BYKdb

Dataset for cluster tadcd of phylum metagenomes

[Download (right click)] [Alignment] [Repertoires]

112 sequence(s)

>gnl|bykdb|A0A0F9I1G8 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][marine sediment metagenome] (length=765 residues).
DLPIAPAPVRRDNEEMLPSTEFRQAAPDWEGEEVHLRDYLEVIARRKWLIFGFLALVFISTLIFTLTATKIYKANAVIEA
NRDAPRVTKFEEVTAALASAREFYQAQVSMLKSTTLIQRVIDKMNLGEHPVLSLAKDGKEKKSARASIKEFVRSLIPQKK
EETAKRPVIPKETLKQQGLIGFVNGNLTPILQRNSNLISISFTSPDRHLSQDVVNTLIEEFVRWKMDQKLEASQLAREFL
TKQIYQSKINLEKVEEELNRFARMSGIVSLDTKLNSVYSQLGELNTALARAEAEMIGKRAIYNQAIKDGPASLPRVLSNL
VIANLKADYARLVSQYQDLTTTFLDDYPEVKNLKSRMLSIGERIHIEEKKIFKAIENEYQTALKKRTALQERVSLQKTLA
IDLNERATQYKIIAREVETNKGIYQSLLERAKEIESMVGVSSSNIHIVDRALLPIFPFKPNVRLNLLLAIVVGLMGGIGL
AFLLEYFADTITNPDQISERFQIPILGVVPLAKSGDYVLDKAFVSEPRAPISEAIRTTKVSLQLSGADALSKCFMITSTA
PEEGKTTLAANLAFAFAGSEEKVLLMDADLRKPHLHKIFTQWSDGTRPGLSSYLAGVIDKNLIQKTDIDNLWFVPSGPIP
PNPVELLASNRFTELMAVCNQKFDRIILDAPPHHGFADILVLSRQVGGVVLVSSIGETTRDALRHFKKGILNVQGTILGC
IINKVNLTKRYGYRAYYKYYQAYNYDYGEDNKRKRVKKLKSDREK
>gnl|bykdb|A0A0F9JKD8 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][marine sediment metagenome] (length=721 residues).
MQQQEIHLRDYFRILRKRRHVVLTFFFITLALVILFTFTASPLYKADTRLLIEKSEQYTITEYGFTVYDPEFYSTQYKII
KSRPVARKVYDSLKDNELFIKHFEESPGEGGLAAMIKGLLPGGGPEDEGADPEAAKRKLIVETILENISVNPEVDTRLVT
VSYLSGNPDLARLVVNTLANAYIEALFELRMDSSQRALQWMSRKVEEERNKLDDSESGLQAYMKANDIVTLEDRIAIVPQ
KLLELSTQLTRSETRRKELETLRNKIRSLKAAGKDLDSLPAIASDKTVASLRGQVLKGEQRITEFSKKYGQKHPLMIESV
GDLRVLREKKEQEIGRVVKSVENEYDLALSNEHNIRRLLSETKLEAHGINEKFVKYNSLKREVDTNRKLFESLLQKMHKE
RIEEEGQTVNVMLVETAETPSYPESPKKALNLIIGFMIGILGGAMLAFFFEYFDNTVKAAEDAEEKLGIPVLGMVSHLRR
EKKGKERHIERIVIEEPKSSFAENYKALRTAIMLSSAESTPKTLLITSMGPAEGKTATAVNLALVVAQSVGKVLLVDTDL
RKPRIHNIFGFSNKSGLSTYLVGSNAKIIKEGPSPNINIVTSGPLPPNPSELLGSEKFARFLSSMQERYDVLIFDSPPVL
TVTDSLVLSKYVDGTIVVARAAKTSYEAVRKGLRQLNDVGSNVLGLLINAIDARKGGYYYNYYYYHDYNYYYSAKDEEGE
E
>gnl|bykdb|A0A0F9KY21 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][marine sediment metagenome] (length=747 residues).
MVKLMNSKPIAPTNDQNKSSAQEIDLLALLGTLLDRKYFIVLFTAVFAVIGVAVAIFSTPIYKATALIQVEESSPSVPGL
DDMAGMFESSSEAVTEIELLKSRSVIGEAVDSLKLDITAEPKLFPIIGGKFYIEFTAEKPNDIAEPMLGASSYAWGGEFI
SVFRFVVPKALEGEEFELLVKQNSQYELLNPNGDVVLNGTVGKDEKDGFYELTVRELNARPDTIFTLVKNNRYRTVVKLQ
QEISASEKGKDSGIITLAYEHKNASHAEKVLDKVSDIYVRRNVERNSAEAKKSLDFLEVQLPEVKKQLEGSEQRFNDYQK
QRKSVNITLETQAILEQIVELDTTLQELDLKRLELSRKFKREHPAYQGVIKQIESIEAEKELLTSKVSNLPETQQELLRL
TRDVEVGNEIYMLLLSKTQELDIVRAGTVGNVRVVDAAAVDTTEPVKPKKALIAVVATLLGGFLAVAIVLIQKAMHRGVE
DPSEIEALGLAVYASVPHSDHQDKLSGFAERARKNKTNKPKSILALDNPADLAIEALRSLRTSLHFAMIEAKNNIIAISG
PSPSVGKSFISVNLASVLAQSGKKVLIIDADMRKGYLQTQFGLKWDDGLSDYLSGRLNLEQVTKPTKVEGLSVITRGQIP
PNPSELLMHSNFSKLVEEVSTAYDIIIVDTPPILAVTDPAIVSAHCGTTLLVARFGQNHVREIELTRNRFEQNGIDVKGV
VFNGVVKKASNAYGYYGYYNYEYKSDK
>gnl|bykdb|A0A0F9LFA5 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][marine sediment metagenome] (length=735 residues).
MNQTNENLSNNEEIIDLGSYLNVIKRAKWRILGFATVVTLLAIMVALTLIPKYVATATLLIEAEQTKAVSFDEIYGLDST
KKEYYLTQFEVIKSDSIAREVITKLNLKAHTDFIAKPSVLGELKATVKEQLPFLNKKEVTVYAPEEQAEREMLGLLAVFK
SRLSVSPIRKTQLVQVSFESSDPKLAALVANTVGEVYIESQMRAKMGITQQASSWLNTRLSQLRIQLDNSEVRLQEYREL
QKLVDIEGIAGLVTQELEQISQQLIVARNEKNNLESINRVISEYGNNNLELLGSMPEITSHRVIQDVKREVILVERKLSD
LGEVYGPRHPKIISANAELATVKNNLNKQIKGLITGIEKELNRVTRTVSALERDLVKIRAEYQDITRKETQYNQLKREVE
TNRNIFNTFLSRSKETEVTSDFSSAAARFTDRAYAPNNPVKPNKKLIVILAFVASFGFAVVMSFIFDALNDTVKTKSDVE
GKLAQRMLGLLPHVQTPKNSVFPIHAYLDDNYRRFAESVRTFRTSLLLTQLERDHKVIAVTSSSPGEGKTTTSANLAMSL
AQMGKVLLIDADLRKPSIAKRFDIPVFHPGLSNLIVGTEQLSECIHVDVQSGVTIMPSGQIPSNPLELLSNARFSEVIDD
FKAQYDHIIIDTPPTQAVSDALVIAQSVDSVIYVVKSDITRIKPIKAGIERLFEAKAHVAGIVLNQVDMSKSKDEHSHGY
YDYYDYSQKPEQPNA
>gnl|bykdb|A0A0F9U8M8 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][marine sediment metagenome] (length=724 residues).
MNTSSNTFLETNNTLDLKRYLHACMEYKWRLIFISSLISVIAAFVVMQIKPTYESTATLLIEPEQKNVVSIDEMYGFNTA
KREFYSTQFEILQSKYIAEAVIEKLNLIKHPEFNDEENNLFGLKALFSSFFGEGGTDDELDLEYKMAHLINDFRQRLSVK
PIQGTQLVHITYQASDRKLAAKIANAIGEVYIETHLEAKLGVTRRASAWMSEKMAGLTKQLERSETAFESFRQKNNIVDI
DSAVLRIDSELEKTQATLAIAESDKSKVDSILELINRFGKSDFENLKSLPEIISHSSISEGRVLLETAELKFAELSKIYG
PKHPKLIAASEELDMRVEQVNAQIQSLISGIEKESYTAAQRVKRYRKELSDIRSKYSDITGLDTKYTALKIELDTNRNLY
NTFLERSRETEATSDYKASPAHFTGVAAASLYPVKPNKKMIVAGAFFLSLMFFVGLVILFEMLDDTIKSPSDIESKLSMR
MLGMIPLSKNTALDIRTFFDKEQQQFSEAVRTLRTGVVLSQMDAENNKVIEVTSSIPGEGKTTTSINLAFSLGQIEKVLL
IDADMRKPSICKRFDMPTYHPGLSNFIAGTDTLENCLYQDEQSGITVMPCGQLPPNPLELLSSNKFSKVIEQLKEKFDRI
IIDTAPIQAVSDSLMISKSVDSVIYVVKSDDTHLSIIKNGIGRLLQDKAKLAGVVLNHVDTDKVAKTQGYNGYYDYYSYG
KKNT
>gnl|bykdb|A0A0F9UWR4 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][marine sediment metagenome] (length=740 residues).
MNSSIRPDRQWQPMPSDDDTDYIDLKKIWYAIWSRKWSIISLVVVVSMLATLAVMQMTPVYRASTTMMIEGKGNQLVAFQ
QVYDNTGQLNEYLQTQIGLISSRGVAERVVRELNLVEHPEFDPRQQDQPLIDIRGIIKSLQGMVLGEDPSDGAEPMTEAQ
IMDNVTQQFMQRVSVSVEGKSQLVRISVEMADRLTAAQAANSVANSYIEGQLEAQMEMSMAATTWMNSRLSELRTSLKEA
ENRLQAYREQEGLVDVDGVGTVSANELALTGDRMVDARSQRAEAESQYRQVQAMSEQGWERMASVPAVLGHPLIQQFKSE
QARARARVEELSRRYGERYPAMQAAQSDLNAATASLRAQVEQVVAGIERNYQLAVANEQSVRASFDANKEQIQDISRKEF
RVRELTREVESNRELYETFMTRLRETTSTQDLSTTNARIVDQAIPPSRPSAPNTKLLIIIATMLALIVGVAIALIADFLN
NTFKSAEDVENNLNLPVLGIVPLVAKKQQKKVSHLFEKGDDMRFCEAVRTIRTSVMLADMSRPQKVIVITSSVPGEGKSS
VAANMAFALGQLQRVLLIDADLRRPTLARNFDFPVGTPGLANLIAGTAKVEDCIQTVDAQLDMLTAGAVPPNPLELLASP
RFAKFLERVKDRYDHILIDSPPTQAVSDSVLMSTYADSVIYVIKSESTSISMAQKGVGQLLQSGASIVGVVLNQVDVKKA
AKKGEYSGYYDHYGYSEQNA
>gnl|bykdb|A0A0F9VQU4 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][marine sediment metagenome] (length=742 residues).
MTESVAIEPMSDLSQKSLPEETIDLSRLFGALFRKKWLIIGVTLLFAFIGIVHGMLSTPVYRADALVQVERRNTVSPFGN
VDNVTGSGSGELNTSAELQILQSRMVLGQVVDRVSSDLIISPVQVPFIGGFVLRRGIPRPAFLQGYPHIWGDESINVARF
TTLDSSRGRSFIVERGAGDSYHIMQGDSRLGTGTLGQPEVFLDGELELTVESFNAAEGAQYVLTRLQKTSAIRGIAGRLQ
VAEVGGAGTTTGMIRLMMFGEDPSEITRSLDAVAQTFLTQNIERQSEQAQQSLEFLQRQAPELREQLDLAEQNLNDYRAN
LDSVDLSSEAQAAIQRYIELDTRLDELEFQEAELAQRFTPSHPNYQALIRQRRQIQRDLQELNARVNELPAAQQEVLRRT
RDVEVTQAIYVNILNKVQELEVARAGTIGNIRIIDSAVLSGQVAPNTPRIFILYTILGLLLITGYVLLKELFKRGVESPD
QIERLGLTVYANVPQSSAQRKLNRALKRRGEKTSKSVVGGVLAQRDPMDLSLESLRGLRTSLHFTMMDGRNNRVMLTGPS
PGVGKSFVSVNLGAISALAGKKVLIVDADLRKGNLHHAFGQASTGGLVEFLSGELTLEDIIKPTGIPHYDVITRGVSASN
PSELLMRPGFEQALEDLSEMYDMVIVDTPPVLAVTDACVAGKHCGTTLLVTRFDRNSVREILMAKKRLESSGLEIQGAIL
NGVKISSRGASGYYGYGTYKYQ
>gnl|bykdb|A0A0F9W5Q6 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][marine sediment metagenome] (length=741 residues).
MQTTSAPTANETSDEIDLLALLGALIDHKLTIIACTLVFAVCGIAYALLSTPIYQANAVIQIEEKSQGIGSLLGDAAGGE
MFSSASAATTEIELLKSRKVIGQAVDNLKLDIVAEPKLMPVIGSFFYRRFSPTSDEPLANSFLGFDSYAWGGEQLKIFQL
EVPRAYEGEELVLRAEENNGYTLLNEDGETLVSGTVDQPLDEQGFRIQIETLSAHPGTEFLVTKRNDLSTILDYQRRVGA
SEKGKDSGIISMSLASPHPAKATATLDEISRLYVRQNVERKSAEAQQSLDFLKEQLPEVRRQLEAAENALNEYQASAGSV
DITLETQAVLDQVVELETAISELALKRSEMERRFTRQHPTYQALMEQKRQLETRRDDLLKRVGGLPETQQELLRFARDVK
VSTEIYTAMLNKSQELDIVRAGTVGNVRIIDDAVVDTSQPVKPKKALIVVLATLLGGMLGVAIALLRHALNRGIENPELI
EQMGLPVYAAVPFSKDQQILERGSKTKGNIQGSHLLAATNPADLSIEALRSLRTSLHFAMMEAKNNILMISGPSPSVGKS
FISANLAAIVAQTGQKVVLLDGDMRKGYVHKLLNREPEPGLSNMLVSTHALADIVHKTEVENLHFISRGQIPPNPSELLM
HANFETLLKKLSSMYDLVIVDTPPVLAVTDAALVGRLAGTSLIVTRFGLNPVREIEQTLQRFRNNGVDIKGAIFNAVEKK
ASAYGYGNYGYYQYEYKSDGK
>gnl|bykdb|A0A0F9XPI6 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][marine sediment metagenome] (length=769 residues).
