATVVDRVSDLTL
FVIRAGKMDKRQLPEIQKIYAEKRLSNLAIILNGLKLGQSGYGYGYGYGYGYGREEGQNSWRKIARSIRAIFTRKIKH
>gnl|bykdb|A0A3R2VV23 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=486 residues).
MAIKTLNEIADIYVRQNIERTSAEAAKSLGFLNEQLPKVRRDLEKAEDALNSYQTRSKSVDITLETKAILDQIVSLDTNI
SELKLKQAEMDRKFTREHPAYRALMTQLGELTNKQDGLAKKVQSLPSTQQELLSLTRDVRVGTEIYTQLLNRSQELDVMR
AGTVGNVRLIDGADVDRTKPVKPKKILIVLVATLFGAFLAVALVLLRKAINRGIESPEVIEKLGLPVYASVPYSLLQKTE
EQKKSRTPNRTGKAPSLLAIHHPTDLSIEALRSLRTSLHFGMLDAKNNLLMISGPSPGVGKTFISANLAAVVAQAGQRVL
LIDVDMRRGYLHDLLGVPYKNGVSDILVNRCDVATAIHKTEIEGFDFMSRGERPPNPSELLMRSSFTELLNKVSSMYDLV
ILDTPPLLAVTDAAIVGRQCGTSLIVARFGLNPAREIELTINRFAQNGIKLAGAIFNGVERRASANYGYSGYGYYHYEYK
DEKAKA
>gnl|bykdb|A0A3R2Y861 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=570 residues).
MWGEPLLTLRGKVGVPLHADTARGPVDLLVKTADGEPGATFTIKRYSEIATTEWLQRSLSISERGKQSSIIGVALDSVDP
VRASQILNVVGTEYVEQNVRRRSEEADKSIRFLDEQLPQLKQQVEESESAYNAYRAKEGAVDTSEEARTLLEQAVTMETR
QLDLKEKRRELITRYTDEHRYVRALDAQLQEGAAALALNQARTRNLPLIEQTLLQRQRKMKVDTELYTNRLNARQQLALV
RAGKVANVRLIDPATPPETPFMPRRGVAVGGSLLAGLFAGLVLATFRRRMAGAVQDREEIEIATGLPVYATVPRSRLTSE
AKPGRPNWPLRLASPAERAVLPDAAIESLRTIRTTLHFALSEAPNRVVLITGPTAGIGKSFVAANLATLAGASKRRVLLI
DADLRNGALHRRFHVDRGPGLSEVVAGTHRLEDVVRRDVSYGLDLLSTGLHMAGPSELLLQPELAALIQRVSAQYDMVVL
DGPPLLPVADALVLGRMAGTVLMVARHRVTTVDQIDESTRRLAQANVAVQGVIFNDFTGTLHRYSYAYGVNAEPQAPRPA
TPGSSPSEPT
>gnl|bykdb|A0A3R3BMP0 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=203 residues).
MLESINNRLMISGPSPAVGKTFVSANLAAVIAQAGQRVLLVDVDMRKGYLHKTLGTSVENGLSDLLAKRCDLETATHKTE
IENFDFISRGQIPPNPSELLMHANFSAFLEQVSQKYDLVILDTPPLLAVTDAAIVGRQSGTSMIVTRFAMNPAREIELTI
RRFAQNGIILRGAILNGVEKRSSAYYGENGYAYYQYEYKSDKN
>gnl|bykdb|A0A3R3EEA8 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=318 residues).
MIDGADVDRTKPVKPKKILIVLVATLFGAFLAVALVLLRKAINRGIESPEVIEKLGLPVYASVPYSLLQKTEEQKKSRTP
NRTGKAPSLLAIHHPTDLSIEALRSLRTSLHFGMLDAKNNLLMISGPSPGVGKTFISANLAAVVAQAGQRVLLIDVDMRR
GYLHDLLGVPYKNGVSDILVNRCDVATAIHKTEIEGFDFMSRGERPPNPSELLMRSSFTELLNKVSSMYDLVILDTPPLL
AVTDAAIVGRQCGTSLIVARFGLNPAREIELTINRFAQNGIKLAGAIFNGVERRASANYGYSGYGYYHYEYKDEKAKA
>gnl|bykdb|A0A3R3G320 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=314 residues).
MIDSADANIEKPVKPKKALIVLIATLLGGLIAVAYVLVRKAMNRGVEDPEVIEQLGIPVYASIPLSKGQSQIEGTLKGSN
RASTGSLLLAVNNPADLAVESLRSLRTSLHFATLEAKNNILMISGPSPAVGKSFVSSNLAAIIAQTGQKVLLVDADMRKG
YLNKMFRMDVSNGLSDLLAGKIDLNKATHSTEVDNLHVITRGQIPPNPSELLMHSNFTRFLEQVSSQYDLVIIDTPPILA
VTDAALVGRQAGTSLIVTRFGVNAAKEIAVTKRRFEQNGIVVKGAIFNAVERKASAYGYGSYSYYQYEYASDKK
>gnl|bykdb|A0A3R3NKS5 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=228 residues).
MSQQPSKQRHLITVTNPRSPVSEAFRALRTNIDFSSVDEQIQIIMVTSSGPEEGKSTVTANLAAAYAQADKKVLLIDGDL
RKPTAHKTFSLSNRVGLSSLLSQQADLEDVVQESGVANLSIMTSGPIPPNPAEMMASNRMSAVLQELRQRYDMILFDTPP
LLAVTDAQIVASKSDGVIMVVSYGKVKRDIAAKAKANLDRVGAKMLGVVLNNVKRKASEGYYYYYYGN
>gnl|bykdb|A0A3R3PAM0 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=314 residues).
MIDSADANIEKPVKPKKALIVLIATLLGGLIAVAYVLVRKAMNRGVEDPEVIEQLGIPVYASIPLSKGQSLIEGTLKGNN
RASTGSLLLAVNNPADLAVESLRSLRTSLHFATLEAKNNILMISGPSPAVGKSFVSCNLAAIIAQTGQKVLLVDADMRKG
YLNKMFRMDVSNGLSDLLAGKIDLNKATHSTEVDNLHVITRGQIPPNPSELLMHSNFTQFLEQVSSQYDLVIIDTPPILA
VTDAALVGRQAGTSLIVTRFGVNAAKEIAVTKRRFEQNGIVVKGAIFNAVERKASAYGYGSYSYYQYEYASDKK
>gnl|bykdb|A0A3R3PBR3 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=228 residues).
MSQLPNKQRHLITVTNPRSPVSEAFRALRTNIDFSSVDETIQVIMVTSSGPEEGKSTVSANLAAAYAQADKKVLLIDADL
RKPTAHKTFSLSNRFGLSSLLSQQAVLEDTVQDSGVPNLSIMTSGPIPPNPAEMMASNRMSTLLQDLRQIYDVILIDTPP
LLAVTDAQIMASKSDGVIMVVSYGKVKRDIAVKAKANLDRVGAKMLGVVLNNVKRKASEGYYYYYYGN
>gnl|bykdb|A0A3R3PPN7 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=480 residues).
