BYKdb

Dataset for cluster tad of phylum metagenomes

[Download (right click)]

1 sequence(s)

>gnl|bykdb|E6PYQ4 [unclassified sequences] Adaptator of bacterial tyrosine kinase [metagenomes][mine drainage metagenome] (length=517 residues).
MTKFPSSNTNQFADNPIRVADVARLIRKYGIYVLGSTMLGAILFAMWAHFQPSLYDATAMIHLDQHSSISLGPSGATGDE
YGLKIQTQIIGLRNPDVAISTMKKLKLSQNPIFNPSLQQDLDNPASRDRLVNVFLGSLKIARVPQTELISVTFRSRNPVL
SAIVVNTLVDEYFEESFEQRYKSTQDISRYLTTRLESLESKIQNEQNELMTSGLKLGIIDIGSGSSSTSGTSSIGTSTLV
VETSGLLDQRVKAQADLYLAEAEYQNLLVHPDAVPPIDVPGSLEMSSLVTSLSTANGQLASIEQRYGSNYPGLGQVQAQV
KSYEHDIADLHAKLLQSAKQNVDRAQSVVDSLNNRINSLKQQSEGATPEIVHYEVLKSQYMSDQTLYNVLLSTLGTGEIQ
AGMQTQVLNRFVTADVPGTRAFPRVGLTGIAGGAGGMVVSLLIISILVFSSDTVETIEQIEESLPVPILASVPEYRDELA
SRSSGEKWNCIDNTAGSTFGQRRSISSASNFDFADAC
© 1998-2019