MTETPFNLDYDQKQDRFDLGEILKKYIKYWPWFAASFLLTLAFAVFYLLSTAKIYESVAKIKIVDNSTDIGLQSNAMSLF
TNGSTINLDNQIEILTSYRILSEVVKELQLDVTYYLKGKLKDKQVWDAPFIVVKETSEELKKAQSLSVNFMANDIEVTDS
NGNNFTLFYKQSENALKTSPFRILMIDTLQNLNLIGQEYEVVISPIKNTVLGLINKMEIQTTTKDSDVLAISLSGNYPTK
SELILNTLIKKFNQDGINDRQQVSKRTLDFIDERFVYLSTELDSIEGGKQAFKTRNNLSYIEADAGVSLERKSETENDVI
KLETQISLSALLKNSVVGQAAFELLPVDVGLENSGLNSMVDRYNDQVLQRNKLLQTVGIQHPSLIAISTQLEVAKVNIIK
TINIYQTQLRTSLIQSNQAQNKVNSVFSGLPEKEKMLRSIERQQSIKENLFLLLLQKREEAGISLAVTTPLVKIVDYALT
STTPIAPKKTIILGVSGILGLLIPFVFFYIKFSLNDKIGSKSDVLAIESSIPFLGEIPHFKTEKKFIDFNDHSVLAESFR
ILATNINYMLPKRKDGSGNVIFVTSGYMGEGKSLLAYNLSVAYASINKKVLLIDADLRSPEQHKYFKMDRNTKGLTDYLK
EEEINWKSFIFSGLEKSKNHHVCLSGAIPPNAPQLLSNGAFEKFITNAKEYYDLIVVDTAPAVPVTDTLLIADYADVTLF
VIRAGVTDKAILHGASEDSHRDKLKNMAYVLNDVHARNIKSYNYGYGEV
>gnl|bykdb|A0A0W8FS74 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][hydrocarbon metagenome] (length=812 residues).
MTPNVSIPPSQPLLRSGENAHIYDYLSVILRRRKLFTLAFCAVLFSVVLYTYFMKPIYEASSTLHIKKEKGPGVLVDMNF
DSSNSIDAELEIIKSRTNLEHVAKRLHLDWQVTKKSKDLDFKLLDFSSTAKNPSYKIEMTGADTFTVKDEDGKLIGEGIS
GRLMQAKGFSLLLNDLKGEKGDSFRLKLLPLQNIAVSLKGGFKATEVGNRTNIVRISYSSTDPVRARDLVNTLVQVYLGQ
NIELKTEEASRTVSFIENQLKGLRGELEGAEQDLETYKSSSGMFKLDSEAQEVVKNLSETEKLRAEVIFQKKQVEFALDA
LNSALRKGNIYSPAIMRDDPLVAGLAAKLSELEIQKRTLLTDYTENHPAVRTIQGQIDEIQKKIRSTYETNLVNLNKQQS
SVTHQLDIYESKLRKLPKAERDLARLTRVSNVNAGIYTFLLQKHEEARIAKATTVSNINIVDPAITPVSPIKPDKPKNLL
LGFLVACILGIGLAFFQEYLDDTIKDAEEAKRAIGLPLLAVIPFITSRAENGEAKKRLPLITRLEPKSQVAEAFRSLRTS
LHFSAINRDKKIILITSTFPGEGKSIITANLSNTMAQTGVKVLVVDCDLRRSSLHDKFGVNKVPGLSEVLTGDTTFREVL
HDTGIPGIDVITAGTTPPNPAELLGSEAMRQFLITHRDEYDHIFIDAPPVLAVTDAPVLTTMSDIVLLIMEAGRVPIKAA
QHMREMLSNVQAPVAGFVLNDKTGSGETYGYYGSRYYRYGRYGKGYGYGYGYGYGYYSDDEPNRCKNPQRWEKVLNFIPE
KLRKEIKKRFKF
>gnl|bykdb|A0A160TC29 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][hydrothermal vent metagenome] (length=729 residues).
MNNAAAVEVIDLTHYWHVIRRQMRKIMALSVIATIVAVLVALVMTPIYRATATLLIESEEAKILSIEEVYGLSGQSSEYF
LTQFEILKSRELAKRVVLQLGLVDNPEFNPYHEANGKSFSLREFILGAKEPPTADEVLAKTIENFWQAISIEPVRKTQLV
KISVESQSPELAYTAANAVAEGYIESQMEARVGLTQQAAVWLSDRLGGLKDKLSESERKLQTYREQNDLVDIEGVNTLVA
KETDQITERLIEARSRRLELEGTYRQLQSLAEQTYESLSSLPSILNNPLVVKLRENETNAELKVSELSKRYGPLHPRMIA
AQSDLDAVRDSVFTQMKRIANGIENDFLVAKSKENSLQSALNSTKARIRDMNRTEFELNDYVREVRANRGLYETFFNRIS
ETSVTGDLQTANARVIDPAVLPKEPIKPNKKLIVALALVVSAMFGIALAFLLDALDATVKNAEDVDRKLGVSLLGIVPLI
ASGKRNKKIDPNKLDATLVRAFVEGSDHGFQESIRTLRTSLTLASLENKAQVMLFTSSVPGEGKTTTSTNLAEAFGQMEK
VVLIDADMRRPTVARKLNMPPNSRGLSNAVAYPETLDDCIHHVADLGIDVIPAGPIPPNPLELLASKNFSALLETLKGRY
DRIIIDSAPTHAVSDATYLSTLVDGVVYVVKADETKDKLITSGIARLHDSNARILGVLLNQMDVEKEARYGGHYSGYYDG
YGYTTTEQS
>gnl|bykdb|A0A1J5R1Y0 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][mine drainage metagenome] (length=733 residues).
MDTPTANPAHTTIQGAAQLSEEKLELLTYWRTFVKHKLTIFSLALAVGILAAVVVYMMRPIYRATAMIQLEDNNAKVLSI
EQVYSSLAHGSEHVQTQADILRSRTIAELVLTKLDLVHNPEFSPGRDLTWLAKAKIALGIAHPPTVSDQPGTVLGELRAH
LTIAPVPRSNLIQVSYDSPDPRMAALIANTFAEQYIRNDMENKFRMTQEANSWLNEHLAGLKAKLEASEQRLQTYRNQQN
IIDVNGSALSGTGNQLEGLVTNLVTARMKMAEAASAYQQIRNAQASGTSLDSLPLVVRDPVVAQLEQVVAQKQQKVSELS
KRYGPKFITMIQAQAELQQARDNLKHQVAIVVSSIEHAYNEARANVQALSGAVAEVRGSIRQANEKQFALADLQRDVQTN
QQVYDMFLQRFKETSAATDLTKPIASVVDPATAPVVPLRPHKARVIAAALLVGLLFGIAVAFLLERLDTTVRSTEEVGLR
LGQPILTTLPLLKDHDHIGRRYLADPHSQFAEAVRTARTGVLLSAIDQPHKIVVVTSSLPGEGKTTFAANLALAHAQTKR
VLLIDADMRKPRLGRELGLDDDLVGLSSLASGEREAKDCMRSVPESTLQVITAGAVPPNPLELLLSQRFQETIAALSREF
DLVILDSPPVHLVSDAIILSTLATGVVFVMKANSTPYQVAQRCLRALQGAKATLFGVVLNQLDFKKAESHYGDYSGYGSY
GKDAAGYYMKESS
>gnl|bykdb|A0A1J5RCY3 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][mine drainage metagenome] (length=544 residues).
MQGQALVELHDYLTIVRKRWVSILVATALSLVVAIGVTLLATPTYQASAQVFVSVNSAGTTADLLQGSNYSQQQVASYTD
LVTSPRVLIPVIEKLALGVRPETLANSVTASSPPNSVLIDITVTDTVARRASDIANAIAGSLGTQVSELETPSSGAASPV
KVSTVRTATVPLAPATPKKTLNLALGLLVGLALGVGLAVLREVLDTKVRNEADVRRVTEASVLGSVHYDPDAPDHPLIVQ
SGPQSHRAESFRRLRTNLQFIDVAEQPKTIVVTSSLPGEGKTTTSINLAITLADAGARVVLVDADLRRPSVAEYMGLEGS
VGLTTVLIGRAAVLDVVQPWGNGQLHVLPSGQIPPNPSELLGSRAMVTLLDKLAQLYDLVLIDTPPLLPVTDAAILSRLT
GGALVVVGAGKLQRQQLAEAMGALETVGARVLGLVLNRLAKTPSDSYTYYDYSTETGSTVTKKRSRTAASTSETQRPPAH
TGSRRLVPRTGQIRAVSAAEVAPRGEIDDPMGDLFPPTGPQRTSAWPGERMSGGTTEDWSSHQV
>gnl|bykdb|A0A1J5RUE5 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][mine drainage metagenome] (length=539 residues).
MPVELDEYVLALRKRWLIIAALALVGAVTGWLYAHSMTPNYRATANVFVSVNGGGTAGELVQGSTFVQNSVESFAKLASM
PVVLDPVIEDLQLDTTAKALGRSISANNPLNTVILQISTTDSQPQRAADISNAVARQLAVTVQNLSPRTVAGQSSIELTV
VAPAVPPETPFEPNTRFLSVTGLALGLGAGVILALLLTIFDTRVRTAADIERVIHLPALATIVRARQSQQPATTVAHDPS
SRRAEGFRRLQANLQYLDVGKPLSSVVVTSAVPGEGKSTTALNLALAVAENGKSVLVIDADLRRPAIALDTGLEAAAGLT
TILIGRATLEDVVQPWGEHDGLHVLTSGEIPPNPSQLLDSPAMHRVLDEAVKTYDLVVVDCPPVLPVVDASVLGRHVDGV
LLVIGLRQVRRQQVRSALAAITAVGATPLGLVITNAVDDGAGAPYSYRRPDEIRPHRSQPWRRRRPDEIRQNGADADVDA
AVSSTAGPEDPRTPISPEPREARASAVQNANAAADAPDADVPAGGDGQNRKKNVASPTA
>gnl|bykdb|A0A1J5SM24 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][mine drainage metagenome] (length=744 residues).
MESPEKQQTPSKSSNYGGYAGYGAPYGYGYGPSEGGAGQRTFQDYVLILRERAWYIVAVFLVVFSTALIITLSKTKIYES
SASVQIFRRDPVIMQTQAVMDNEVRSAEDLNTQVKILESEAIIQKVADRLTGNDLAMFKAPYEKDGALSHVPITTILRLN
RKVVPQRLSLVIDVQYDHPDPVVAAKVANLFVDEYIAYNARMRIDESMKAVEDLKVRAEQQRSKVNELALALQAYREKNN
LVSLDQRKDIVTEKLKALNLLLTQSASTLADAQVKWQQVQDCRRQGRSLIDLPFILNSSNDNSGPSLVSQLNQQVAQQEI
DIAKLRERYRDKHPIMVAALNSLAQTKAQLKLAIDAAAAAVQANYQTAQSDYQHAKAALAAQEQESLELDRYGVEYTNLE
RDYNINNQLLQQILERMRETSMTSTIETQNARIVDRGQVAKKPVSPNVPLNLGLGFVGGLGLGLAFAFFVAYIDDRVKSS
YDIESVIGLPLIGIIPEIKKMEQPDKAQIVMNNADRQVAESFLTLHSSLRLKDESKNAKVFLTTSTIPGEGKSFMTTNLA
LTFASHGERVLVVDCDLRKPNIHKSFRLENLKGVIDVVTGTAKLDDVIVKGVYPNLDVLTTGGRAKNPTQILNSKDFELM
ISDLKKRYDRVFVDSPPLAAVSDAMIILPLCDGSLFTIFFNKVRRKAAQFVAHKLTDSNVPNFGAVLNGLNLAVSGYYYA
QYYDKTYKDYYVVMAKQDPDTPER
>gnl|bykdb|A0A1J5SPZ5 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][mine drainage metagenome] (length=725 residues).
MSDVPQQTPPPKPPPPPAAAREEDEIVERRTLRDYYIILRERFWIAFPLALLVSLGVGYYQSRQTPMYMSTATMQFEKPD
RIVTTEGVTNPAVQSEIDINTNIEILKSDRLRERVIHSLTPEEVKILQRPYLKDLPPGASPPSAAAAMPNVDVSAVRNSL
LIRITTTDRDPEAAKIIADKYVDQFMQYLLENVGGKNEYAVDWLTSRAEQLRRESEAAALKLQNFMQAQGMVSLDDSTNL
ITARLQAVSNALTQNQLQLLQLQAQYSQIQQYIQSGQNLLEIQAIATHGEIPSLVSQLMSLKQQQQVLAERYLERYPKMI
DIANQISVAQSQLDKAIKLAVDEIKSQLAKTIDAEKRLEAEKAIQEKAFLHLGDVRTEYESLKNQSDVKRKNYMDILDRL
NQTQTTSNIDKIPLRPLDRAQIAGAPYTPNMGRIIKTCTGLGVLVFLGVAVGLSFIDDRIKSAWDVEHFIGANLLGIIPE
IGQIKDEDKYQLVLNNKPNPGQESFLSVYSSVKIQSKLDFPKSILVTSTIPGEGKTLVSCNLAGAFARHGRNTLLIDCDL
RRPMLHRHYKQANNNGLISWYENGADLESDLLGNPHLGIVKIGENLSLLCSGGRSKTPSELLESNTFAQLLERLKRRFDL
IVVDSPPLGAVTDSLLIAERIDEVIYVCRFNRAYRKHIKLYIKALRSGKNEILGIVLNGLSPRRIEYYSNYRYYRSYKKY
YGAQT
>gnl|bykdb|A0A1W1BK27 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][hydrothermal vent metagenome] (length=812 residues).
MQNIQIEEDEIDLSQLFSTLKKNFFTIVFITLFITSLVVVYSYFLPPIYSSDVKISFSNEEKSSMSSLIPNALADFTATT
EKKLETVKLTLETRKFINSVIKELDINQRYFIEHNYRKDELYAFDNLEVSLNIHDDNFKEKYDGTLYDKLFTIKPIDKKH
FLLSVDAMEYNRTCSYNKLVSNAYFSIKVIKKSYLEDTNYYISQSNPQLLADHILENMKTTILSDNVLQITYTDTVAKRA
KEIVQEIANQFREFTLVKKTSELKKRLIFINGQIGIIENQLQGEGKNLKEYQKKHKTFFTIETNNKMILEKLAEKKEMIE
TLKLQLKELNDFQKSFKKGNLNTVSLLNNGINISSIEPLIERFHAIDIELEDMRIQAKNIEKSLTKRPQLEQLIQRLHKE
KDTLEELNFNFTPTHPQVVKTNNTIIEIENDIRSYIQTDLNRLRKSKSSIKTKIIANINTTKKSIEHKLNIFKHDIQNEN
ALMQTLPEKSLTVQELKRKFTLSENIYTFLLQKKMETQMSLASVIENTQIIESAREGLKPIKPNKKLIVIVGFITSLILA
IFYVFLKSMLDTKIRNEANIKELTDAPLYGSLPNKKHKRFFEEAMRVIRTNLQFIIPKDKQCISILVSSTVPGEGKTTVI
ANLAHIIAQSNQKRVLIMDLDLRKPRLYQELNKSNKLGMTQYLTGDFELESCIQEVNEHLDFFPAGAIPPNPSELLMSEK
FDKTIKKLFLTYDYILFDTSPIGSIIDAKILLPYSDIVLLVVRANVAEKGFIEHFNNLRKETEIQSSGIILNDVKHDKSS
SYGYGYGYGYGV
>gnl|bykdb|A0A1W1CD04 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][hydrothermal vent metagenome] (length=824 residues).