MLDEIGKLYVRQNVERTSAEAASSLEFLRGQLPEVRRDLEKAEDALNAYQTLSKSVDISLETKAILDQIVALDTSISELK
LQQAEMDRKFTRQHPAYQALVKQLGELSTKQKRLSKKVEGLPETQQELLRLTRDVQVGTQIYTQLLNKAQELDVMRAGAV
GNVRVIDTADVDVTKPVKPKKPLIVLIATMLGLFVAIALVLVRKALNRGIENPEAIEQLGLPVYASIPYSVLQKAEEDKR
GKGKSRAAKAAPLLAISHPTDLAIESLRSLRTSLHFATLEAENNRLMISGPSPSVGKTFVSANLAAVIAQAGQRVLLIDV
DMRKGYLHKILGTDEQNGLSDLLTKRCDFDTAARKTDVDGFFFIPRGQIPPNPSELLMHANFTALLEEASKHFDLVILDT
PPLLAVTDAAIVGRQAGTSLIVARFGLNPVREVDMTMRRFAQNGIELKGAIFNGVEKRASAYYGYGGYGYYQYEYKSDKA
>gnl|bykdb|A0A3R3TMZ8 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=237 residues).
MVSVIKDLIAYSDPKSSSAEAYRTLRTNLQFSMLDKDSNIIAVTSCAPGEGKSTIIANLAVSLAQSGKKVLLVDCDLRKP
TIHKKFGISNASGLTSLLLKESTLEEAIYKVDIPNLGLIPSGPVPPNPSEILGSKKMGKILEDLKNYFDVILLDSPPVIV
VSDLHVLASTLDGILLVATYGVTEKNAILRAKESIIKVGGKVLGVVENKIPQDAKGYGYGGYGYGKYQGYYSSDTEE
>gnl|bykdb|A0A3R3W423 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=505 residues).
MSAAERGKESGIIALSLENEDPDLANKVLDEINRLYVLQNVQRNSAEAAQSLEFLRTQLPDVRKQLEKAEGQLNAYQTSA
RSVDITIETKAVLDQIVALETLISELKLKQAEMEHRFTREHPSYQALMTQMGQLDQQKRGLEKKVKNLPETQQELLRLAR
DMQVTTEIYTQLLNKTQELDIVRAGTVGNVRVIDSADANIEKPVKPKKALIVLIATLLGGLIAVAYVLVRKAMNRGVEDP
EVIEQLGIPVYASIPLSKGQSQIEGTLKGNNRASTGSLLLAVNNPADLAVESLRSLRTSLHFATLEAKNNILMISGPSPA
VGKSFVSSNLAAIIAQTGQKVLLVDADMRKGYLNKMFRMDVNSGLSDLLAGKIDLNKATHSTEVDNLHVITRGQIPPNPS
ELLMHSNFTQFLEQVSSQYDLVIIDTPPILAVTDAALVGRQAGTSLIVTRFGVNAAKEIAVTKRRFEQNGIVVKGAIFNA
VERKASAYGYGSYSYYQYEYASDKK
>gnl|bykdb|A0A3R3WRK8 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=498 residues).
MALDSVDPVRASQILNVVGTEYVEQNVRRRSEEADKSIRFLDEQLPQLKQQVEESESAYNAYRAKEGAVDTSEEARTLLE
QAVTMETRQLDLKEKRRELITRYTDEHRYVRALDAQLQEGAAALALNQARTRNLPLIEQTLLQRQRKMKVDTELYTNRLN
ARQQLALVRAGKVANVRLIDPATPPETPFMPRRGVAVGGSLLAGLFAGLVLATFRRRMAGAVQDREEIEIATGLPVYATV
PRSRLTSEAKPGRPNWPLRLASPAERAVLPDAAIESLRTIRTTLHFALSEAPNRVVLITGPTAGIGKSFVAANLATLAGA
SKRRVLLIDADLRNGALHRRFHVDRGPGLSEVVAGTHRLEDVVRRDVSYGLDLLSTGLHMAGPSELLLQPELAALIQRVS
AQYDMVVLDGPPLLPVADALVLGRMAGTVLMVARHRVTTVDQIDESTRRLAQANVAVQGVIFNDFTGTLHRYSYAYGVNA
EPQAPRPATPGSSPSEPT
>gnl|bykdb|A0A3R3YDR2 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=203 residues).
MDDPHKILVITSSIPGEGKSTVAANLAMALGQMEKVLLIDADMRRPTLAKNFDFAVGTPGLANLIAGTAKLEECIKHVEG
IDMLSAGAVPPNPLELLSSARFEKVLEFLRSKYDRVVIDSPPTQAVSDATVLATHANALLYVIKSEATPIPLAQKGVGQL
LQNNAPVTGVILNQVDIKKAQKQGYSYGGYYDYYGYSNDAQKA
>gnl|bykdb|A0A3R4BTI6 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=203 residues).
MDDPHKILVVTSSIPGEGKSTVAANLACALGQMEKVLLIDADMRRPTMAKNFGFAVGTPGLANLIAGTAKLEECVKHIEG
IDMLSAGAVPPNPLELLSSARFEKVVEFLRSKYDRIVIDSPPTQAVSDALVLGTLANALIYVVKSEATPIPLVQKGIGQL
LQNNAPVTGIVLNQVDIKKAQKQGYSYGGYYDYYGYSSDAQKA
>gnl|bykdb|A0A3R4D168 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=704 residues).
MDIKYYLSIFLRRWWILVITTGLVTGVTAIRAGKEPVTYTAQARMLYETNNVASSVLGGAMFMPMSWNNPVDTQLQLITT
RPNAEEAIKRLGLNDPAKGPVITPEEVLGGLSAQVDKNTDIIMLRFTHLKSDLAIKVVNEMGHVFVERNRANHQETARTA
RQFIMEQLAKTEKTLTEAEDQLRAFRESNGLFEVSSLGNTTAGQLSSIDTRLIDLDVDRKVAEEKLANARRHLEVTDPGL
MLRMEKLNADKVYASLQSSLAEGEAALTVKRTQYTDDAPEVQDAQAQLNKLRAAMQMRVKHVLGKGLGDQELVSSRTTSE
ERFLADLVTAQTEVAQLDARAAALKASRGEYESRFSSLPAKDQQLAQLNRRKAAAEQTYEVFLKREQEMRITEAMNLGNV
RMVEEATVASASASGYSRTVSLAALLGLIFGLGVALLIEFLDDRIRRPEEAENVLELPILGMLPWVEGREASRRRLVVLE
DPRSPVTESYRALQTYTRTVEPDVRHQCFMLTSPGPKEGKSTVLANLAITSAQLGKRTLIVDTDLRAPSQHINFDRQNLM
GIYDVVYEGCPLEEAIQQTDVEGLDILCTGPVPPDPVQTLHADAFKRMVEKLRKDYDAIFFDSPPINLFTDAAVLGRMTD
SVLMVVDVRSTTRQATVAAKELLIKAKVPLAGMVVKNTAATTNRYHTRYYERYYMDRLKQLADE
>gnl|bykdb|A0A3R4GVU7 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=327 residues).
MRAGTVGNVRLIDTADVDLRKPVKPRKPLIVLIATLFGAFLATALVLFRKALNRGVENPDQIEQLGLPVYASIPFSSLQK
SEESKILRSGRGRANKVAPILASSHPTDLAIEGLRSLRTSLHFAMLEASNNRLMISGPSPKVGKTFVSANLAAVIAQTGQ
RVLLIDVDMRKGYLHKVFGTPAENGLSDLLVKRCDLATAINKTEFEHLDVIGRGQIPPNPSELLMHANFSAFLEQVSTQY
DLVILDTPPLLAVTDAAIVGRQSGTSLIVTRFALNPVREIELTMRRFAQNGIELKGAIFNGVEKRASAKYGYADYGYYNY
EYKSESV
>gnl|bykdb|A0A3R4HE49 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=420 residues).