MNEIEEDEIDLRELIDKLKNSLTTIVIITVLFMIGAGGYIYFSKPVYKSSVTISLDSEKKSKLGDMLQDPFSQAGLGKER
LKLAKVTLMSKKFIGTIIDKVDIAKEFFIQRNFRKVELKNFSNLKIDIKYNNNSLYGKFFKIVPYGNQRFLLIIKGINYK
KVHSYSEEIKTKFFTLRVIKVDGENPYKTIAMNENPIESFIASLGLEEESYYFRSFDRDTQENMIIKNMSVSDLSENILK
IEYSDNIPQQTKEIAEEIARSFIEYNLENKTAELEQTLEFLDKQLIEVKSDLKNKGEKLKKHQEKSGSAVMSSGEALLES
IDEKKDLIEKIILQLQEVKNFRASLQNGIMSSVALTSVGIDTSSIQSLIDSYTKSEETIRELRLQQNNITKSVTSNLLIA
ALINELKEKETLLRSLLTDFTEEHPQVIEQKKEVDNMRNKIHGNIVTNIQKLKKNRAIAKSTILNNMLMVQNNLTDKLRL
LKSDIRQKKSLLRSMPKENLVNASLKRNFALNEEIYTFLLQRKIEIEISKASTIANTRVVENAYVAKGAYKPKKTLIMAV
ATIVGFILAIFFVLMRDFFDTKIRTVRDIESLTDKPIYGSLPPLKNERFFKEALRSIRTNLQFVISKNGCTKILISSTVP
QEGKTTISAGLAKIISEADKKVLLVDLDLRKAKLHQELKQKNRMGMSNYLSGDIEIIDIIKPLPNNLDFISAGAKPPNPS
ELLMSEKFNKAINELEKHYDYIIFDTAPIGIVTDANMILKHTDIVLLIVKAGSAEKDFINNFNKMVKDKNIESSGIILNG
VKISKGKNYGYGYGYGYGYGYGEE
>gnl|bykdb|A0A1W1D4H7 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][hydrothermal vent metagenome] (length=778 residues).
MNTMDNKYNDEFDDEIDLRELYKTLLKHKISIFLITFLFFIGSLIFAYYKPNIYSSNMSLEILKENKGGMESSIALNQML
LGSDQVNLENEKVVLQSRFIVQKALEKLDLDTKYYVINRFFKKIELYKDAPFDVKIISLDDMMYGKTFELIPIDSVSFRL
EIKPLSKYSIKGILATLNIISLDEKDKISYNQIHHYNELIKTPYFTIMVDKLKHIDGLKYNFSFIKQDKLYDFYKDNLSV
KNMLKSSSVLELTYQDTVSLRAKEILDAISTTYIATTVKQKTEANGLTLNFIDTQLKVISANLKNSEKNLENYKIHHSVV
DLKTKLEVKTQKIAEYEGEQLELQTEINILNNIKYYINKNKDLTALSIGTVKFTDNRISLLVTSLEALMNRREQLASKYT
QFHPDIVKIDKSIKIAKKAIKKAVQNSLDQLNQRSIDLGNMVVQLNKSLESLPTEEKKLAQLLRPLKVNQKIYEFLLQKR
AETAILKSATIANARILDSARENTTPVKPKRVLIVVVSVISGLIIGIFLAFLREFFTTTLQSLEELEHITSLPIYGVIPY
NKDESTENTYKEAFRNLRTNLQFLPESKNHKIISITSSISGEGKTTISTTLGEMLAKGDKKVILLDLDLRKSSFHTEFEV
KNDVGVSNYLIAQNKLSEIIQTTNIENLDIIPTGPLPPNPSELILSKAFTKMLEVLKKKYDYIIIDTPPAGLVTDAIIVM
NYSDLSLFLVRANYTKKEFIKNIDKLVKEYKENRVGIIFNGATINSQYGYYGYYNYYK
>gnl|bykdb|A0A1W1DYN8 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][hydrothermal vent metagenome] (length=730 residues).
MDTLINTSSNLSTDSNEEIDLQELFGTLVEKKWLIAIITSIIFMASVFYVLIATPVYRADTVLQVEDKSNNMLNLSDLTN
FSASSPTSTEIEIIKSRNIIGQTVDQLKLDILVKPDYFPIIGAAIARRNNDKNITKDNSRTGYAWGGERIQIEQFTLSRS
LQEDGITLIAQDNQTYKLIDTEGGVLLIGKVGELAQANGVTIFISELVARIGTEFSLSKDNRAEIVDDLKKIIKVTERGK
KTGILNISLEGKDRVLISRIIENIANLYLRQNIERTSVEAERSLVFLQKQTPLIKDEMEAAEVELNNYKGYKNSVNLTLE
TQSLLNRIIMIETQLAELEVKHSDLSKKYTDIHPIMITLTNQEVKLQEQLEKINAKAHGLPKTQQEILRLSRDVEVATTI
YTQLLNKTQELKVVKAGAVGNVRIIDTALTAQRPIKPKKLLIVLISTLLGLFLVIAWVLVRRAMNKGVEDSDLIERDIGI
PVYANVALSAKQKLLNKDIITNKIKHAILCEHDPQDSAIEGLRSLRTNLHFALLEAKNNIVMVTGPSPDIGKSFVSINFA
HTIAQAGQKVLLIDADMRKGHIHKEYNLSRSPGLSELITNQVDKKVAVHNSEFKNIDILTTGALPPNPSELLMHKNFGQY
LTEFSKDYDLILIDTPPILAVTDATVIAQLCGITFVLLHYGMHSMSEIRATINRLRQNNIETKGFIFNGIKAHGGYGKYA
HYHYEYKTQE
>gnl|bykdb|A0A1W1E4Z5 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][hydrothermal vent metagenome] (length=730 residues).
MDTLINTSSNLSTDSNEEIDLQELFGTLVEKKWLIAIITSIIFMASVFYVLIATPVYRADTVLQVEDKSNNMLNLSDLTN
FSASSPTSTEIEIIKSRNIIGQTVDQLKLDILVKPDYFPIIGAAIARRNNDKNITKDNSRTGYAWGGERIQIEQFTLSRS
LQEDGITLIAQDNQTYKLIDTEGGVLLIGKVGELAQANGVTIFISELVARIGTEFSLSKDNRAEIVDDLKKIIKVTEKGK
KTGILNISLEGKDRVLISRIIENIANLYLRQNIERTSVEAERSLVFLQKQTPLIKDEMEAAEVELNNYKGYKNSVNLTLE
TQSLLNRIIMIETQLAELEVKHSDLSKKYTDIHPIMITLTNQEVKLQEQLEKINAKAHGLPKTQQEILRLSRDVEVATTI
YTQLLNKTQELKVVKAGTVGNVRIIDTALTAQRPIKPKKLLIVLISTLLGLFLVIAWVLVRRAMNKGVEDSDLIERDIGI
PVYANVALSAKQKLLNKDIITNKIKHAILCEHDPQDSAIEGLRSLRTNLHFALLEAKNNIVMVTGPSPDIGKSFVSINFA
HTIAQAGQKVLLIDADMRKGHIHKEYNLSRSPGLSELITNQVDKKVAVHNSEFKNIDILTTGALPPNPSELLMHKNFGRY
LTEFSKDYDLILIDTPPILAVTDATVIAQLCGITFVLLHYGMHSMSEIRATINRLRQNNIETKGFIFNGIKAHGGYGKYA
HYHYEYKTQE
>gnl|bykdb|A0A2H9T6C5 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][invertebrate metagenome] (length=736 residues).
MPNEMTQSRPTVADDDVISLSEILDILIKGKWWIAGATLFFAVCSLAYLWVATPVFQSDALVQVESQKSPVGALVDMSDM
LGSESPSEAEIEVIRSRFVLGEVVDDLTLDIVAKPDYFPIIGQAVARRFSPDAEANEPLNSPWLWFSGYAWGGEAVKIER
FETPDSQIGKTYTLVTGENNRYELYDEDDEKILVGKVGLSAVSRDNQVRLFVSELIARPQTRFNVIRQPMVTAINHLSKR
LSVSEKGKKTGVLSLSLSGPSSVHNSHILEAIIQRYVRQNVERVSAEAQNSLKFLEHQLPDMKKDVELAESKLHRFQQEN
QTVDLTMETQAVLDQAVDIDTQLAQLDMQIKQMGQRYTKSHPVMEELQLQRQLIVDRKNKFSDEARGLPKTQQEVMRLAR
DVQVNTEVYTELLNKAQELKIVKASAVGNVRILDHALSAIEAVKPKKSLIFVLAVLLGAMLGTGFVFLRTMLRQGVKTPE
EIESKTGLSVYATVPVSEQNRLLERNSHKNGDSCLLACSAPDDLAVESLRSLRTNLAFAMMEEKDSRIMITGSSPTVGKS
FVSANLALLLAESGKKVLLIDADMRKGRLHHYFAVHRGKGLSDILAGNADSSAIRGINEKCHLLTAGRIPPNPSELLMSQ
SFSAFLEKASDVYDVVLVDTPPILAVTDAAIIGRQCSQTFLVAWAEKNTASEISYAAKRLQQAKVNVKGCILNGMVHTSS
RYGQYGYYHYAYGDKA
>gnl|bykdb|A0A2H9TBF4 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][invertebrate metagenome] (length=763 residues).
MQQSTDVSAQGTAASQDEDIIDLRSLFTTLFHYRWAILGFTLIVTLLTVLVVFSITPKYQATAVLLIEQEQAKVVSIEEV
YGIDGGGDSYLNTQHEVLKSRALVEKVVKKLNLIDHPEFNHALREEPWYVSMMNWRQWLGLALPQDTVSGETILNRTIDA
FAENVRIEPVRKTQVARIHVMSEDPQLAATAANAMGEAYIESWLEAKLSLTTNATRWMQDRLQDLSEKLKTAESQLHKFR
VSEDLVDIEGVLTISTDELKALTESLVETRRKLTLSENIYRQIQDGKNLQADQYQSLPAVLAHPLVQQLKQREAELEQKV
RELGRRYGPKHPKMIAANTELESISNNIRLQVQRIVLGVENEFEVARANEQSLVAAMTTAKQAVQTINSKQFRLKALERE
VRTNKDLYDAFFKRIQETSATSDLQSANARVVDRAFTPEHPVKPKKKLIVGIAALLSLLIACGMAYLLEMLNNTIRTAKD
VEDQLNLPVLGVLPEVDIKASSVPVSQLFINKDISKEQRAFVESVRTIRTGLNLSLMSVGQEAHKKIIAITSTMPGEGKS
SVAANLSSALGQLGSVVLVDGDLRRPTVGKNFSIKGGSAGLANLLSGHAQMNECLHPRNSIMVMPAGMMPPDPTQLFAEE
KFKNVLSQLSERFDTVIMDCPPMQGISDTLMISQLCDAVVYVVEAGRASKTAISHSTGRLLQNSVPLTGVVLNKVNTRRG
HEDGYYGYYDYHGYSDGHQDNKKHPDAQGKRIKTAEIEPESVV
>gnl|bykdb|A0A380TDI0 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][metagenome] (length=752 residues).
MDQRLTTATQSEPAEPRRRPLAALDSELRETIRSFWRHKWAILGVVVLLTGIAVLYVQTATPRYTAELQVVFENKTGPLF
DFQAAVAGAPQDEASILTEIEVIRSRKLADRVIKALQLDQDPEFNGKLRPPSAFATFFKDTLGLNLFPARAPNETDPTQL
TVEELRDKENNKIIDAVLEDVQAKQIPRSRAVVINFTSESPRTAARVLNTLSELYLVARLEDKFDNAQRASSWLAGRIQV
LREKVEASEREIEAYRKRHGLFEGRATSLVTEHVSDLSSKLTDATIERRAAEARLAQVRNLKNAENVDTAVQVLDSALIQ
RLREQELELERKEAELGQNLGARHPAMIQLQAERQRFREKLQAEIGKIVQRAENEVVVARGREAALQRDLASVKGDMVQS
NQASIGLRALEREADANKLLLEQFLASFMQASAQEDMRAQLPDARVVSPAAMPDKPSYPRKVFVVMIAFLGSILVGGLLA
LTLESLDAGFRSAEQIEAVTELPVMAHVPLLTAAKGGGDRPETFILKRPDSAYAEAIRSLRTRLLLAFGDRPPQVVVLTS
AEPDEGKSTLGLSLVRAQAQADRRTLLIDADFRRSRLTTRITGISAQPGLYEVLSGQATAEDAIQSDPTSLADLMVSGAS
SADRKVLGDAARLEGLLAKLRGRYDLIVIDAPPALALAEGQVIPMVADATLLVVRWGKTRKRVVRYTMDQLTRFGMPLHG
VVLNMVDVRKQAYYGYGDAGYYYGKRAKYYTS
>gnl|bykdb|A0A380TDN3 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][metagenome] (length=752 residues).
MDQRLTTATQSEPAEPRRRPLAALDSELRETIRSFWRHKWAILGVVVLLTGIAVLYVQTATPRYTAELQVVFENKTGPLF
DFQAAVAGAPQDEASILTEIEVIRSRKLADRVIKALQLDQDPEFNGKLRPPSTLATFFKDTLGLDLLLAKAPDETDPTQL
TVEELRDKENNKIIDAVLEDVQAKQIPRSRAVVINFTSESPRTAARVLNTLSELYLVARLEDKFDNAQRASSWLAGRIQV
LREKVEASEREIEAYRKRHGLFEGRATSLVTEHVSDLSSKLTDATIERRAAEARLAQVRNLKNAENVDTAVQVLDSALIQ
RLREQELELERKEAELGQNLGARHPAMIQLQAERQRFREKLQAEIGKIVQRAENEVVVARGREAALQRDLASVKGDMVQS
NQASIGLRALEREADANKLLLEQFLASFMQASAQEDMRAQLPDARVVSPAAMPDKPSYPRKVFVVMIAFLGSILVGGLLA
LTLESLDAGFRSAEQIESVTELPVMAHVPLLTAAKGGGDRPETFILKRPDSAYAEAIRSLRTRLLLAFGDRPPQVLVLTS
AEPDEGKSTLGLSLVRAQAQADRRTLLIDADFRRSRLTTRIPGISAQPGLYEVLSGQATAADAIQSDPASLADLMVSGSS
SADRKVLGDAARLEGLLATLRSRYDLIVIDAPPALALAEGQVIPMVADATLLVVRWGKTRKRVVRYTMDQLTRFGMPLHG
VVLNMVDVRKQAYYGYGDAGYYYGKRAKYYTS
>gnl|bykdb|A0A380TGM5 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][metagenome] (length=744 residues).