MRQDLTKDLVQAEINNLGYATRVDALKTLVSNYNSRLTGLPNKELQLTRLMRNASVTAELYKMLLQKQQEARISENMNLG
NVRIVEEAVMPEKPIKPKKLQNMLVALVVGLMFGVGAAMFLEYLDDTIQTADDAEAIAELPTLGIIPWLRSQTDAKLITL
ADPRSPASEAYRTLRTNIKFLSADSPLRTLTITSAGPEEGKSTTIANLGVSFAQTGKKVLIVDTDMRKPTVHTIFGLRSD
IGVTSVLAGDLPLEEAIQNTEAETLQVLTCGPIPPNPAELLESNRFQALIEELKERYDVVLFDAPPIIAVTDASILAAKL
DGLILLLGVNKVTRKAAKHALQLLARAKVKVWGMVVRGVRPDNDGYYYAYYHRYYGTMERDRKKADKKAKREATATVAQA
PDTQAAPGSVTIDINKLKKG
>gnl|bykdb|A0A3R4HSN4 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=202 residues).
MMEANNNVLMISGASPNIGKTFVSINLAAVIAQTGQRVLVIDADMRKGYSHILVGTEWNNGLSDFLSGKITQEQAIHQTK
VEGMDFIPRGQLPPNPSELLMHSRLADLLNWAGGKYDLILIDTPPVLAVTDASIIGRLAGTSLMVARFGVNTVKEVDFSI
RRFDQNGINIKGVILNAVEKRASNYYGGYGYYQYSYTSDKKQ
>gnl|bykdb|A0A3R4QZA0 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=269 residues).
MRSGIKDSAQIENELDLPVYATVPRSPVQESRINILKKKKNIPILAVKNSDDIAIESLRSMRTAIHFALSSARNNLITIS
GPAPEVGKSFISTNLATILAQSDKRVLIIDADLRRGYLHKYFNLDTQPGLTELLNGQQSLETVIRHTEVPGLSVISRGKN
PANPSELLSSNQFKNLLEQMSEKFDHVIIDTPPVLAVTDGIIISQYTGVNLVIARYAKTQMKELELTLNRFEQAGVKVNG
FILNDIQRSAGSGYGYNYAYAYKANKELD
>gnl|bykdb|A0A3R4S1T4 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=241 residues).
MRVAVEAPRSQFAETLRNTKLACDIVLQGKKCAVIGVVSCLPGEGKSTVAANFAGLIASSGARTLVIDADLRNPGLSKML
ASEPEVGLVDVILNKASWTSVARVDRRSRLTILPMTTRGRQVTHTSELLASSGMSQFLESIKDTFDVIVVDLAPLIPVID
AKAFEPYADAFVFVTEWGATPAKAVQSVLQSEPQIAAKTIGVILNKTDLSELHKYADPGAPERLRSNYLSYYRDYKEVAA
E
>gnl|bykdb|A0A3R4T9I0 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=237 residues).
MQLLAVTSPESLAIESLRNLRVSLQLTLMETGNNRVLITGATPGVGKSFVSGNFAVIMAQAGKRVLLIDADLRKGHLQKA
FGLPRKGGLADVLSGEMTPEQAIHAQVVPNLDVLTTGAYPFNPANMMLSSALGELLNDFSERYDLVVIDSPPVLVAADAA
AVAAHAGAVLLVARDNLTQLGELNESIKRLAHAGQQVNGVVFNGMDLSRRHYGSYGYKYGGYRYTEYKYKEAGAASE
>gnl|bykdb|A0A3R4U3E9 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=420 residues).
MQTKGLLEQEVAVEASIQQLRLKQAEMDRSFTREHPAYRALLRQIGDLEGRKGGFQKQVGDLPETQQELLRLTRDLQVSN
ELYTALLNQAQQLDVARAGAVGNVRIVDPAIVDIAHPVAPRKGLIVAIATLLGAFLSVAFVFLQRMLNPGIEDPADIEAL
GLPVYAAIPLSVSNTLPKLRKGKHGTRVVSDGRQHLLAVSAPADPTVEALRSLRTSLHFAMLEAKNNILTISGPRPGVGK
TFVSTNLAAVIAQAGQRVLVIDADMRKGTLHKILGVSPQKGLSDVLGGKLSVDEVIHPVSGLDNMHYMVRGDIPPNPAEL
LMHPRFAQLLQDMSGKYDLVIVDTPPILAVTDPALVATHAGSSLLVTRFGVNQAKEIELTLQRFEQNGVQIKGAIFNAVE
KRATGYYSYGYYEYKSDGKE
>gnl|bykdb|A0A3R4U8W0 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=442 residues).
MRTRLDDAENKLNAYRQQKDSVDLPLEAKSVLDSMVNIDAQLNELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKTKL
NNRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITEASTVGDVRIVDPAITQPGVLKPKKALIILGSMILGLML
SIVGVLLRSLLNRGIESPQVLEENGISVYASIPLSEWQKSRDSVKTVKGIKRYKQSQLLAVGNPTDLAIEAVRSLRTSLH
FAMMQAKNNVLMLTGVSPSIGKTFVCANLAAVISQTNKRVLLIDCDMRKGYTHELLGTNNVNGLSEILLGKGEISQSAKP
TSITNFDLVPRGQVPPNPSELLMSERFTQLVKWASENYDLVLIDTPPILAVTDAAVVGRHAGTTLMVARYAVNTLKEVET
SLSRFEQNGIEVKGVILNSIFRRATGYQDYGYYEYEYKSDSK
>gnl|bykdb|A0A3R4UA41 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=538 residues).
MVVSRLDGKPGAEFLVSRASLLATTEDLQKRLQLAEQGKQSNVISASLEDSDRDRLQRTLNEIGAQYVRQNVERKAAEAE
KTIEFLDRQLPEFKRQLESSEDAYARFRNQNGTVAFDEEAKAALTMSVQLQTKLLESQQLRRELLSRFTESNPKVRMIDG
QIAAVRHEIEGLETRVSAMPAIQRDALRLERDVRVNGELYKSMLDSSLQLRLVKEGKIGNVRLLDTAVEPRRAVKPQKPL
VVALSLVLGLLTGVALAILRSKLSSGIRNPQEIEDRLGLNVYSVVPLALEQETILEHIAGGAKGVQLLAVTSPESLAIES
LRNLRVSLQLTLMESGNNRVLITGATPGVGKSFVSGNFAVIMAQAGKRVLLIDADLRKGHLQKAFGLPRKGGLAEILAGD
LTPEQATHVQVIPNLDVLTTGAYPFNPANMMLSAALGELLNDFSERYDLVVIDSPPVLVAADAAAVAAHAGAVLLVARDN
LTQLGELNESIKRLAHAGQQVNGVVFNGMDLSRRHYGSYGYKYGGYRYTEYKYKEEAA
>gnl|bykdb|A0A3R4ZJ07 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=374 residues).
MNKQRHGLEKKVQDLPATQQELLNLTRDVEVATQIYTQLLNKSQELDIVRAGAVGNARLIDSADVDITSPVKPRKALIIL
AATLLGGFVGVALVLVRKSLGRGIEGPDAIEKLGLPVYASIPYSVLQQEEDSKKLRLANGVNSQSFLLAQRNPTDLSIES
IRSLRTCLHFAGLDATNNRIMISGPSPQVGKTFVSSNLAAVIAQSGQRVVLIDADMRKGHLHKSLATPISNGLSDLLTKR
CSIEQAINKLEVDNLHFISRGQVPPNPSELLMHANFRELLAELSKLYDVVIIDTPPLLAVTDAAIVGREAAINLIVTRFG
VNPAKEIELTIRRFAQNGIELKGAIFNGVEKRASSYYGNGSYAYYNYEYASDKS
>gnl|bykdb|A0A3R5AYY7 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=338 residues).