MQMDRPNLTPAYPSVWAAERSYDIRELTRIVRRRKSIVIGTVTLILALTVFFLSQLTPTYRAEALVIVESRKANIADLRE
ILTDVSANQETTRNEIEVIRSRTLARRVIEQLGLAERDEFTSSRSRSLLEIASKAAALGGKDDTNPGSADRQALEARAAR
AASLDEVVDEFLKHLDVRPTKASRVISVRFQSRDAQLAADVANAVADTYTNRFIETKIAIAEKATGWLKGQVKALREAVA
RSEKAVEAFRTQSGLLRGSQVTLISEEISEINRRLAAASADRAQATATLNEVQALQKASNIEAAQAIMESPVVQQLRIQE
AAVLRELAELSIELGERHPRVINKKSELEKFRAKIEAEMERVLKGYATAVSVATAREDSLERELNKLKSKQALANSREIE
LRELEREAEANRKLLETFLTRLKETTPQLDTEMQVPGATVLSPAAVPLRSLPDKRIVLAVATIIALLLGLGLALMAERLD
YGFRHAEQVSEATGLPVIAHLPVARSGRDGPEAAMLDSQPSLFLEGIRSTYIQLALRSKRPAIRSLLVTSSMPKEGKTTL
AIGLTRARAIAGHRALLIDADLRRPSVHVRLKLAREPGLVDLLVGDASLEQVLQRDEPTGAFVIASGSAARDPSDLLGSK
AVKAFLDQACESFDLVVLDSSPLMSVSDACNLAPLAEETVFVIQWGKTGREVVKLALEKLTETQGVPRGIVLSRVDTAKI
RLYGYGDAAYYDRTVREYYTRGSA
>gnl|bykdb|A0A381Y0U7 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][marine metagenome] (length=733 residues).
MDKIPSTEQSLPSTEQSSDKLHILDYWRIIRVRFVVILLVFLITAVTTTVVTFLLPPTYMSLSRISVEKETSDIAPLLGM
QSGPTAFDPYFIQTEFEKIQSQKVLDKVVTKCNLTESLVLGKTLNEREARKILEKSIDVRQYRNTSIIELRAYDRKPTKA
QEIAQALASEYQDHRSSLHKVAVQKGIDSLKSRMGEMNTEISDMQSNVDKFRTDLGISDAAGEESYSIIEPEIVRRYEVE
LIAAKGVHTTQSSLLDGLKAQSAEELRASILTAHPDAQLDALTREFHTGQQTLANQSIDLGDQHPRIKGLKKVVATLEEQ
IDNRIKGILAGLELRVNSSMAQVEQLKRDVEDAKKRESDMREKGREYFNAKRELANTTRIRDTILLRVMQEEVDLELGSK
ESSVEIIDEADLPIKAVRPNIPLNISLGVVVGLILGVGLAFFIEYLDTSVKTIDDVERALGAAVLGVIPQNVGSLLEEGD
ESPHAEAYRVLRTNILFAGRKSEKQTTFSVVSGGAGEGKTTTMFNLAVVFAQQGDRILIVDSDLRRPSMHRYLKVSNNIG
LTNYLLGQVAIDEVIQTTELPSLHFIPSGKLPSSSMGILSSAKMKEFVAEMKSRYDYVFLDAPPIMGVSDASVLASMVDM
CVLVVQYRKYPQLMTQRAKGMVTKVGGELVGVVLNNINISQDSYYYYYSGYYYDYYYKSREKEESADETQDGEKEAKLVA
NADIGGEDEKPKY
>gnl|bykdb|A0A381Z3K5 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][marine metagenome] (length=725 residues).
MDKTPSTDQSSDRLHIMDYWRIIRVRFVVILLVFLITAVTTTVVTFLIPPTYMSLSRISIEKDTSDIAPLLGMQSGPMAF
DPYFIQTEFEKIQSQKVLDKVVAKCSLTESLVLGEVLNDRAARKILEKSIDVRQYRNTSIIELRAYDRKQKKAQEIANAL
AEEYQSHRTDLHKERVTKGINALNKRMEEINEDITGMQSKVDRLRTDLGISDAAGDESYSLIEPEIVRRYQAELITAKGV
YTTQATLLAGLKDQSVDELRASIMTAHPDAQLDSLIREFLTGQQALANQSIDLGDQHPRIKGLKKVVAILEGQIDARIQG
VLAGLELRVKSSKAQVDQLQQDVSGAKTKESEMREKGREYFDAKRALANTTRIRDTILLRVMQEEVDLELPKESTVEIID
EADLPIKAVRPNIPLNISLGVVVGLVLGVGLAFFIEYLDTSVKTIDDVERALGAAVLGVIPQNVGSLLEEGDESPHAEAY
RVLRTNILFAGRKSEKQTTFSVVSGGAGEGKTTTMFNLAVVFAQQGDRILIVDSDLRRPSMHRYLKVSNNIGLTNYLLGQ
VAIDEVIQTTELPSLHFIPSGKLPSSSMGILSSAKMKEFVAEMKSRYDYVFLDAPPIMGVSDASVLASMVDMCVLVVQYR
KYPQLMTQRAKGMVTKVGGELVGVVLNNINISQDSYYYYYSGYYYDYYYKSREKEESADETQDGEKEAKLVANADIGGED
EKPKY
>gnl|bykdb|A0A3B0V744 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][hydrothermal vent metagenome] (length=784 residues).
HDYPLNFGVKIMVQFNQNIGNNPPALEEENHDIDWIKLRLILRKGIPWFITIFVLLILVAALYLRYTKPMYQSNSEIKLD
QEDQSNVLGLPQYEQSSNMGLLSSEMEIIQSRLFFNKVVETVNLNPQYFTYGNILDDEKYLNPPFKVSYKILNASIYNIP
IDVIVINQKTFQLNYTVREKEYSLNARFEDSVKTELINLKIELNESWAIEDGSRFYFRINSREVLINYVESNLSVEPLNF
QANTFQISFTDHNLNKAHALVSAIDTLYYNYSLQEKTKANRNKIDYLDKQLEETEKKLDNFETYFEDFTIDNKTVDLNED
VRRTVDAINGLDSQRIKIDNKLSELELLQAKLSKTPYENLTPKVNVYPNYLNRAFDEFNLLKNDLQKLGLSYKENTYTFK
SRQKEVELMRADILAEVNDYKQDLQKQKSNLVTTKQQLRRQLISLPSKNTEYNKSKRFYSVYEEMYLSLMQSKNEFEIAI
AGSITKIKILSPASLSNTPIYPVPLFAYATAVILSIVLSFLFAGVMYLAHNKIQSLHEIEFLTTATTLGAVPKHNLNGKV
AKIIVDKHPKSAVSEALRSIRTNIEFMIPDKDSKVLSVTSTIGSEGKTFISTNLGALLAMAGKKTVIVDLDLRKPKIHLA
FEQKENANGVSSILIGKGKIEECIQNSTIQNLDFITAGAIPPNPSELILRKEFGEMIENLKLKYEVVILDTPPVGLVTDG
LLAMQKADLPLYVIKADFSKRSFVQNVNRVLATGQFNNLSIILNATTTSETGYGYGKKSAYYET
>gnl|bykdb|A0A3B0VME9 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][hydrothermal vent metagenome] (length=775 residues).
MNNQTEPIDNAGEDRQTMVPAGDTHLPSTRVHEIMPPVEEEINLRDYLDVILRRRWVIILTLLVTFSLVAVFTFSSTPLF
LAQGTLKASPRVASITSFKGIAQGMDESFMQSKEFIATQVKLLKNEGLLIKLIKKMDLQDNILFVGKKDNDTGHGILGGV
KEAFASLKNMIRPRLDSDPANKMNRKVQENITLDNNLGKIKNSLTITPVRGTQLIKISFQSPHSGLAADIVNNLMKEFIQ
VNAEQKLAAFHSSGVFLDKQVNASKIKLEKSEQELNGYARRTGIISLNSKLNLVMGQLEAVNDALAQAVTARISKESLYL
QTKKNGGENMPQVLNNPLLQNLKKQYSDLRSQYEVLSTVFKDQYPKVKKLKAQMKDLRNRYAQEQQLILDSIRLAYEEAL
EKEKRLTTKAEAQKKLAIELNSRATQYKILRREVATNREVYSSLLSRSKEIEASAGSDNGNIMIVSMARPPLYPYKPKVA
RNLLLGIVLGSFAGVGLAFVLEYLDDTIKNPDEFPQRYHIPVLGLIPFKDAGKTDDEFDEIALTFYNEPKAPLSEAIRTA
MVAINLSTAATPPKTVLITSVLPDAGKSTLASNLSLSLLASSAKVLLIDTDLRKPGLHKIFGQKDNSIGLSSFLAGTADI
DEVIMKTEFPNLFFIPSGPIPPSPAELLASSTMRAFIAAAAREYDYLILDAPPFHGFAEILILSNMVDGVILTTQLNRTP
RDGVEYFRKAVTNVGGRILGTLVNKVPTGKTGSRYYGGYKYYKYYSYDYEYGRDA
>gnl|bykdb|A0A3B1AK25 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][hydrothermal vent metagenome] (length=737 residues).
MQENKAQQPLEEDEIDLREYWRVIMRHKSSIFGLAFLAAILSALVVFAMKPIYSSTVTLLIEPGSANVVSIEDVYGDSDT
STYYKTQHEILESRLLITKVIAKLNLQENPEFLPDESEPLISIDWRAWIKELLPDNTIPEEPGIDEYEAFNAELIKDFSA
RLSVAPVRKSQLVKISFEANNRKLAAQVANTLANTYIESDMEARLEMTSTASNWLTERLVTLKSNLQQSENELQAYREKE
ELLEAGGVSTLSTRQLQDLNEKLVLATQQRATAEISLKQIKSLAGESPDKLGAIPAVLNDDLVGSLKHSESDMQREVSAL
AKRYGPMHPEMIQAKANLAKATQNVNRRIRSVTNGVEKEYQIAMAAESSLKRSLQRAKGEMQNINRKGYKLGVLEREVES
NRQLYKLFLNRFKETKETSGLEQVRARIVDPAEPSIKPIKPKKQLIVLIATLISGFLGILLAFLFEHLDNTIKKASDLED
RLHLPVLGLLPKLDLKKHKTASPLSYAKGNKQSFFSESIRTIRTAMLLSGLDDPYKVILVTSSVPGEGKSAVATTLAESM
GELHKVLLIDADMRRPTIAKTWDFDPRSPGLSEFIAESAQLSECVYQIQDSNVHIMPSGTVPPNPLALLSSNRFTTALDH
LGKNFDHIIIDSAPCLAVSDALVLSRCASGVILVVKADATPYPVAQDAIKRLHQSNARIIGGVLNNVSKSKKGGYGNYGK
YSYYDGCYYGSYGYTND
>gnl|bykdb|A0A3B1C250 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][hydrothermal vent metagenome] (length=1032 residues).
MPGYNKDENSGGYVEPYQNSSDADGDEINLSEYWYTIKRNKWGILGLAFVATLIGVLTAFSMKPIYRASVTILIEPEQPK
FVSVIPMESGSNINYFYATQYKIIRSRSVAESVIDKLNLAEKEGFADLVSKKKTGFIEEYLPASWFPEKREATEEEKKRR
LIAYFSSNLRVVGYKNSQIAIINYEAYNPQLAADIANAVAAAYIETGMESRLMMAKQATSWLTEKLSLLRTKLEESEKTL
QRYQAREGVVDTKSQKSIINRKLVSITEELIKAQTRRAEAEIRYMEIKNVKNERGYESIRAVLRHPLIQKLKEEESRMAR
RVSELSKRYGKKHPKMIAAISDYKEARRTVRKEVKRVVDGIRRDFEAAVANEKELRRLSNTTEKDARRIKGKEFEMAKLE
REVSANRQLHDLFLTRFKETNMGENANVTNVRIIDRAEPPMRPHKPKKSRIVGLALFIGIFLGVILAFVQEHLDKTFRNT
DDVERFLTLPVLGSVPTVKKGGDDAFGPEWHSLANPRSPFAESVNHIRTSVMFSNIDNPPKIIMITSAMPSEGKSTLATN
MALAYSNLGKTLLIDADLRKHSLTEFLDSNSNGLGLTDLVSGQNTFQDCIRRLKLSKNLYILTSGATPPNPLEFLSSRRL
ANTFNQVKKAFDTIIIDTPPILLFSDAMVVGQLVDCCILSIRSDQTTHNMAQDAVKRLTSSQLKPLGVVLSYANTKGGKS
YGGYYGDYYGDYYGAEFDEDEDDFITKKSNKSRRGKRKGRSLATVGGIALALTIIAYFLWNPDKSLLSALPTLDIGIGST
AEEPKGEALSKPWSPQTGAKGDPSVKPEPAQKNSRTMKPNKPKAKPTAKKQPIAKFSTPRSGSAKPKPIPAILTLPAADG
KSLQGKRVEIVASSTTGDTRVTGGGFGSSTAAGDMSKWIGEGWEKMNTEGIEAACPVWEAGLRSSTAESVVLIVGRYSGL
TKAKVPLELLGEELPIFAVCAKYRGKNAYYVLAAPSPANLKKTQKIIRSRLNIKSVKGNYPQKLVRIIDRGR
>gnl|bykdb|A0A3B1C7A9 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][hydrothermal vent metagenome] (length=747 residues).
MDNEFDNNIQEETHSIKDYFNLIRINIIPILLIGLTGLAVSVIYAFTARDIYTASTALKIQKPQAGGILSSPLLPEISDF
GNDRFIANEIEILKSRRLRDIIASALIDSFNTVNNPDSFYVLLDHSFDLEDNGVKLKSKYDLMEMLDKVKIEQKRGLDIV
EISVESPVPYEAQMIANCYAQSYEKLNLKYTRQQLSKVVAFLQKQRTKKYQELLVVEEKMKKFQVEGRIIALDDQAKALI
DILSTFEAQRDATSLELSQAEENIKQYKEEMNKQNSSISKYIENYATEPRMRALQEEIARLEMERDVAMSDTTMSATRKE
LLVNKNRTIRDLRKQLNEQLKIYKESIYAASPAELKELSLKLLTEEVRYKSLQATYQNLNKIIDNYESKFNELPNRTIGF
ARYQRELNAYEKLYLLIEEKYQEALISEQSTPGNVLIIDEAQRPVKPSKPNRKLIVVIGLILGFGFGVGFAFVRDYFDNT
VKTPEDIEKENINVLTWIPKIEGVETNKEFEFIIHEKSDSIYSEAFRVLRTRIQFSKLNNGGVKVIHITSSTPQEGKTTI
AINVAGSFAQTNKRTIIVDCDLRKPRVHTVFKEQRFPGFTDYFLGHTDLESVIHKSKLPNLDFITCGTIPPNPSEILGSQ
QMVDLLARLKTKYDLIVLDSPPIIAVTDSEILSRIADTTILVAASGETEIELLKKSAELLQHDSDSFIGVVLNKFTFKSG
YGSYYKYYYYYSNNKDAKKKKFFSKKT
>gnl|bykdb|A0A3B1CUQ0 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][hydrothermal vent metagenome] (length=772 residues).
MSQLEHTDDVEEREIHLNDYIEVLLRKKWIVISCFVVIVLATGIGTYLATPIYEATTSILIDDSKGGGQALFTELAGLPQ
TSEIPSQIELIKSRTIAEEVVRKLKYDQRVFDISGDLDPRVTNLQIPQKFIDEEIKVEFTDSKGNFTVTKEGESLGRGIV
GTPFKSDSGLYFDLKEVNPYKGASFKIKRSRFYEAVEDLQKKVTVSPVRNTNIVYIKVQDSDPRMAAAIANSIVKRYIQH
DISKRSKEATYMIKFVKKQIEPTQKKLENALESLAAHKRNSRVVYLKEGTKKLIENIGALEQEKTNLDIKEQQVRYLYDE
VQKNITDTSTLNLSVLEDTVVQSMISSLAMLENNRKSLLSEYTARHPQVVALSAEINEIKKRINASILNTLDSLRTKKES
FSKEIGRLRAELKVLPEEEKTLAGLVLNKEVLSNINAFLFQKLNEATITQASTISSIQVVDPAIVPKKPIKPQKKRNILL
AVVVGLMSGVGFAFFFDYLDNSIKTPRDVEERLGLPVFGHIPLVQAEETKKPLSGGNSNSGLITINSTKSITAESFRSLR
TNLQFAVPEKRGRVFHFTSTMQGEGKTTITANLGVTLALMGSRTLIIDLDLRKPRIHHIFDINREPGITHLLAGKSDFKE
IIRPTATEHLYVIPAGIIPPNPSELLSQQDLRDFLDKTRKEFDYILIDSPPVLPVTDSLLLGRLADASFIIIKLGETSFP
AVEQAVKQLRSVDVNVAGAIINKIKPSAGYGYYHNYYHYYYGDESPEEKKNT
>gnl|bykdb|A0A3B1DSR1 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][hydrothermal vent metagenome] (length=765 residues).
MNTQNNLSEFDQTGLTESSGFEIDLLSLASRHWKLLLLGLIVGLVLGELYYRKAGPEYDATARILVEKKVSVQLKDGDAK
IYGDRAEHIKLIMSPLIVNIAIENQNLDKLPSLLGEENPAGEILDTLVVKRTAGRDRSFSNVLDLSYRNRYKEDAKTILS
AIIEAYQEYLTRNQNKNQKKSLELITQANDELEVKLNKKKEEYQKFRDNAPLYWNAAPGVKGVGSSVTNVHRDRFLKLEE
KRREVVTRQAETKARIISLEEAVAARQSPKKLERMVRIFLSYQTGRGGQSAATQLNPDLVTLESRLVPLVLRERSLLREF
GKDHSDVIGIREQINALRDIYRQKGIDISESGITDEGIEEGAVKIDFVALYIQSLKQLLVELKQRKLTFDELIALESQES
KKLSRYLMEDQTHSDEIERLKTIWQIAVDQLNRTTLSKNHSGYSMEKMAPVRAELSFKRHLKFLGGGVVGGMLVLFGFIY
LRAFLDTTVHTVNDIRDNFNLPILGAIPEFAPIATKELKQIDSHKIAPELYYFHKPGSIEAESFRSVRTALYVIAASDKA
QVIQVTSPLSGDGKTTLIGNLAVAMANSGKSVLLIDADMRHRSVHLLFGLRHNIGVSDVLTGEIEFLNAVQKTGFKNLSA
LTAGEEPENPAELLASPTFKKMLSEAKSQFDFILIDTPPLLAVSDPCIVAPQTDGLLLILRLKKDSRADITRAAELLDTH
NIDVLGAIVNGVEISPDEQTYGNYYSSEQQEETKNNLAEAMVSQS
>gnl|bykdb|A0A3P5W345 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][metagenome] (length=744 residues).
MQMDRANLTPAYPSVWAAERSYDIRELTRIVRRRKSIVIGTVTLILALTVFFLSQLTPTYRAEALVIVESRKANIADLRE
ILTDVSANQETTRNEIEVIRSRTLARRVIEQLGLAERDEFTSSRSRSLLEIASKAAALGGKDDTNPGSADRQALEARAAR
AASLDEVVDEFLKHLDVRPTKASRVISVRFQSRDAQLAADVANAVADTYTNRFIETKIAIAEKATGWLKGQVKALREAVA
RSEKAVEAFRTQSGLLRGSQVTLISEEISEINRRLAAASADRAQATATLNEVQALQKASNIEAAQAIMESPVVQQLRIQE
AAVLRELAELSIELGERHPRVINKKSELEKFRAKIEAEMERVLKGYATAVSVATAREDSLERELNKLKSKQALANSREIE
LRELEREAEANRKLLETFLTRLKETTPQLDTEMQVPGATVLSPAAVPLRSLPDKRIVLAVATIIALLLGLGLALMAERLD
YGFRHAEQVSEATGLPVIAHLPVARSGRDGPEAAMLDSQPSLFLEGIRSTYIQLALRSKRPAIRSLLVTSSMPKEGKTTL
AIGLTRARAIAGHRALLIDADLRRPSVHVRLKLAREPGLVDLLVGDASLEQVLQRDEPTGAFVIASGSAARDPSDLLGSK
AVKAFLDQACESFDLVVLDSSPLMSVSDACNLAPLAEETVFVIQWGKTGREVVKLALEKLTETQGVPRGIVLSRVDTAKI
RLYGYGDAAYYDRTVREYYTRGSA
>gnl|bykdb|A0A3P5WKD3 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][metagenome] (length=752 residues).
MDQRLTTATQSEPAEPRRRPLAALDSELRETIRSFWRHKWAILGVVVLLTGIAVLYVQTATPRYTAELQVVFENKTGPLF
DFQAAVAGAPQDEASILTEIEVIRSRKLADRVIKALQLDQDPEFNGKLRPPSTLATFFKDTLGLDLLLAKAPDETDPTQL
TVEELRDKENNKIIDAVLEDVQAKQIPRSRAVVINFTSESPRTAARVLNTLSELYLVARLEDKFDNAQRASSWLAGRIQV
LREKVEASEREIEAYRKRHGLFEGRATSLVTEHVSDLSSKLTDATIERRAAEARLAQVRNLRSADSVDTAVQVLDSKLIE
RFREQELELERKEAELGQSLGARHPAMIQLQAERQRFREKLQAEIGKIVQRAENEVVVARGREAALQRDLSSVKGDMVQS
NQASIGLRALEREADANKLLLEQFLASFMQASAQEDMRAQLPDARVVSPAAMPDKPSYPRKVFVVMIAFLGSILVGGLLA
LTLESLDAGFRSAEQIESVTELPVMAHVPLLTAAKGGGDRPETFILKRPDSAYAEAIRSLRTRLLLAFGDRPPQVLVLTS
AEPDEGKSTLGLSLVRAQAQADRRTLLIDADFRRSRLTTRIPGISAQPGLYEVLSGQATAADAIQSDPASLADLMVSGSS
SADRKVLGDAARLEGLLATLRSRYDLIVIDAPPALALAEGQVIPMVADATLLVVRWGKTRKRVVRYTMDQLTRFGMPLHG
VVLNMVDVRKQAYYGYGDAGYYYGKRAKYYTS
>gnl|bykdb|A0A3R1GLT3 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=736 residues).
MTTNTRIPAQDDTDEIDLRQLLGTLIDHKWWIAAITGGFFVAAAAYALLATPIYRADAIVQVESKVPSLPGLSDLSQSLG
IGAGSAEATTEIALITSRAVVGSAVNALRLDIEVEPNRFPLFGGYFARKAERSAPDALADTRFGMTRFGWGGEKLDVFQL
DVPRKLIDRPLTLVAGDNSSYELFDEQDNLLVRGEIGKVAAGQGVTMQVAEIRAHPGMRFEVTRHRHLAVVNDLQKKVSV
SESGKDSGILTLAFENADPELAQNFLQQVAQAYVRQNVERNSAEASAQLTFVKEQLPNVRSQVDAAQKSLSSYQMRANSV
DLTLQTKGLLDQEVAVETSIQQLRLQQAEMDRKFTRDHPAYQALMRQIGDLEARKSGFQGQVKQLPEAQQELLRLTRDLQ
VSNEMYTAMLNQAQQLDVARAGTVGNVRIVDAAEVDATEPVKPRKPLLVLVGTLLGAFLSIGLVLLRQVLNRGVEDPSQI
EEIGLPVYASIPVSPGQQSDSVRGKFRADGKLHLLAVKDPADLAVEAVRSLRTSLHFARLEAKNNIVLISGSSPNAGKTF
VSSNLAAVIAQAGQRVLIIDADMRKGTLHKALGATQTPGLSDVLVGKTSLDDAIRAVPGLDNLSFIARGDVPPNPSELLM
HRNFTELLEQVEKRFDLVIIDTPPILAVTDAAVIAHHAGTCLLVARFGLNQPKELMLARKRFEQNNVQLKGAIFNAVERR
ATGYYSYGYYEYKSTR
>gnl|bykdb|A0A3R1LUZ7 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=724 residues).
MPSETPIKNTTQQKTEIDIGRLVGEVIDHRKLIISVVAIFATISLVYVLFATPVYQANALVQVEQKQGNAILDSLTQALP
TTQPKSDPEISLLLSRMILGKTVDDLNLQAQIEEKHFPLFGKGLSRISGGSDGRISVSNFNLISLNKNHPKIELEVIDNK
SFVITNDAEEIKGNVGELIDNGNLSIKVNSIDALPGSVFEITYLSKLDAINNIQNSFKVEDQGRDTGMLSLTLTGEDPIL
IKRILDSISKNYLEQNIDRQAAQDAKSLEFLGKQLPKVRNDLDKAENILNAYRQKKDSVDLSLEAKSVLDQVVNVDNQLN
ELVFREAEISQLYTKEHPTYKALVEKRETLNQERARLNKRVASMPETQQEILRLSRDVESGQAVYMQLLNRQQELSIAKS
SAIGNVRIIDPAVTEPTAVKPQKIAIIAIGIIAGFFVSGWIILLRILLRKGIDSPAQLEENGINVYASVPISDWLYKNSD
NAGKLGINKAHHHKAYGLLAVENPADLAIEAIRSLRTSLHFAMLDAVNNVLMISGASPNAGKTFVSSNLAAVMAQGDRKV
IFIDADLRKGYAHKIFGLPNDIGLSEYLSGSADIKRVVKRVDSGQFDFISRGTNPPNPAELLMRGNLEELIEWASKNYDL
VIVDTPPVLAVTDPTIISRCAGTTLMVIRHEVNTLPEVVAAIKRFEMNNVSVKGVILNAVVKRATNYYAYGYTNYTYDYT
DKNK
>gnl|bykdb|A0A3R1N912 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=760 residues).
MLQRHDPLTMADIDKNAFAADFIDIDAALATIRRQWRIVLATIAIAGTIGLAYAATAVPIYSATATLLIDRNNSQVVEQL
STIGGVIEDEASILSQVEVLQSETIGLAVVDNLNLTENQEFRATRASLLSSMLGTVRSLVNVSQWFSPAKEAVVDDGTLK
RALSDRLLQGLSVKRIGRTYALELTYNSTSPALAAQIVNAVAAAYLVDKLNSKYEATKRASDWLSDRIAELRQRALDTDL
AVQKFRAEHNLIETGNNGLLSDQQLAELNSAQILAQSETARARARVQRIEHILATDDVDAVVTDILDSSVANDLRKKYLE
SSKIEAEITGRLGKNHVQAVRLRNEMQEYRRLMFQEVSRIAQSYKSDLEVAEARERTLEASVAKATTVSNSASQTQVQLR
ELQREAETYKNMYQTFLQRYQEAMQQQSFPVTEARVISKAIPPKIPSKPNKPMLLALFMIMGAAAGGGIAMFREFRDRFF
RTGEQVRDVLGLEFLGNTPLIPNKPVEEILPKAQESGPTATRPSSVARYAVDHPLSSFAETLRSTRLALDLGIPAKSGAR
VVGVVSALPSEGKSTISINLAQLLAGQGARVLLLDADIRNPGATRALGRHAGEGLLEVLLEGRNVRDVLLHDEKTGLAFL
PTVVKQRVPHSSELLTSPQMHKLLAEASGVFDYIIVDLPPLGPVVDARAMASRIDGFVFVTEWGKTARRAVRNTIENEVH
IRKKCLGVILNKVDTEKLKLYRAYGSSEYYYSRYTRYYHD
>gnl|bykdb|A0A3R1PAA4 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=726 residues).
MMKNNALPIVMAEQDDKLEWERLIGPLWDNRWRILLVTGVAGILGCAYALMATPIYQATALVQVEKQLSGDSLLRETLDS
SIGGVGQNSATQDEVSLAKSRYVIGKTVDDLGLTVRISPDYFPLFGKGIARLSGEVTPVLRISSMKVPAVMQGQELTLTV
DDPQHYSLGHDGKTLFSGVVGQTLQQGGWSVNVSELEAQPGTTFTVVNVPRQKAVDDLRNILDVAPGGKESGIMTFSLAG
EDPQRAEAVLKSITDNYLQQNVDRKTEEAQRMLAFLHEQLPRTQTSLNNAENQLNQFRQQNDSVDLSLEAKSVLDTQVQL
EGQLNELTFKEAEISKLYTRVHPAYRALLEKRATLEAEKARLGKQVQTLPKTQQEILRLTRDVQVDQQVYMQLMNKQQEL
SISKAGTVGNIRIIDEAETGLRPVQPQKAMIVFFALLMGGVLSASVVVLRAALHRGISDTDTLEKRGISVYATVPLSPWQ
QKRNRVQQQLLTKHSSGKLPILAQEEPEDLSVEAIRSLRTSLHFAMMEAKNNILMVSGASPASGKSFTSTNLAVVIAQAG
QRVLLIDADMRKGFLHRWLNNSAKAGLSDMLSGLIAPEMAVKKTDIANLDFVPRGQVPPNPSELLMHQRFADFLRWAGQN
YDLVLIDTPPVLAVTDAAIVGHHAGTALMVVRFEVNTVRQIETSIRRFEQNGVAIKGVILNGMVKKTATDAGYYAFAYPS
HQEKVQ
>gnl|bykdb|A0A3R1PE73 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=720 residues).
MTEKTKPSAAPISGSDEIDIGRLVGTVVEAKWWVLGITAVFALAAVIYTLFATPIYSADALVQIEQNSGNSLVQDIGSAL
ANKPPASDAEIQLIQSRLVLGKTVDDLDLDIGVTKDTFPIFGAGWDRLMGRQNDMVKVTTFELPKGAGDQVFTLEVLGPK
QYQLTSDAGFSARGEVGQMLTKNGVTMMVSDIKAAEGGKFTVSKFSMLGMINNLQGNLTVTENGKDTGVLSMTFTGEDKD
KIRDILNSITRNYLEQNVERKSAEAAKSLAFLAKQLPEVRAHLDEAENKLNAYRQDKDSVDLPLEAKSVLDSMVNIDAQL
NELTFKEAEISKLYTKRHPAYRTLLEKRQALEDEKSKLNNRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITE
ASTVGDVRIVDPAITQPGVLKPKKALIVLGSIILGLMLSIMGVLLRSLFNRGIESPQVLEENGISVYASIPLSEWQKSRD
SVKTVKGVKRYKQSQLLAVGNPTDLAIEAVRSLRTSLHFAMMQAKNNVLMMTGVSPSIGKTFVCANLAAVVSQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILLGKGEIEQCAKPTSITNFDLVPRGQVPPNPSELLMSERFTQLIEWASKHYDLVL
IDTPPILAVTDAAVVGRHAGTTLMVARYAVNTLKEVETSLNRFEQNGIDVKGVILNSIFRRATGYQDYGYYEYEYKSDSK
>gnl|bykdb|A0A3R1PLZ2 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=727 residues).