MLNRSQELDVMRAGTVGNVRLIDGADVDRTKPVKPKKILIVLVATLFGAFLAVALVLLRKAINRGIESPEVIEKLGLPVY
ASVPYSLLQKTEEQKKPRTPNRTGKAPSLLAIHHPTDLSIEALRSLRTSLHFGMLDAKNNLLMISGPSPGVGKTFISANL
AAVVAQAGQRVLLIDVDMRRGYLHDLLGVPYKNGVSDILVNRCDVATAIHKTEIEGFDFMSRGERPPNPSELLMRSSFTE
LLNKVSSMYDLVILDTPPLLAVTDAAIVGRQCGTSLIVARFGLNPAREIELTINRFAQNGIKLAGAIFNGVERRASANYG
YSGYGYYHYEYKDEKAKA
>gnl|bykdb|A0A3R5C7Q1 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=257 residues).
MPLALEQETILEHIAGGAKGVQLLAVTSPESLAIESLRNLRVSLQLTLMETGNNRVLITGATPGVGKSFVSGNFAVIMAQ
AGKRVLLIDADLRKGHLQKAFGLPRKGGLADVLSGEMTPEQAIHAQVVPNLDVLTTGAYPFNPANMMLSSALGELLDAFS
ERYDLVVIDSPPVLVAADAAAVAAHAGAVLLVARDNLTQLGELNESVKRLAHAGQQVNGVVFNGMDLSRRHYGSYGYKYG
GYRYTEYKYKEAGAASE
>gnl|bykdb|A0A3R5CIW6 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=444 residues).
MRKQLEKAEGQLNAYQSSARSVDITIETKAVLDQIVALETLISELKLKQAEMEHRFTREHPSYQALMTQMGQLDQQKRGL
EKKVKNLPETQQELLRLTRDMQVTTDIYTQLLNKTQELDIVRAGTVGNVRVIDSADANIEKPVKPKKMLIVLIATLLGGL
IAVAYVLVRKAMNRGVEDPEVIEQLGIPVYASIPLSKGQSQIEGTLKGNNRASTGSLLLAVNNPADLAVESLRSLRTSLH
FATLEAKNNILMISGPSPAVGKSFVSCNLAAIIAQTGQKVLLVDADMRKGYLNKMFRMDVSNGLSDLLAGKIDLNKATHS
TEVDNLHVITRGQIPPNPSELLMHSNFTRFLEQVSSQYDLVIIDTPPILAVTDAALVGRQSGTNLIVTRFGVNAAKEIAV
TKRRFEQNGIVVKGAIFNAVERKASAYGYGSYSYYQYEYASDKK
>gnl|bykdb|A0A3R5DAG0 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=259 residues).
MYASIPFSSLQKSEESKILRSGRGRANKVAPILASSHPTDLAIEGLRSLRTSLHFAMLEASNNRLMISGPSPKVGKTFVS
ANLAAVIAQTGQRVLLIDVDMRKGYLHKVFGTPAENGLSDLLVKRCDLATAINKTEFEHLDVIGRGQIPPNPSELLMHAN
FSAFLDQVSAQYDLVILDTPPLLAVTDAAIVGRQSGTSLIVTRFALNPAREIELTMRRFAQNGIELKGAIFNGVEKRASA
KYGYADYGYYNYEYKSESV
>gnl|bykdb|A0A3R5GLV2 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=557 residues).
MASAYLLDKLNSKYEATRRASDWLSDRIAELRQRALDTDLAVQKFRAEHNLISTGNNSLLSDQQLAESNSALILAQSETA
KARARVQRIEHILATDDVDGVVTDILDSSVANDLRKKYLESSKIEAEITRRLGSNHIQAVRLRNEMQEYRRLMFQEISRI
AQSYKSDLEVSEAKEKSLAESVAKATDISNSASETQVQLRELQREAETYKNMYQTFLQRYQEAMQQQSFPVTEARVISKA
MPPRIPSKPNKPIILALFMIMGAAAGGGIAMFREFRDRFFRTGEQVRDVLGLEFLGNTPLIPNKPATEAPESGHPGLTLP
TSVARYAVDHPLSSFAETLRSTRLAIDLGISTKSGARIVGVVSALPSEGKSTISINLAQLLAGQGARVLLLDADIRNPGA
TRAMARHASEGLLEVLLEGRSVQDVLLRDEKTKLAFLPTVVKQRVPHSSELLTSAQMHKLLAEASNAFDYIIVDLPPLGP
VVDARAMAGRIDGFIFVTEWGKTARRAVRNTVENEVHIRKKCLGVILNKVDTEKLKLYRAYGSSEYYHSRYTRYYHD
>gnl|bykdb|A0A3R5HKR2 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=233 residues).
MPLNEALLAARNPADLAMESLRSLRTSLHFAMMEAKNNIVMISGPGPGLGKTFVSTNFAATLAMGGKKVLVIDADLRKGY
MQKVMGQEMGAGLSAYLAGQTEMMPVISKTGFDGLDFVCRGAVPPNPSELLMHPRFKALLDWASEHYDFVIVDSPPILAV
TDAAIVGQHVGASLLVARFAKTAVKEVEVAIRRFEQNGVAIKGILLNAVEKKASSYYGNYGYYQYSYGDASFE
>gnl|bykdb|A0A3R5KFR9 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=293 residues).
MGFVLSVGIVLLRMAMKRGIETPEQLEMQGITVLATLPRSEWLWKKTRLRSKRFISERWNHRTRNVPFLPVDRPVDVFVE
AIRGLRTSLHFTMMGTHNRVIMLTGPTQDCGKTLVATSLAAIVAQAGQKVLFIDADMRKGYVHQIFSLTNRCGLADVLMG
KGEYQDAIQHYAPGGVDVLTCGQAPTNPSELLIGDGFQQLLKWANEHYEMVIVDTPPILAVTDASLVGRRAGTTLLVARF
GMTSVKEMQACVKRLHLAGVSIDGAILNDVVKSAAIYYTAGYSPYEYRQAAEK
>gnl|bykdb|A0A3R5NV43 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=505 residues).
MSAAERGKESGIIALSLENEDPDLANKVLDEINRLYVLQNVQRNSAEAAQSLEFLRTQLPDVRKQLEKAEGQLNAYQSSA
RSVDITIETKAVLDQIVALETLISELKLKQAEMEHRFTREHPSYQALMTQMGQLDQQKRGLEKKVKNLPETQQELLRLTR
DMQVTTDIYTQLLNKTQELDIVRAGTVGNVRVIDSADANIEKPVKPKKMLIVLIATLLGGLIAVAYVLVRKAMNRGVEDP
EVIEQLGIPVYASIPLSKGQSQIEGTLKGNNRASTGSLLLAVNNPADLAVESLRSLRTSLHFATLEAKNNILMISGPSPA
VGKSFVSSNLAAIIAQTGQKVLLVDADMRKGYLNKMFRMDVNSGLSDLLAGKIDLNKATHSTEVDNLHVITRGQIPPNPS
ELLMHSNFTRFLEQVSSQYDLVIIDTPPILAVTDAALVGRQAGTSLIVTRFGVNAAKEIAVTKRRFEQNGIVVKGAIFNA
VERKASAYGYGSYSYYQYEYASDKK
>gnl|bykdb|A0A3R5S6P1 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=250 residues).