MNQNTNTEDTIDLKELFFSLIAQWKLIALCIILSLVCALLYLRVTPDTYSVDALVQVEDSKGASAALLGDLSQMMEQKSP
AQAEIEILKSRLVLGSVIKELHLNIQVSSTENTLTHRLLSDTEYKTEYTKKSVLFKDDLKSFEVREFEVPAFYLDKNLLL
NFDKQSLRLTDPTTEEVILTVPLNQANHVTGPHGLWKVAIFTKDQLDATYNISNLSLPAAVDAISSNYSVGERGKLTGVL
GLNYQGQDKEHITNVLNAILATYSAQNIERRSAESAQTLKFLDEQLPELKKQLDDAERQFNKFRQQYNTVDVTKESELYL
TQSITLETKKAELEQKQAEMVAKYTAEHPAMREINGQLGAINKQIGELNSTLKQLPDVQRQYLQLYREVEVKTQLYTALL
NSYQQLRIAKAGEIGNVRIVDTAIEPVEPIKPKKLLVLILSIFVGGFIGTLVALLRNMLRTGIKDSGQIENELDLPVYAT
VPRSPIQESRIKILKKKKSIPILAVKNSDDIAIESLRSIRTAIHFALTSAKNNIIMIAGPSPEVGKSFISTNLATIFAQG
NKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQADLQKVLHKTQVANLDVITRGKSPTNPSEILSSTQFKDLLETVQS
QYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSQMKELELTLNRFEQAGVKVNGFILNDIQRASAGYGYGYNYAYA
YKAQKED
>gnl|bykdb|A0A3R1WG16 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=739 residues).
MQLPSVIGTRDNDQDSIDLLGIFGSLIDQKWLIGALTGAFMATGVAYAVLATPVYLANALVQVEPKKNDMLGFSDLNSML
GGQSPSVTEIGIIKSRAVIGKTVDDLRLDIDVTPNTFPLIGGFLARRYRGETEFSVAAPRLGLNSYAWGGERLEINRLNL
PKALLGKKLTLIAGEQHRFRLFDENDNLLVEGVAGEAFKQDEVEGQIAQLSANPGTRFEVVRNPRIVTIQSYQDALDISE
QGKESGIIRLALASTDAAEAVKILNKIASLYVQQNVQRTSAEAAQSLEFLQGQLPQVKRDLAKASDALNGYQTRGKTVNI
SLETQSVLEQVVSLDTRISELKMQQAEMDRKFTRQHPAYRALMTQIGELTQQQKALESKAQDLPATQQELLNLTRDVEVA
SQIYTQLLNKSQELDIVRAGAVGNVRLVDSADVDLTSPVKPKKALIVLIATFLGAFFGVALVLLRKSLSRGLEGPEAIEQ
LGLPVYASIPYSALQQEEDSKKVRAKDGTDKPAYLLALRNPTDLSIESIRSLRTCLHFAGLDSTNNRIMISGPSPQVGKT
FVSSNLAAVMALSGQRVVLIDADMRKGHLHKTLDTPITNGLSDLLVKRCSIEQAINKVEIDNLHFISRGQVPPNPSELLM
HANFRELLAQLSERYDVVIIDTPPLLAVTDAAIVGRDAGISLIVTRFGVNPAKEIELTIRRFAQNGIELKGAVFNGVEKR
AASYGTGGYYNYEYASDKS
>gnl|bykdb|A0A3R1X0V0 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=740 residues).
MQSNLLSRKPNPPGLEMSDEIDLLKFWKALWRRKWAIVGFSMLPSLLVGLSLLTVTPTYRAETTVLIEGKPSSVGSIEHV
YGRDTVSSEYLPTQLELFKSRALAERVVRQLNLVAHPEFFAKEQEGTFALLKKLLSALDIRKLVPSGAALEPPTPEELEV
LRFDEVTRAFMTRIKVIRQGNSTLVKVQVEMSDPHMAAKAANALAKELIESQMEAAVEVSAGASAWMNGRLVSLREQLKV
SEERLQRYREAENLVDVGGVSTISATELARTGDRLIDARLKYAEAESQYRQVQANRGNWEKLAAVPAVLGHPLIQQLKAD
ETKARAKVEERSKRYGAQHPQMEAVRAELNAASASLHGQIVQVVAGIERNYQLAVANQKTLQASFNRVQSQQQSVSRKEF
KLRELKSEVDANRSLYNAFANRLKETAATSDLDIVSVRIVDPAIVPTMPVGQRKVLVVTLTAMLSLILAAALTLLFEALN
NTFKSVDQVEEQLNIPVLGVAPRLSTKLGCELWQLYSRELDRRFSESIRTMRTGIVLSDLKQPHKVLLVTSSIPGEGKTT
VSTNLACALGQMEKVLLIDADLRRPMLAKHFQLPIGSPGLANLLAGTASLDDCIQQADGVDVLAAGTVPPNPQELLASPL
FSQLLEQLSERYQRIVIDTPPCLAVSDALLMSTLADFVLYVVKSDATAVPLVHKGIGQLLQGNAPVKGIVLNQVDVTAAG
SKGGRYDGYYDYYSYSDSPT
>gnl|bykdb|A0A3R1X9G0 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=742 residues).
MQQSHVQQDIDNDEMDLLGLFGAVVDHKWMIAAITGAFMVAGASYAILATPIYQANALVQVEAKKNDLLGFSDVSSMLGK
ESPSVTEIELIKSRSIIGEAIDSLGLNITVRPNYFPIVGHFLARRYVKKNPDSVSDPLLPLSGFAWGGETLKIGTLQLPD
SLLGTKLALIVEDKGGYIILNEDGDKIAESKVGELYSNNDISVNVEQIRAKPGTKFFIVCSPRLTSILDYQDALDISERG
KESGIIGLSLESEDPNLAIKTLNEIADIYVRQNIERTSAEAAKSLGFLNEQLPKVRRDLEKAEDALNSYQTRSKSVDITL
ETKAILDQIVSLDTNISELKLKQAEMDRKFTREHPAYRALMTQLGELTNKQDGLAKKVQSLPSTQQELLSLTRDVRVGTE
IYTQLLNRSQELDVMRAGTVGNVRLIDGADVDRTKPVKPKKILIVLVATLFGAFLAVALVLLRKAINRGIESPEVIEKLG
LPVYASVPYSLLQKTEEQKKSRTPNRTGKAPSLLAIHHPTDLSIEALRSLRTSLHFGMLDAKNNLLMISGPSPGVGKTFI
SANLAAVVAQAGQRVLLIDVDMRRGYLHDLLGVPYKNGVSDILVNRCDVATAIHKTEIEGFDFMSRGERPPNPSELLMRS
SFTELLNKVSSMYDLVILDTPPLLAVTDAAIVGRQCGTSLIVARFGLNPAREIELTINRFAQNGIKLAGAIFNGVERRAS
ANYGYSGYGYYHYEYKDEKAKA
>gnl|bykdb|A0A3R2BGD8 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=727 residues).
MMKNNALPIVMAEQDDKLEWERLIGPLWDNRWRILLVTGVAGILGCAYALMATPIYQATALVQVEKQLSGDSLLRETLDS
SIGGSIGQNSATQDEVSLAKSRYVIGKTVDDLGLTVRISPDYFPLLGKGIARLSGETPPLLNVSGMKVPAVMQGQELTLT
AEDQQRYSLSHDGKKLFSGSVGQALQQGGWAMNVTALEALPGTTFTIVNVPRQKAVDDLRNMLDVAPGGKESGIMTFSLA
GEDPQRAEAVLKSITDNYLQQNVDRKTEEAQRMLAFLHEQLPRTQSSLNNAENQLNQFRQQNDSVDLSLEAKSVLDTQVQ
LEGQLNELTFKEAEISKLYTRVHPAYRALLEKRATLEAEKARLGKQVQSLPKTQQEILRLTRDVQVDQQVYMQLMNKQQE
LSISKAGTVGNIRIIDEAETGLRPVQPQKAMIVLFALLMGGVLSASVVVLRAALHRGIGDTDTLEKRGISVYATVPLSPW
QQKRNRAQQQLLTKHGSGKLPILAQEEPEDLSVEAIRSLRTSLHFAMMEAKNNILMVSGASPASGKSFTSTNLAVVIAQA
GQRVLLIDADMRKGFLHRWLNNSAKAGLSDMLSGLIAPDQAVKKTDIVNLDFVPRGQVPPNPSELLMHQRFADFLRWAGQ
NYDLVLIDTPPVLAVTDAAIVGHHAGTALMVVRFEVNTVRQIETSIRRFEQNGVTIKGVILNGMVKKTATDAGYYAFAYP
SHQEKVQ
>gnl|bykdb|A0A3R2C102 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=724 residues).
MTEKNRAVSTASKENEEIDLGRLVGTLIDHRWLIIGITALFAVMGIIYSLFATPIYQADATVQVEQNEGNSLVNNISQML
PNSQPASSTEIELITSRMIVGKTVQDLNLDTVVNQKYFPMFGRGWARLTGEVPGQIAVSRVTISESMAEQPLELTVIDKN
NYSVEFDGVEIIKGKVGVYATGNGVSLLVSDVVAKPGTVFEVSKLSKLAATLQLLDELNVEDKGKDTGVLSLSIMGDDPT
QIKKIIDSISNNYLVQNVERKSEEAAKSLAFLKDQLPLVRDSLNTAEDKLNSFRQANDSVDLSLEAKSVLDTIVGVEAQL
NELTFKEAEISKLYTKEHPAYRALLEKRGTLQQEKDKLDKRVSKMPQTQQEILRLTRDVDAGKEIYMQLLNKQQELSITK
ASTVGNVRIIDPAVTQPKPVKPKKTLIVIIVTMLGGAIAVVIVLAKNMLHRGIESPDQLEEQGINVYASIPLSEWQQKKD
IETILRSSKKSNTRSKTLLAVGNPADLAIEAVRSLRTSLHFAMLESKNNVLMICGASPNIGKTFVSINLAAVIAQAGQRV
LVIDADMRKGYSHTLLNTNWQNGLSDILSQQVSKEAAVRKTEIENLDFIPRGTIPPNPSELLMGSRFNELIKWAEKNYDI
VMIDTPPILAVTDAAIIGHNAGTSLMIARFSVNTVKEMEISIRRFNQNGIDIKGVILNAVEKRASSYYGDYGYYHYEYRS
NEKS
>gnl|bykdb|A0A3R2C7H5 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=725 residues).
MMKNNAMPIVMAEQDEKLEWERLIGPLWDNRWRILLVTGVAGALGCAYALMATPIYQATALVQVEKQLSGDSLLRETLDN
SLGSAGQNSATQDEVSLAKSRYVIGKTVDDLGLTVRISPDYFPLFGKGLARLSGEPPPVLLISGMTVPAAMQGQELTLTV
QDKQRYSLSHDGKNLFSGTVGQPLKQGAWAMNVTALEALPGTEFSVVNVPRQQAVDDLRNLLDVAPGGKESGIMTFNLAG
EDPQRAEAVLKSITDNYLQQNVDRKTEEAQRMLAFLHEQLPRTQTSLNNAENQLNQFRQQNDSVDLTLEAKSVLDTQVQL
EAQLNELTFKEAEISKLYTREHPAYRALLEKRATLEAEKARLGKQVQTLPKTQQEILRLTRDVQVDQQVYMQLMNKQQEL
SISKAGTVGNIRIIDEAESGLRPVKPQKAMIVFFALLLGGVLSASVVVLRAALQHGVSDTEALEKRGINVYATVPLSPWQ
QKRNRTQQQLLVKNGGDKLPILAKEEPGDLSVEAIRSLRTSLHFAMMEAKNNILMVSGASPASGKSFTSTNLAVVIAEAG
QRVLLIDADMRKGFLHRWFSNGAKGGLSDMLSGLIAPDQSVKKTAIANLDFVPRGQVPPNPSELLMHQRFADFLQWAGQH
YDLVLIDTPPVLAVTDAAIVGHHVGTALMVVRFEVDTLRQIETSIRRFEQNGVAIKGVILNGMVKKTATDAGYYAFAYPS
HQEKV
>gnl|bykdb|A0A3R2CMW0 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=730 residues).
MSQNSNTEDTIDLKELFFSLIVQWKLIALCVILSLVCALLYLRTTPDTYAVDALVQVEENKGTSAALLGDLSSMIEQKQP
AQAEIELLKSRLVLGSVIQNLNLDLKISGTENSFFNRLLSPHDYQSTYNKNAVVFKDDAKSFDVRKFEIPTYYLDKNLLL
NFNGNKYTLTDAKTKQVVFSAATNQESQHTSEYGTWNIALYTQDQFKNTYNIEKMSLPAAMGSITNNYSVAEKGKMTGIL
GLNYQGQDKEHITNVLNSILVAYSQQNIERRSAETAQTLKFLDEQLPELKQQLDIAEREFNKFRQQYNTVDVTKESELYL
TQSIQLETSKAEIEQKLAEAAAKYTNEHPAMQQMNAQLGAINKKIGELNDTLKQLPDLQRRYLQLYREVEVKTQLYTALL
NSYQQLRIAKAGEIGNVRIVDTAVLPIEPIKPKKLQILILAIFLGGFLGTLLALLRNMMHSGIKDSNQIENELDLPVYAT
VPRSPAQESRIKLLKKKKSIPILAIKNGDDIAIESLRSMRTAIHFALNNAKNNIIMISGPAPEVGKSFISTNLAAILAQS
NKRVLIIDADMRRGYLHKYFNHDNLPGLAEYLNTQQTLDSIIKPTEIPHLDVITRGKSPVNPSELLSSAKFAAMFEQLSP
MYDHIIIDTPPVLAVTDGIIISQYAGVNLVIARYAKSQMKELELTVNRFEQVGVKVNGFILNDIQRGTGGYGYGYGYNYA
YGYKASKNND
>gnl|bykdb|A0A3R2D8P2 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=723 residues).
MANPKNNSTQAAESSNEIDLARTFGTLIDHCWLIVGVTCMFTVLGIIYSLFATPIYQSDALIQVEQNVGNSLLNNLSEIL
PNNQPPSAAEIQLIQSRMVIGKTIDDLKLDISVKQSFMPVFGKGFNRLLGRSEYDVVVSKFDVPKINYDKEYTLKIVDSK
TYILSLDGEEILTGKVGQLEHNSGVEILITDTNAVPGTNFSLVKRPVLAVIKDLLENLRVADKGKDTGVLALSLEGSNPK
EIQAILDSISKNYLLQNVERKSAEAEKSLVFLKEQLPEVQAKLDSSENELNHFRQQNESVDLSLEAKSALETMVALDSQL
NELTFREAELSKLYTKEHPAYRALLEKKQTLEKEKVNLNKHIASLPKTQQQILRLTRDAKVSQEVYMQLLNKQQELNISK
ASTVGYVRIVDTAVTQPKPVRPKKALIVALATVLGGGLSVVYVLVMAAFRKGLESPDELEELGVSVYASIPLSEWQQKQD
RKFKLRKANNGSNAKSTDLLAIGNPADLAIESIRSLRTSLHFASLEAKNNILMISGASPSIGKTFVSVNLAAVIAQAGQR
VILIDCDMRRGYTHLQMQTSVESGLSDVLSEQVSLDKCIKRTKVENLDFISRGMIPPNPAELLMHSNFEKLLKWCSDNYD
LVLVDTPPILAVTDAAIIGRHVGTSLMVARFDVNTTKEVMLSIRRFEQNGVDIKGVIINAVVRKAASHYSYGYYNYEYSS
DKK
>gnl|bykdb|A0A3R2EM25 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=715 residues).
MTDNTKPGLSTANNHDEIDLSRLLGTLLDHRWLIIGITALFSVTGIIYSLFATPVYQADAMVQVEQNVGNSLVNDLSQML
PSSQPGSSTEIELIKSRMVTGKTVDDLNLDTVAQQKYFPVFGRGWARLTGVEPGRIALSRLTVPSNTDDTALELKVIDDK
NYVLSKDGTEIIKAKVGELASGRGVTLLVSEISAQPGTVFEVAKLQRLVATNNLLDALTVEDKGKDTGVLALSLVGDDPV
LVRKILDSISKNYLLQNVERKSEEAAKSLDFLKEQLPEVRSSLDSAEDKLNRFRQANDSVDLSLEAKSVLDTIVGVEAQL
NELTFKEAEISKLYTKEHPAYRALMEKRATLQQEKDKLNKRVSGMPKTQQEILRLTRDVQAGQEIYMQLLNKQQELGITK
ASTVGNVRIVDPAVTQPRPVKPQKTIIVLIVTLLGGLFSTGFVLLKTMLHRGIESPEQLEQQGINVYASIPLSEWQQKSD
RETMLSSKRSSIKSYTLLAVGNPADLAIEAVRSLRTSLHFASLEAKNNVLMISGASPSIGKTFVSINLAAVIAQAGQRIL
VVDADMRKGYAHSLLNCELGIGLSDVLSGQASAQQAVRKTSIENLSFISRGKIPPNPSELLMHNRLTEFLEWAGKEYDIV
LVDTPPILAVTDAAIVARNVGTTLLVARYGVNSLKEIEVSIRRFEQNGMEIKGIILNAVEHKSGSAYGYYAYEYK
>gnl|bykdb|A0A3R2GYI6 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=725 residues).
MTDNTKAGLSTANDNDEIDLNRLLGVLLDHRWLITGVITLFAVVGIIYSIFSTPVYQADAMVQVEQNAGNSILSDFSQML
PSSQPGSATEIELISSRMVIGKTVDDLNLDIAVNQDYFPMFGRGWERLSGKEPSEISINRLKVPEYVVEKPLELKALGGK
QYSLSYDGNEILKGTAGVLAAGKDIQIFVSDIKAEPGTTFQVVKRLKLNVINDLLRNLTAEDKGKDTGVLALSLTGENQT
RIREVLDSITKNYLLQNVERKSEEAGKSLTFLKEQIPDVRAKLDASEDLLNKYRQKNDSVDLSLETKAVLDSIVSVETQL
NESTFKEAEVSKLYTKQHPAYRALLEKRQTLEDERNKLNKRIATMPKTQQEILRLTRDVQVEQEIFMQLLNKEQELSVTK
ASTVGNVRIIDPALTQINPVQPRKTLIVLLAVFVGGLLSVGFVLLKTMLHKGIDNPEALEEHGINVYASIPLSEWQQKKD
IEMANKRGRKISSTDSVSLLAIGNPADLAIEAIRSLRTSLHFAMMEANNNVLMISGASPNIGKTFVSINLAAVIAQTGQR
VLVIDADMRKGYSHILVGTEWNNGLSDFLSGKITQEQAIHQTKVEGMDFIPRGQLPPNPSELLMHSRLADLLNWAGGKYD
LILIDTPPVLAVTDASIIGRLAGTSLMVARFGVNTVKEVDFSIRRFDQNGINIKGVILNAVEKRASNYYGGYGYYQYSYT
SDKKQ
>gnl|bykdb|A0A3R2H5L1 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=727 residues).
MNQNTNTEDTIDLKELFFSLIAQWKLIALCVILSLVCALLYLRVTPNTYSVDALVQVEDSKGASAALLGDLSNMMEQKSP
AQAEIEILKSRLVLGSVIKDLHLNIQVSSTENTLSHRLLSDTHYKTEYNKKSVIFKDGLKSFEIRTLEIPAYYLDKTLHL
NFDKQSLRLTDPATEEVVLNVPLNQLNQVAGPYGSWKIAIFTKDQFDTTYNIRNLSLPAAVNAISSNYSVAEQGKLTGVL
GLNYQGQDKEHITKVLNAILATYSAQNIERRSAESAQTLKFLDEQLPDLKKQLDDAERQFNKFRQQYNTVDVTKESELYL
TQSITLETKKAEFEQKQAEMAAKYTAEHPAMREINGQLAAINKQIGELNSTLKQLPDVQRQYLQLYREVEVKTQLYTALL
NSYQQLRIAKAGEIGNVRIVDTAVEPVEPIKPKKLQILILSLFLGGFIGTLIALLRNMLRTGIKDSGQIENELDLPVYAT
VPRSPIQESRVKILKKKKSIPILAVKNSDDIAIESLRSIRTAIHFALTSAKNNIIMIAGPSPEVGKSFISTNLATIFAQG
DKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQADLQKVLHKTQVANLDVITRGKSPTNPSEILSSTQFKELLEQLQS
QYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSQMKELELTLNRFEQAGVKVNGFILNDIQRASAGYGYGYNYAYA
YKAQKED
>gnl|bykdb|A0A3R2HMB7 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=702 residues).
MVTGAAYSILSSPVYLANALVQVEPKKNDMLGFSDISSMLGGQSPAATEIGIIKSRAVIGKTVDDLRLDIVTTPKTFPIV
GGFIARRYKSTPAQSVSPPLFGLNSFAWGGERLEIEKLTLPDELLGEKLTLIAAEQNRFQLYDEDGGLLADGTTGATVME
NGVEVLVAHMDANPGAKFEVVRNPRIVTIQNYQDVLEVSEQGKESGIISLALASTDYALAVKILNKIASLYVEQNVQRTS
AEAAQSLDFLQAQLPQVKEDLAKASNALNSYQTRGNTVNISLETKSVLEQMVVLDTRISDLKLQQADLDRKFTREHPTYR
ALMAQLGDLNKQRHGLEKKVQDLPATQQELLNLTRDVEVATQIYTQLLNKSQELDIVRAGAVGNARLIDTADVDITSPVK
PRKALIILAATLLGGFVGVALVLVRKSLGRGIEGPDAIEKLGLPVYASIPYSVLQQEEDSKKLRLANGVNSQSFLLAQRN
PTDLSIESIRSLRTCLHFAGLDATNNRIMISGPSPQVGKTFVSSNLAAVIAQSGQRVVLIDADMRKGHLHKSLATPISNG
LSDLLTKRCSIEQAINKLEVDNLHFISRGQVPPNPSELLMHANFRELLAELSKLYDVVIIDTPPLLAVTDAAIVGREAAI
NLIVTRFGVNPAKEIELTIRRFAQNGIELKGAIFNGVEKRASSYYGNGSYAYYNYEYASDKS
>gnl|bykdb|A0A3R2R3E8 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=747 residues).
MSIAFFYLRYTKPVYDSSMLIQLAEKDQGKELLEIDNVNKRVDISTEIELLRSQLLFEVAIAKMNMNVSLFSKGKILTEE
KYHQSSFTILPYSLSDSALCDVPIWIETSGNRRIKLSYTLNNKNYSVKSDVNKPIKTKHFEIGFKVENWEVLKQDDEANE
LYFTFNNQKTLASRLIANLEVNPVDANAKTIELRYNGNNPELCKDIIQSVAQTFFNYDEEAKRKSADNILNFIQIQLDSI
SGELKDSKDSLTDFQRKSHLSDPENEGGNLSQDIDKYQDLLFELDNELATLRTVNSKLRSEPNRLDIYRLIPEMLGKSFE
ISLTKQITDLNLLLERKEELLTNVTENNSELKNLNLRIQSKIQSIRRSVEVIQERILEQAKVIRGKIGIVEGEYLKMPQK
KMEYNRLKSLQDLNEKYYTLLTEKKIMYSISNAGYTSNNRVLNEASLNFTPVSPNRKLVYAGFIFIGFVSGFAFLFFKYV
TFNEINTIDDLKHLLPDKVTVLGNIPLLKESTEYSQLLVHNTPKSILAESMRNIRTNLSFVNSDVRVIAISSSISGEGKT
FVALNLAGIIALSGKRTIVIDLDLRKPKVHLGLNVPNEKGISNLIIKQVTLEECIRKSEIENLDFISAGPIPPNPSELIL
SDSFQEILETLKATYDIVIIDNPPVGLVTDGVQILAKADVPIYIFKAHYSKRIFAGRVRELFEMNQISHLNIILNGTKAY
KGKYGYGYGYGYGYDYYDEEDKKKKKK
>gnl|bykdb|A0A3R2TSB1 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=759 residues).
MNARWYPPLPAPYSPEPERPHSRFKEYVDLMLDNRWLIASVTAAVLVLGAGYALFGPRVYEANVLIQLEDAERSPGGAGD
AAVNGVGVKTPTSGEAEILKSRMVLGQAIENTKLFIKARPHYIPVVGAFMARHSKTLSRPGFLGMRGYVSGTERIAVAQM
DVPPALEGKKFLLTAGKDGTYTLTHPDLDTPLHGRVGEPQDSSVPGGTVHLLVASIDARPGGAFELTRHSTQLTMLELQR
ELRVIEKGKQSSVIDVSWQTDDREHLANLLNEVARLYMRQNIDQKTAQAERTLNFLGTELPKFKQQLEQSEEAYNQYRNQ
NGTISLDDEARNALSQNVDLQAKLLDARQKRLDLASRFTSQHPMLITLDAQIASLRKELGGVDNRIRRMPMLQQNSLRMQ
RDIKVNTELYSSLLNSSLQMRLAREGRIGNVRVLDQALSPEKPVRPKAVIVMALALVVGLFLGAVTSVLRKVLKNTVATP
DEIEMRTGLNVYSTIALSTRQGTLDRAIRQGKPGVKLLAASHPDDPALEGVRRLRTALGFLMAGAQNNRILLTSATPGAG
KTFLSANFSAVLAASGRRVLLIDADMRRGKLASQFGLKATTGLSELIAGTATLAQAVHAQVLPHLDVITTGKLPLDPATM
MGSTAFTRLLETLSALYDAVVIDAPPILLATETVAMSPDVGTLMLVARAGDSELGDLVESAKRLAHVGAAFHGVVLNAQD
ARQRHNAYGYDYGPYGLPPNIYPPALGHTPRAEPERATS
>gnl|bykdb|A0A3R2U6C3 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=753 residues).
MSLPIETFEPSVPARQQETPLSSHVDAIFSNRWMIIAITMVALLGALAYVMVTPSVYSADIIVQVEEEMPNGQARSLLGD
VSSMFDTKAETSGEMEVLRSRMVVGPAVDKFLLYIHAKPRYFPVVGEWLAQRYESLPYPSSFPRGGYAWGGEAVAISQLD
VPNEWLGKPLRLTTLGEGRYTLSDKLTGATFTGTVGKPEHFLLPGGGAMDVHVDALAGRPGTEFTVSRSSRLAAIEGVQS
RMGIFERGRASGVIGVTLEGNDPALTTAVLNQIGQEYVQQNVNRKSAQAEKSLAFLEQQLPQLKGELDAAETKYNALRNK
RGTIDLSEEAKLILAQSVDAQTRVMELRSKRQELITRFAPTHPSIVGIDRQIASLTGDVNRIGNNIKQLPDLEQDVVRLV
RDVRVNTELYTALLNNAQQLKLIRAGKVGNVRILDAAVQPDKPVRPKGAIIIGVATAIGLIFGILCAFVRSALFGGLSEP
EDVERHTGLPVLAAIPYSDVQDKLWRRSRRKNATVPALLAQSQGNSPPIESLRSFRNVLQASLRQSANNMVMFTGPVAGV
GKSFLSANFAFIQGGVGKRVLLIDADFRKGQLNRYFGLPKEDGLFEVLSGTIPLNRVRKHSVSEGVDFIATGAVTFDPSE
LLASPVFGETLRELATQYDMVILDTAPVLSSPDAAVVGTHAAAVMVVVRSGMNTVGEIRETAKRLIQAGAPVDGVLFNGL
KLLPERFGFRSKYGGYRYSRAAYYGDFKQNGPK
>gnl|bykdb|A0A3R2V5T0 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=782 residues).
MHHKTFKSNIGFPESGKDSDTFIDLDRLWAAVVRRANVIAASVIAAVVLAGLYLVLATPVYTAMTQVLLDESLSRYAEEE
SPVPAAQIVDNRIASAVEILKSKEMALTVVDKAKFDENDIIVNPPMSPVELVKTSVRGILDLVLPGDPPVSEAAIRAGRR
EKAAAVLQQSLTVERVGRSSVIAISTRSTDRQLAAQIAKTYAQAYLTEQLNANFDASERASVWLQERMTDLNQRAQAAEL
AVQKYRSDNNIVSSRGELMSESQLADLNGQLISAQADAATASARYSQYKSIIDRGPETAVDNAVVSARDTDNSVIQDLRK
RYITISDRQRGIVQQFGADHPQAAALDAEKKEISQQIFQELQQLTGSFKNEVDVANSRVQSLRDSIDKVAGRNSQANITM
VQLRELEQRSTALRTLYQSYLGRFEEASQKQSLPIAKARIISEAGLPTSPSSPKKTMTMALSVVLGLMLGGGIAALLEFR
DRFFHTGNDVRDNLRMRFLGYLPFIGERGVENAKAGTSAATPGGEHATLDESGQVSFQKMLRLAVDSPRSSFAETLRNVK
LTADVVIQERQCRVIGVISCLPNEGKSVVALNLAGLIASTGKRTLVVDADIRNPGLSRMLTTRQSAGLVEVVLDEIPWTQ
AVKVDTRTKMGILPVSTSNQFAHSSELLSSSGMRKFIDSAREACDYIIVDLAPVVPVIDAKAFAPQVDGFVFVTEWGKTP
IQMVQNLMANEPQIANKTLGIVLNKTDMTELQRYAGPGGSEHYHEKFSAYYGDAKPPVKEEA
>gnl|bykdb|A0A3R2W4Z8 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=715 residues).