MLQKAEEDKRSTGKSRSAKAAPLLAVSHPTDLAVESLRSLRTSLHFATLEAENNRLMISGPSPSVGKTFVSANLAAVIAQ
AGQRVLLIDVDMRKGYLHKILGTDEQNGLSDLLTKRCDFDNAIRNTDVDGFFFIPRGQIPPNPSELLMHANFTALLEEAS
KHFDLVILDTPPLLAVTDAAIVGRQAGTSLIVARFGLNPVREVDLTMRRFAQNGIELKGAIFNGVEKRASAYYGYGGYGY
YQYEYKSDKA
>gnl|bykdb|A0A3R5TDH0 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=212 residues).
MNGPHRILVVTSSLPGEGKSTVAANLAYAFGQMERVLLIDADLRRPTLAKNFKFPVGTPGLANLIAGTAKTDDCIKSIEG
IDMMCAGAVPPNPLELLSSERFAKLIEQLKSRYDRVIIDSPPIQAVSDATILATHADAQIYVIKSEATPIPLAQKGVGQL
LQTNSPVTGVVLNQVDVKRAQKHGYHYGGYYDYYGYTKPQKAEAQATQGSQA
>gnl|bykdb|A0A3R5TF76 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=193 residues).
MPSEGKSTISINLAQLLAGQGSRVLLLDADIRNPGATRAMARHASEGLLEVLLEGRSVQDVVLRDEKTKLAFLPTVVKQR
VPHSSELLTSAQMHKLLAEASNAFDYIIVDLPPLGPVVDARAMAGRIDGFIFVTEWGKTARRAVRNTVENEVHIRKKCLG
VILNKVDTEKLKLYRAYGSSEYYHSRYTRYYHD
>gnl|bykdb|A0A404A688 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=235 residues).
MPFLPVDRPLDIFVEAIRGLRTSLHFAMMDAQNNILMFSGPTQDCGKTLVSTSLAALVAQVEQRVLFIDADMRKGYVHNI
FDLKNDAGLSDVLSGKVEFQQAVQTYASGKFDVVTCGQYPPNPSELLMHSRFREFMRWASEHYDMVIVDTPPILAVTDAA
LVGGIAASTLLVARFNVTSVREMQVSYRRLQQMGVNIKGAILNDVMKSAASYYSSGYDAYGYSAAQNEGAQTARR
>gnl|bykdb|A0A404ALK7 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=347 residues).
MQREVEANRALYDTFMTRLKETAATSDLETANARVVDQSVVPTQPIKPQKSLIISMAGILALMAGIGLSLLLEMLNNTFK
GAEEVEAKLNLPVLGILPLVKNKHRSQIASLFSSNEDKSFSESIRTIRTSLVLSGMSDPHRILVVTSSIPGEGKSTVAAN
LAYAFGQMEKVLLVDADLRRPTLAKNFKFPVGTPGLANLIAGTAKVDECIKTIEGIDMLCAGAVPPNPLELLSSERFTKL
IEQLKDSYDRVIIDSPPIQAVSDATILAIHADAQIYVIKSESTSVPLARRGVGQLLQSNSPVTGVVLNQVDIKKAQKHGY
HYGGYYDYYGYTNPQKTDAQTTQGSKA
>gnl|bykdb|A0A404C9H2 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=329 residues).
MQLLNKQQELGITKASTVGNVRIVDPAVTQPRPVKPQKTIIVLIVTLLGGLFSTGFVLLKTMLHRGIESPEQLEQQGINV
YASIPLSEWQQKSDRETMLSGKRSSTKSYTLLAVGNPADLAIEAVRSLRTSLHFASLEAKNNVLMISGASPSIGKTFVSI
NLAAVIAQAGQRILVVDADMRKGYAHSLLNCELGLGLSDVLSGQATAQQAIKKTSIENLSFISRGKIPPNPSELLMHNRL
SEFLEWAGKEYDIVLVDTPPILAVTDAAIVARNVGTTLLVARYGVNSLKEIEVSIRRFEQNGMEIKGIILNAVEHKSGSA
YGYYAYEYK
>gnl|bykdb|A0A404MRF7 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=427 residues).
MDLTLEAKSVLEQIVNADNQLNELTFREAEISQLFKKDHPTYRALNEKRQTLENEKARLNKRVTAMPSTQQEILRLSRDV
DSGRAVYQQLLTRQQELSISRSSAIGNVRIIDSAVTQPEPIKPQKPLIVVIGGLLGFVLSLGIVLLRMAMKRGIERPEQL
EMQGITVLATLPRSEWLWKKTRLRSKRFISERWNHRTRNVPFLPVDRPVDVFVEAIRGLRTSLHFTMMGTHNRVIMLTGP
TQDCGKTLVATSLAAIVAQAGQKVLFIDADMRKGYVHQIFSLTNRCGLADVLMGKGGYQDAIQHYAPGGVDVLTCGQAPT
NPSELLIGDGFQQLLKWANEHYEMVILDTPPILAVTDASLVGTRAGTTLLVARFGMTSVKEMQACVKRLHLAGVSIDGAI
LNDVVKSAAIYYTAGYSPYEYRQAAEK
>gnl|bykdb|A0A404N310 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=434 residues).
MLGKSFEISLTKQITDLNLLLERKEELLTNVTENNSELKNLNLRIQSKIQSIRRSVEVIQERILEQAKVIRGKIGIVEGE
YLKMPQKKMEYNRLKSLQDLNEKYYTLLTEKKIMYSISNAGYTSNNRVLNEASLNFTPVSPNRKLVYAGFIFIGFVSGFA
FLFFKYVTFNEINTIDDLKHLLPDKVTVLGNIPLLKESTEYSQLLVHNTPKSILAESMRNIRTNLSFVNSDVRVIAISSS
ISGEGKTFVALNLAGIIALSGKRTIVIDLDLRKPKVHLGLNVPNEKGISNLIIKQVTLEECIRKSEIENLDFISAGPIPP
NPSELILSDSFQEILETLKATYDIVIIDNPPVGLVTDGVQILAKADVPIYIFKAHYSKRIFAGRVRELFEMNQISHLNII
LNGTKAYKGKYGYGYGYGYGYDYYDEEDKKKKKK
>gnl|bykdb|A0A404NRH5 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=314 residues).
MIDSADANIEKPVKPKKALIVLIATLLGGLIAVAYVLVRKAMNRGVEDPEVIEQLGIPVYASIPLSKGQSQIEGTLKGNN
RASTGSLLLAVNNPADLAVESLRSLRTSLHFATLEAKNNILMISGPSPAVGKSFVSSNLAAIIAQTGQKVLLVDADMRKG
YLNKMFRMDVSNGLSDLLAGKIDLNKATHSTEVDNLHVITRGQIPPNPSELLMHSNFTRFLEQVSSQYDLVIIDTPPILA
VTDAALVGRQAGTSLIVTRFGVNAAKEIAVTKRRFEQNGIVVKGAIFNAVERKASAYGYGSYSYYQYEYASDKK
>gnl|bykdb|A0A404X108 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=233 residues).
MPLNEALLAARNPADLAMESLRSLRTSLHFAMMEAKNNIVMISGPGPGLGKTFVSTNFAATLAMGGKKVLVIDADLRKGY
MQKVMGQEMGAGLSAYLAGQTEMMQVISKTGFDGLDFVCRGAVPPNPSELLMHPRFKALLDWASERYDFVIVDSPPILAV
TDAAIVGQHVGASLLVARFAKTAVKEVEVAIRRFEQNGVAIKGILLNAVEKKASSYYGNYGYYQYSYGDKTKA
>gnl|bykdb|A0A404XVD4 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=193 residues).
MISGPSPGVGKTFVSVNLAAVIAQAGRRVLLIDVDMRKGYVHKMLGAGAENGLSDVLSKQCALDKAIHQTDIKGFDFISR
GRIPPNPSELLMKVNFAELLDEVSKDYDLIILDTPPLLAVTDAAIVGRQSGTNLIVTRFGLNPAHEIELTIRRFAQNGIE
LKGAIFNGVEKRASAYGYGSYGYYHYDYKSDNA
>gnl|bykdb|A0A405D7C3 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=233 residues).
MPLNEALLAARNPADLAMESLRSLRTSLHFAMMEAKNNIVMISGPGPGLGKTFVSTNFAATLAMGGKKVLVIDADLRKGY
MQKVMGQEMGAGLSAYLAGQTEMMQVISKTGFDGLDFVCRGAVPPNPSELLMHPRFKALLDWASERYDFVIVDSPPILAV
TDAAIVGQHVGASLLVARFAKTAVKEVEVAIRRFEQNGVVIKGILLNAVEKKASSYYGNYGYYQYSYGDKTKA
>gnl|bykdb|A0A405KPI1 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=229 residues).
MLQRTNKRPIITHENPKSPISEAYRALRTNIQFSAIDEDIRVIMVTSAGPGEGKSTTINNLATAYAQSDKKVLIIDADLR
KPTLHNTFNVTNRWGLTSLLTNQVGLGEVIHTSFIPNLDILTSGPVPPNPSEILASKRLALLLEELKGIYDIIFIDTPPA
IAVTDAQIVATKCDGVLLVVDSGNVKREIALKAKNNMEHVKARILGVILNNVDRRNKDSYYYYYYGANE
>gnl|bykdb|A0A406DTV4 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=259 residues).
MYASIPFSSLQKSEESKILRSGRGRANKVAPILASSHPTDLAIEGLRSLRTSLHFAMLEASNNRLMISGPSPKVGKTFVS
ANLAAVIAQTGQRVLLIDVDMRKGYLHKVFGTPAENGLSDLLVKRCDLATAINKTEFEHLDVIGRGQIPPNPSELLMHAN
FSAFLDQVSAQYDLVILDTPPLLAVTDAAIVGRQSGTSLIVTRFALNPVREIELTMRRFAQNGIDLKGAIFNGVEKRASS
KYGYSDYGYYNYEYKSESV
>gnl|bykdb|A0A406EFX4 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=406 residues).
MLRAQQELAAIDGQIQAEIQRVISNLEARVQVARDRTNSVQSSIGRARGTLAGNNAAAVRLNELERNAEAVRTLYKGLLD
RYQETTSRAGVETADSRIVSAAKAPGSPSSPNIPVNLVLGFIFAVGAGLTAVVIMEMLDDGLLTADDVEARLGLPTLGSV
PLLMSIADRKDRHMPPTEYLLARPLSGFAEAFRSLRTSILYARLGQAVKVVTVTSALPGEGKTTASVCLAISAAQAGSRV
VVVDCDIRRRNVSRLLGVTAEKGLLDVLDGSAPLNQAVLQDETSGAWILPLAKREFTPHEVFNTPAMHDLLKQLRAQFDL
VILDTAPLLAIAETRVLASQSDAVVFLTRWRKTPAKASNAALQTLRQSDAKIAGVVLTLVDVNEQARYGYGDPGYYYSSY
KNYYAT
>gnl|bykdb|A0A406QJE9 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=317 residues).
MRIVDPAVVDTANPVKPRKALIVAIATLLGGFLSVAFVFLQRMLNPGIEDPADIEALGLPVYAAIPLSVSNTLPKLRKGK
HGTRVVADGRQHLLAVSAPADPTVEALRSLRTSLHFAMLEAKNNILTISGPRPGVGKTFVSTNLAAVIAQAGQRVLVIDA
DMRKGTLHKILGVSPQKGLSDVLGGKLSVDEVIHPVSGLDNMHYMVRGDIPPNPAELLMHPRFAQLLQDMSGKYDLVIVD
TPPILAVTDPALVATHAGSSLLVTRFGVNQAKEIELTLQRFEQNGVQIKGAIFNAVEKRATGYYSYGYYEYKSDGKE
>gnl|bykdb|A0A407LWW7 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=216 residues).
MLQASLRQSANNMVMFTGPVAGVGKSFLSANFAFIQGGVGKRVLLIDADFRKGQLNRYFGLPKEDGLFEVLSGTIPLNRV
RKHSVSEGVDFIATGAVTFDPSELLASPVFGETLRELATQYDMVILDTAPVLSSPDAAVVGTHAAAVMVVVRSGMNTVGE
IRETAKRLIQAGAPVDGVLFNGLKLLPERFGFRSKYGGYRYSRAAYYGDFKQNGPK
>gnl|bykdb|A0A407YHX1 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=610 residues).
MERVGRSSVIAISTRSTDRQLAAQIAKTYAQAYLTEQLNANFDASERASVWLQERMTDLNQRAQAAELAVQKYRSDNNIV
SSRGELMSESQLADLNGQLISAQADAATASARYSQYKSIIDRGPETAVDNAVVSARDTDNSVIQDLRKRYITISDRQRGI
VQQFGADHPQAAALDAEKKEISQQIFQELQQLTGSFKNEVDVANSRVQSLRDSIDKVAGRNSQANITMVQLRELEQRSTA
LRTLYQSYLGRFEEASQKQSLPIAKARIISEAGLPTSPSSPKKTMTMALSVVLGLMLGGGIAALLEFRDRFFHTGNDVRD
NLRMRFLGYLPFIGERGVENAKAGTSAATPGGEHATLDESGQVSFQKMLRLAVDSPRSSFAETLRNVKLTADVVIQERQC
RVIGVISCLPNEGKSVVALNLAGLIASTGKRTLVVDADIRNPGLSRMLTTRQSAGLVEVVLDEIPWTQAVKVDTRTKMGI
LPVSTSNQFAHSSELLSSSGMRKFIDSAREACDYIIVDLAPVVPVIDAKAFAPQVDGFVFVTEWGKTPIQMVQNLMANEP
QIANKTLGIVLNKTDMTELQRYAGPGGSEHYHEKFSAYYGDAKPPVKEEA
>gnl|bykdb|A0A408AG77 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=331 residues).
MRAGKVANVRLIDPATPPETPFMPRRGVAVGGSLLAGLFAGLVLATFRRRMAGAVQDREEIEIATGLPVYATVPRSRLTS
EAKPGRPNWPLRLASPAERAVLPDAAIESLRTIRTTLHFALSEAPNRVVLITGPTAGIGKSFVAANLATLAGASKRRVLL
IDADLRNGALHRRFHVDRGPGLSEVVAGTHRLEDVVRRDVSYGLDLLSTGLHMAGPSELLLQPELAALIQRVSAQYDMVV
LDGPPLLPVADALVLGRMAGTVLMVARHRVTTVDQIDESTRRLAQANVAVQGVIFNDFTGTLHRYSYAYGVNAEPQAPRP
ATPGSSPSEPT
>gnl|bykdb|A0A408ANB0 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=359 residues).
MEQDTLRLMRDVKVNNELYVGLLNSMQQLRLVKAGKVGNVRLLDKALVPEEPVKPRRVIVLALAAVLGVALGVVAAFVRN
ALHGGIKDPKDIERHTGLNVYATVVLSQAQGAITEEFHSSKRGNRLLASRCPNDPAVESLRSLRTALQFAMLDAGNNRVL
VGGPTPGVGKSFVSANLAAVIAAGGKRVLLIDADMRKGYLNRHFGKAREPGLSDVLAGSAGIEQVIHRDVVEGVDLISAG
TVPPNPADLLLSERIVQLLDAVSGRYDLVLIDTPPVLAVTDAVILAAQCGTVFLVSRFGKTTIEDIAEAENQLRHANADV
KGVIFNALDPRAFRYGYGNKYERYRHAYYGNAAIDGRSK
>gnl|bykdb|A0A408BKC9 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=269 residues).
MPGEGKSWTSSNLAVTFAQAGKKVVLVDADMRKGRQYSIFDGKPRPGLSNFLSGIDQEDNSLPVLVQATEVDNLFIIATG
DVPPNPAELLISDKMDELISQLKEVADIIIFDAPPGLVVTDAAILSRYVDSTIIVTAANDTKMEALEKVKKAIENVGGKV
SGVVINKVPMNTRKYGYYGNYYGSTATFKKGRGKNKHHLAMSQREAARPENQPKREVKTGFDEIYAFKQREEELKDITKD
SISVDKAQDVLNQINTYLSEEKKKLKGDS
>gnl|bykdb|A0A408LKC9 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=288 residues).
MLIGSLLGAVLSVALILIKQMLNRGVEDPAQIEELGLPVYASIPVSVQQQTDSVRGKFRADGRLHLLAIKDPADLAIEAV
RSLRTSLHFARLEAKNNIVLISGASPNAGKTFVSSNLAAVIAQAGQRVLIIDADMRKGTLHKALGATQTPGLSDLLVGKS
DLSDVVRVLPGLENLSFISRGDVPPNPSELLMHANFTKLLSEAAPAYDLVIVDTPPILAVTDAAIIAHHAGTCLMVARFG
LNQAKELALAKRRFEQNNVRIKGAIFNAVERRATGYYSYGYYEYKSTT
>gnl|bykdb|A0A408M394 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=453 residues).
MKSEPNRLDIYRLIPEMLGKSFELSLTKQITDLNLLLERKEELLTNVTENNSELKNLNLRIQSKIQSIKRSVEVIQERIL
EQAKVVKGKIGIVEGEYLKMPQKKMEYNRLKSLQDLNEKYYTLLTEKKIMYSISNAGYTSNNRVLNEASLNFDPVSPNRK
LVYAGFIFIGFVSGFAFLFFKYVTFNEINTIDDLKHLLPEKVTILGNIPLLKDSSEYSQLMVHNSPKSILAESMRNIRTN
LSFVNSNVRVIAISSSISGEGKTFVALNLAGIIALSGKKTIVIDLDLRKPKVHLGLNVSNEKGISNLIIKQVTLEECIRK
SEIENLDFISAGPIPPNPSELILSDSFLEILETLKATYDIVIIDNPPVGLVTDGVQILAKADVPIYIFKAHYSKRIFAGR
VRELFDMNQISHLNIILNGTKAYKGKYGYGYGYGYGYDYYDEEDKDKKKKKSN
>gnl|bykdb|A0A409DV79 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=340 residues).
MNNAQQLRLIRAGKVGNVRILDAAVQPDRPVRPKAAIIIGVATVIGLIFGMLCAFVRNALFGGLSEPDDVERYTGLPVLA
AIPYSDMQDKLWRRSRRKNATVPALLAQSQGNSPPIESLRSFRNVLQASLRQSANNMVMFTGPVAGVGKSFLSANFAFIQ
GGVGKRVLLIDADFRKGQLNRYFGVPKEDGLFEVLSGTIPLTRVRKHSVSEGVDFIATGAVTFDPSELLASPVFGETLRE
LATQYDMVILDTAPVLSSPDAAVVGTHAAAVMVVVRSGMNTVGEIRETAKRLIQAGAPVDGVLFNGLKLLPERFGFRSKY
GGYRYSRAAYYGDFKQNGPK
>gnl|bykdb|A0A409P464 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=413 residues).
MLEQVVSLDTRISELKMQQAEMDRKFTRQHPAYRALMTQIGELTQQQKALESKAQDLPATQQELLNLTRDVEVASQIYTQ
LLNKSQELDIVRAGAVGNVRLIDTADVDLTNPVKPRKPLIVLIATFLGAFFGVALVLLRKSLSRGLEGPEAIEQLGLPVY
ASIPYSALQQEEDSKKVRAKDGTDKPAYLLALRNPTDLSIESIRSLRTCLHFAGLDSTNNRIMISGPSPQVGKTFVSSNL
AAVMALSGQRVVLIDADMRKGHLHKTLDTPITNGLSDLLVKRCSIEQAINKVEIDNLHFISRGQVPPNPSELLMHANFRE
LLAQLSERYDLVIIDTPPLLAVTDAAIVGRDAGISLIVTRFGVNPAKEIELTIRRFAQNGIELKGAVFNGVEKRAASYGT
GGYYNYEYASDKS
>gnl|bykdb|A0A409P6G9 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=205 residues).
MLSDLKQPHKVLLVTSSIPGEGKTTVSTNLACALGQMEKVLLIDADLRRPMLAKHFQLPIGSPGLANLLAGTASLDDCIQ
QADGVDVLAAGTVPPNPQELLASPLFSQLLEQLSERYQRIVIDTPPCLAVSDALLMSTLADFVLYVVKSDATAVPLVHKG
IGQLLQGNAPVKGIVLNQVDVTAAGSKGGRYDGYYDYYSYSDSPT
>gnl|bykdb|A0A409R088 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=228 residues).
MPFLPVDRPVDVFVEAIRGLRTSLHFTMMGAKNCVVMLTGPTQDCGKTLVATSLAAIVAQAGQKVLFIDADMRKGYVHQI
FSLINSHGLADVLMGKVEYESAIQHYAPGSVDVLTCGQVPGNPSELLIGDGFQQLLRWANEHYDMVIVDTPPILAVTDAS
LVGRLAGTTLLVARFGMTSVKEMQACVKRLHLAGVSIEGAILNDVVKSAAIYYTTGYSQYVYSQAADK
>gnl|bykdb|A0A409SIT6 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=201 residues).
MMEAKNNILMVSGASPASGKSFTSTNLAVVIAQAGQRVLLIDADMRKGFLHRWLNNSAKAGLSDMLSGLIAPDQAVKKTD
IVNLDFVPRGQVPPNPSELLMHQRFADFLRWAGQNYDLVLIDTPPVLAVTDAAIVGHHAGTALMVVRFEVNTVRQIETSI
RRFEQNGVTIKGVILNGMVKKTATDAGYYAFAYPSHQEKVQ
>gnl|bykdb|J9H061 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][gut metagenome] (length=234 residues).
MVQEGNRDVINEAFRVLRTNLEFMVGKDHSSNVIVVTSFNPGSGKSFLTMNLAVSLAVKNKKVLVIDGDLRHATTSAYIH
SPKIGLSDYLGGRIDKLSDIIVTHESHASLDIIPVGTIPPNPTELLFDERLQAAIGNLKQQYDFVLIDCPPIELVADTQI
IEKLAHRTIFVVRAGLLERSMLPELEHIYQEKKYKNMSLILNATEGSGGRYGYRYGYHYGYGNGYHYGNSTKTN
>gnl|bykdb|K1RRH4 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][human gut metagenome] (length=240 residues).
MKSTDLIINVNPKSIFSESIKTIRTNLAFSAIGNEMKVLLATSPAAGDGKSFISANLAVAYAQEGKKVLMIDCDLRRGRQ
HEIFEVMNLTSGGYSNLILNYKEDVNLGKYIMKTSNANVDLLPTGPTPPNPIELLASENNQKLLNELRKLYDIIILDCPP
VIGLSDTMIMTKFSDANIIVVSNKKTKIESLDRAKKIFAQANAKITGVVINKASVKGSSYYSYYSDEYYRDTDSKKKRKR
>gnl|bykdb|K1S5Q5 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][human gut metagenome] (length=371 residues).
DIKNWVSIEAVEDTAIINLTVTTPNADVSYGIANAYVNNYESAINAAFPSTTLTVIDPPLLASAPDRDASAKIYTIVGFA
AGLVISIFAIVLAVIAKDTVKTADDVKDKLGVDVIGMVAHVNRKKKKKGEEYKPLLISDRRSGFPFIETFKIIRTKIEHT
AQREKYKTFVVTSTAENEGKTTSAVNIALALAQNGKSVLLVDGDLRKPAVAKLLGINASEDGGVYGVINGEKTLAEAIKY
SEKYNLFLLVSGKPVFDPSELLSTDAMSDIIKSAEKEFDYIIIDTAPCGVVADASILSSYADGILLVVRNDMVASRRIKR
AVENLENSGTKLVGCIYNDTESGMPKRFMSSYNKKYGYGYGYGYGYGSNQK
>gnl|bykdb|K1SQJ7 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][human gut metagenome] (length=241 residues).
IPQIQAPDRKSKPVLVLGENSSFAVRESYNTIRANLLFTGKGERCPVYAVTSADKDEGKTLNSVNIAISYAQLGKKVLLI
DGDMRNMSVASLLKLRGRLGLSQYLAGLRETPQIVEYRQNLDVLVGGENPPNPSELLGGERMKELLTTLRSRYDCIIIDL
PPVGIVTDALLLSYEVTAYLLVVRAGVSHMSREKSAVTLLEQVDADICGILFNGLPPKSKDCNYRLQQYWQEYKQQNGEA
V
>gnl|bykdb|K1ULC5 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][human gut metagenome] (length=268 residues).
MLDTTIRGRKDIEDNLAVPFLGDIPQYSGEKQRGSFVVRENGRDPVSEAFRMIRSNMNFMNLGKGEIKVIMVTSSNPHAG
KTFVSTNLAMTFATTGKKVVIMDLDLRRRTFSKQMGHDGDTNGVSSYLSGSTELQAIIRKSKLSEKLDIIYAGIQPPNPS
EMLLSQRMEELIAELKLHYDYIIIDSTPAMAVADAIITDRLADLSIYVVREGLLDRRQLPDIERLYREKKFHNMAIILNG
ASSTKRHGYGYGYGYGYGYGLDEEETTT
>gnl|bykdb|W1Y9X6 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][human gut metagenome] (length=239 residues).
MAKRGAYDEGNFELNESYREIRTYVTINKNIKTILVTSAEMDEGKTTIICNLAKCFSELEGVRVLLIDCDFRKRGVSRYF
GIENSFGVSDIVFGNNKKSECIKRVGDLDIITSGGVPSNTSILLNSQSMKDLVSKLREEYDYVFIDSPPICRLNDACIIT
QYVDGTIIVNAAKAIDSKGAKITLDKLNKVGANIIGVVLNKFKAEKYSYYSNYYGYSNYYGEHKHKLFGRKKKRRRKTS
>gnl|bykdb|W1YAG3 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][human gut metagenome] (length=223 residues).
MGRITSLEKPQSNISEAYRTIRTGIEFSNLDKDLKIICITSSKKDEGKTTVLSNLGVSFAKIDKKVLLIDADLRNPSISK
MFDTSNAQGLMDILLGKRNIQDCVKKTKQENLYILTGGTIPPNPAEVLSSKKMSEFIESIKDEYDYIFIDSPPVGVVSDA
SIISAYSDGVIFVVGANEVDSNLAKIAKERLDNVKANIVGVILNKFKTDTNSEYYNYYYNENK
>gnl|bykdb|X0S5W7 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][marine sediment metagenome] (length=433 residues).
QLAPLLLQMAQQGLDKSKQKESILQASLDEARFEAVTHQRDTSHITMLEQNVLRLRRLHDAIIDQIAGVDLRQGHGEIQA
TIIKDATASGQIVSPKISRIIACWILGTLGIGFVLVYVQDTIDDRFRTPEELSKRVGHPLIGLVRALPELSGEGLKKVSA
FGDPVSVFVESFRTLRTSLTLSGVDSTRIAFTSSEPGDGKTTVIANLAVVCAQSGKKTLLIDGDLRRPGLTRLLDLKSKP
GLSDLLNADDEVSDMISDYLASTDAPNLDVLPAGPRRQNPSELLASDRLAQIFAWAETKYDQILVDCPPTLVASDAVLVG
RIVDGMVLIVRPDKNRRKLVFRATQNLTEMKIPLLGLVANGVGAENNKGYSFGEGEGYGYGYGYGDDENNDEDEGEIEQQ
GNGDSYQGISFQSKTSDQSENDQENLPANFRKT
>gnl|bykdb|X0T0M9 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][marine sediment metagenome] (length=326 residues).
AISPLNRTSPNTKVNLAVGLLLGLGLGALAAFLIEQTDNSIKNVSDIERKGINVLGIIPDISKSKSATKKRNITRKTQKT
PKGQEGTINIARDIKRRIITKEDPRSPISEAYRSLRTSITYASVDNPTKTIIVTSPGPGEGKTTTITNLAITFANIGKRT
LLVDADLRRPVIHRIFNLNIEPGVTHYLTGFPRDIRPLIKQTEIKNLQVITAGATPPDPSVLISSKRMHEFIKSLEIGWD
IILFDAPPAIAVTDTSLLAKEINQFIIVVKSGQTDKFAFDRAIQMLESVNAPIAGAIMNAVSPKTSYESYYYYHEYYHYY
GKDKNK
>gnl|bykdb|X1MSI7 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][marine sediment metagenome] (length=237 residues).
MPNKYSDWLVVKSKPKSHVSEAYRTLRTNIEFSNLDKPLNTIMVTSAVPQEGKTTNTVNLALTIAESGKKVIIVDVDLRV
PTIHKVFNSDSKPGLTNVLVYNKKLSEVIKKADEINSNLYYITSGPIPPNPSELLGSEKMKVVIEELKERADTLIFDSAP
VIGFADSLVLANQVDGVVLILNAGMVTRDAAKQAKALLEKAKAKILGVVLNNVDIKREGYYHYYHYYNYSKYYNTEE
>gnl|bykdb|X1SDZ3 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][marine sediment metagenome] (length=270 residues).
LVFLIEYLDTSLRTIEDVEKYLPWPVLGIIPRFEQAFEGKIPHSDIQPVVRKHPKSVPAEAYRTLKTNIQLADLDRPPRS
IAITSAVPLEGKSTTAVNLAVALAQKGSKVLLVDADLRKSVIHKILHLDNSTGLVDLITNHAKPEAAIKEFHSVDNLWVL
TSGSVPSDSSELLGSTQMRSLVEQLTKEYNYVVFDTPPLMSVSDTAVLASQVDGVLMIIRPGKLRREMARRTKELLNRVG
TPVLGCVLNGVEPRDSSYYYYYHSYAGAEG
© 1998-2019