MAGVTAVALVIGTAYALLATPIYQSNLLIQVEDSAPDAKNFLGDTANLFDVKTPATGEIQIIRSRMVIGGAIEAKQLYID
AQPRYLPFIGEWLSRRAKELSSPGFLGMGGYVSGTEAVNIAKFDVPSTFEDQKPFTITALAGDQYSLSHPDLAEPLTGTV
GKVLNREAPEGAITLVVSRLDGKPGAEFLVSRASLLTTVEDLQRRLQLGEQGKQSNVISVSLEDSDRDRLRSTLNEIGAQ
YVRQNVERKAAEAEKTIEFLDRQLPEFKQQLEDSEDAYARFRNQNGTVAFDEEAKAALTMSVQLQTKLLESQQLRRELLS
RFTESNPKVRMIDGQIAAVRHEIEGLETRVSAMPAVQRDALRLERDVRVNGELYKSLLNSSLQLRLVKEGKIGNVRLLDT
AVEPKKAVKPQKPLVVALSLVLGLLAGVAFAIVRSKLSSGIQNPQEIEERLGLNVYSVVPLALEQETILEHIAGGAKGVQ
LLAVTSPESLAIESLRNLRVSLQLTLMETGNNRVLITGATPGVGKSFVSGNFAVIMAQAGKRVLLIDADLRKGHLQKAFG
LPRKGGLADVLSGEMTPEQAIHAQVVPNLDVLTTGAYPFNPANMMLSSALGELLNDFSERYDLVVIDSPPVLVAADAAAV
AAHAGAVLLVARDNLTQLGELNESVKRLAHAGQQVNGVVFNGMDLSRRHYGSYGYKYGGYRYTEYKYKEAGLASE
>gnl|bykdb|A0A3R2WIS1 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=683 residues).
MIQVEDSAPDSKNFLGDTANLFDVKTPAIGEIQIIRSRMVIGGAVEAMRLYINAQPRYVPVIGEWLSRRSTELSNPGFLG
MGGYVSGTEAIDIAKFDVPSALEDQQPFTITAQADDHYTVSHPGLPEPLTGTAGKMLSQQVPGGTITLMVSRIDGKPGAE
FLVSRASSLATTESLQKRVQLSEQGKQSNVINVTLEGSDRGRLRRTLNEIGAQYVRQNVERKAAEAEKTIEFLDQQLPEF
KRQLEDSEDVYARFRNKNGTVAFDEEAKAVLGMSVQLQTKLLDTQQQRRELLARFTETNPKVRMVDGQIAAINHEINGLE
TRVSAMPAIQRDALRLERDVRVNGELYKSLLNSSLQLRLVKEGKIGNVRLLDTAIEPKSAVKPQKPLIVALSLILGLLAG
VALAILRTKLSSGIRNPQEIEDRLGLNVYSVVPLALEQETILEHIAGGAKGVQLLAVTSPESLAIESLRNLRVSLQLTLM
ESGNNRVLITGATPGVGKSFVSGNFAVIMAQAGKRVLLIDADLRKGHLQKAFGLPRKGGLADVLAGDMSPEQAIHGQVIP
NLDVLTTGNYPFNPANMMLSSKLGELLNDFSERYDLVVIDSPPVLVAADAAAVAAHAGAVLLVARDNLTQLGELNESVKR
LAHAGQQVNGVVFNGMDLSRRHYGSYGYKYGGYRYTEYKYKEA
>gnl|bykdb|A0A3R2WMV4 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=664 residues).
MLGGQSPAATEIGIIKSRAVIGKTVDDLRLDIVTTPKTFPIVGGFIARRYKSTPTQSVSPPLFGLNSFAWGGERLEIEKL
TLPDELLGEKLTLIAAEQNRFQLYDEDGGLLADGTTGATVMENGVEVLVAHMDANPGAKFEVVRNPRIVTIQNYQDILEV
SEQGKESGIISLALASTDYALAVKILNKISSLYVEQNVQRTSAEAAQSLDFLQAQLPQVKEDLAKASNALNSYQTHGNTV
NISLETKSVLEQMVVLDTRISDLKLQQADLDRKFTREHPAYRALMAQLGDLNKQRHGLEKKVQDLPATQQELLNLTRDVE
VATQIYTQLLNKSQELDIVRAGAVGNARLIDTADVDITSPVKPRKALIILAATLLGGFVGVALVLVRKSLGRGIEGPDAI
EKLGLPVYASIPYSVLQQEEDSKKLRLANGVNSQSFLLAQRNPTDLSIESIRSLRTCLHFAGLDATNNRIMISGPSPQVG
KTFVSSNLAAVIAQSGQRVVLIDADMRKGHLHKSLATPISNGLSDLLTKRCSIEQAINKLEVDNLHFISRGQVPPNPSEL
LMHANFRELLAELSKLYDVVIIDTPPLLAVTDAAIVGREAAINLIVTRFGVNPAKEIELTIRRFAQNGIELKGAIFNGVE
KRASSYYGNGSYAYYNYEYASDKS
>gnl|bykdb|A0A3R3BQL7 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=742 residues).
MQLPSVVSDRDKDRDEIDLLGLLGTLIDHKWLIGAITGAFMVTGAAYSILSSPVYLANALVQVEPKKNDMLGFSDISSML
GGQSPAATEIGIIKSRAVIGKTVDDLRLDIVTTPKTFPIVGGFIARRYKSTPAQSVSPPLFGLNSFAWGGERLEIEKLTL
PDELLGEKLTLIAAEQNRFQLYDEDGGLLADGTTGATVMENGVEVLVAHMDANPGAKFEVVRNPRIVTIQNYQDVLEVSE
QGKESGIISLALASTDYALAVKILNKIASLYVEQNVQRTSAEAAQSLDFLQAQLPQVKEDLAKASNALNSYQTRGNTVNI
SLETKSVLEQMVVLDTRISDLKLQQADLDRKFTREHPTYRALMAQLGDLNKQRHGLEKKVQDLPATQQELLNLTRDVEVA
TQIYTQLLNKSQELDIVRAGAVGNARLIDTADVDITSPVKPRKALIILAATLLGGFVGVALVLVRKSLGRGIEGPDAIEK
LGLPVYASIPYSVLQQEEDSKKLRLANGVNSQSFLLAQRNPTDLSIESIRSLRTCLHFAGLDATNNRIMISGPSPQVGKT
FVSSNLAAVIAQSGQRVVLIDADMRKGHLHKSLATPISNGLSDLLTKRCSIEQAINKLEVDNLHFISRGQVPPNPSELLM
HANFRELLAELSKLYDVVIIDTPPLLAVTDAAIVGREAAINLIVTRFGVNPAKEIELTIRRFAQNGIELKGAIFNGVEKR
ASSYYGNGSYAYYNYEYASDKS
>gnl|bykdb|A0A3R3CX96 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=720 residues).
MTEKTKPSAAPISGSDEIDIGRLVGTIIEARWWVLGITAVFALAAVIYTLFATPIYSADALVQIEQNSGNSLVQDIGSAL
ANKPPASDAEIQLIQSRMVLGKTVDDLDLDIAVTKNTFPVFGAGWDRLMGRQNDTVKVTTFTLPKGTAKDVFTLTVLGPK
QYELKSDAGFSARGEVGQMLTKNGVTMMVSDIQAADGGEFTVSKFSMLGMINNLQNNLTVTENGKDTGVLSLTFTGEDKD
MIRNVLNSITRNYLEQNVERKSEEAAKSLAFLAKQLPEVRTRLDDAENKLNAYRQQKDSVDLPLEAKSVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKTKLNNRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITE
ASTVGDVRIVDPAITQPGVLKPKKALIILGSMILGLMLSIVGVLLRSLLNRGIESPQVLEENGISVYASIPLSEWQKSRD
SVKTVKGIKRYKQSQLLAVGNPTDLAIEAVRSLRTSLHFAMMQAKNNVLMLTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILLGKGEISQSAKPTSITNFDLVPRGQVPPNPSELLMSERFTQLVKWASENYDLVL
IDTPPILAVTDAAVVGRHAGTTLMVARYAVNTLKEVETSLSRFEQNGIEVKGVILNSIFRRATGYQDYGYYEYEYKSDSK
>gnl|bykdb|A0A3R3DWA3 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=745 residues).
MEVMTKEAGTRVSRDEDEIDLRELLGLLLDRKWWIIGATLLFCVIGAAYALLVTPVHQAQAMVQVESRMPSIPGLADLTS
LTGGGSSASTTEVALLTSRTVVGTAVDQLQLDIKAEPKRFPSVGGFFARRFEAGVADAVASPVLGLARYGWGGESLLIHR
FDVPATLLDEPLILVAGEISGSFELLGDGGETLLKGAIGQPSEANGIVLEVAALRANPGMRFEVTRLRRLDVIAGLQKDI
KASEQGKESGILRVSYEDTDALRAEMLVQKVVEAYVRQNVDRSSAEAASQLQFVKDQLPTVRKQVESAQAAMATYQSRAN
SVDITLQTKGLLEQEVSVESSIQQLHMKQAEMDRSFTREHPAYRALLNQIAGLQARKDSFRRDVSALPDTQQELLRLTRD
LQVSNELYTALLNQAQQLDVARAGTVGNVRIVDPAVVDMSSPVKPRRLLVVLVATLLGGFLSIGAVFVLRMLNPGIEDPA
QIEELGLPVYAAIPLSGSRSLLQTQKRRGRRKHGDASGQSHLLAKAEPADLAVEALRSLRTSLHFAMMEAKNNVLAISGP
RPGVGKTFVAANLATVIAQGGQRVLIIDVDMRKGTVHKVLGVELAKGLSDVLAGTARVEDVISAVPGLAKMHYMTRGDIP
PNPAELLMHPRFEQMLEELAGVYDLVIVDTPPILAVTDAVIVAKHAGSTLMVTRFGINQPKEILLSMKCFERNGVQVKGA
IFNAVEKRATGYHSYGYYEYASDKA
>gnl|bykdb|A0A3R3FNT7 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=715 residues).
MTDNTKPGLSTANNNDEIDLSRLLGTLLDHRWLIIGVTALFSVAGIIYSLFATPVYQADAMVQVEQNVGNSLVNDLSQML
PNSQPGSSTEIELIKSRMVTGKTVDDLNLDTVTQQKFFPVFGRGWARLTGVEPGRIALSRLSVPSNADDTELELTVIDDK
NYVLSKNGTEIIKGKVGELASAQGVALLVSEISAEPGTVFEVAKLQRLVATNNLLDALTVEDKGKDTGVLALSLIGDDPI
LVRKILDSISKNYLLQNVERKSEEAAKSLDFLKEQLPEVRSSLDSAEEKLNRFRQANDSVDLSLEAKSVLDTIVGVEAQL
NELTFKEAEISKLYTKEHPAYRALMEKRVTLQQEKDKLNKRVSGMPKTQQEILRLTRDVQAGQEIYMQLLNKQQELGITK
ASTVGNVRIVDPAVTQPRPVKPQKTIIVLIVTLLGGLFSTGFVLLKTMLHRGIESPEQLEQQGINVYASIPLSEWQQKSD
RETMLSGKRSSTKSYTLLAVGNPADLAIEAVRSLRTSLHFASLEAKNNVLMISGASPSIGKTFVSINLAAVIAQAGQRIL
VVDADMRKGYAHSLLNCELGLGLSDVLSGQATAQQAIKKTSIENLSFISRGKIPPNPSELLMHNRLSEFLEWAGKEYDIV
LVDTPPILAVTDAAIVARNVGTTLLVARYGVNSLKEIEVSIRRFEQNGMEIKGIILNAVEHKSGSAYGYYAYEYK
>gnl|bykdb|A0A3R3R2K7 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=739 residues).
MQLPSVIGTRDNDQDSIDLLGIFGSLIDQKWLIGALTGAFMATGVAYAVLATPVYLANALVQVEPKKNDMLGFSDLNSML
GGQSPSVTEIGIIKSRAVIGKTVDDLRLDIDVTPNTFPIIGGFLARRYRGETEFSVAAPRLGLNSYAWGGERLEINRLNL
PKALLGKKLTLIAGEQHRFRLFDENDNLLVEGVAGEAFKQDEVEGQIAQLSANPGTRFEVVRNPRIVTIQSYQDALDISE
QGKESGIIRLALASTDAAEAVKILNKIASLYVQQNVQRTSAEAAQSLAFLQGQLPQVKRDLAKASDALNGYQTRGKTVNI
SLETQSVLEQVVSLDTRISELKMQQAEMDRKFTRQHPAYRALMTQIGELTQQQKALESKAQDLPATQQELLNLTRDVEVA
SQIYTQLLNKSQELDIVRAGAVGNVRLVDSADVDLTSPVKPKKALIVLIATFLGAFFGVALVLLRKSLSRGLEGPEAIEQ
LGLPVYASIPYSALQQEEDSKKVRAKDGTDKPAYLLALRNPTDLSIESIRSLRTCLHFAGLDSTNNRIMISGPSPQVGKT
FVSSNLAAVMALSGQRVVLIDADMRKGHLHKTLDTPITNGLSDLLVKRCSIEQAINKVEIDNLHFISRGQVPPNPSELLM
HANFRELLAQLSERYDVVIIDTPPLLAVTDAAIVGRDAGISLIVTRFGVNPAKEIELTIRRFAQNGIELKGAVFNGVEKR
AASYGTGGYYNYEYASDKS
>gnl|bykdb|A0A3R3TCJ4 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=734 residues).
MSTTIEIPAARSETFGLRNLLAIFRRRLRLFAAIVLIVFLAALVVTARMTPRYTAQAQVMLNTRQEQVVDTKAVLSNLPA
ESGVIDTEVEVLQSRDLARQVAEKLQLERDPEFNWALRPPTGLKALIARMQGKSVAPLPPPTTPNEILMGRERAASALQG
GLAVRRSGLTYIIVIAYTALNPEKAAQIANAYAEQYVQNQIQAKYAANNQANTFLDSRLNQLRSEVLAAEAAVEQYRSAN
NLLTTSGATLTEQEISSYNQQLATTQAEQAAEEARLRAARSQLARGSSGDDVGEALQSSVVSQLRGQRAVVTARVADLQA
RYGPRHPEMLRAQQELAAIDGQIQAEIQRVISNLEARVQVARDRTNSVQSSIGRARGTLAGNNAAAVRLNELERNAEAVR
TLYKGLLDRYQETTSRAGVETADSRIVSAAKAPGSPSSPNIPVNLVLGFIFAVGAGLTAVVIMEMLDDGLLTADDVEARL
GLPTLGSVPLLMSIADRKDRHMPPTEYLLARPLSGFAEAFRSLRTSILYARLGQAVKVVTVTSALPGEGKTTTSVCLAIS
AAQAGSRVVVVDCDIRRRNVSRLLGVTAEKGLLDVLDGSAPLNQAVLQDETSGAWILPLAKREFTPHEVFNTPAMHDLLK
QLRAQFDLVILDTAPLLAIAETRVLASQSDAVVFLTRWRKTPAKASNAALQTLRQSDAKIAGVVLTLVDVNEQARYGYGD
PGYYYSSYKNYYAT
>gnl|bykdb|A0A3R3TSL3 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=739 residues).
MQLPSVIGTRDNDQDSIDLLGIFGSLIDQKWLIGALTGAFMVTGVAYAVLATPVYLANALVQVEPKKNDMLGFSDLNSML
GGQSPSVTEIGIIKSRAVIGKTVDDLRLDIDVTPNTFPIIGGFLARRYRGETEFSVAAPRLGLNSYAWGGERLEINRLNL
PKALLGKKLTLIAGEQHRFRLFDENDNLLVEGVAGEAFKQDEVEGQIAQLSANPGTRFEVVRNPRIVTIQSYQDALDISE
QGKESGIIRLALASTDAAEAVKILNKIASLYVQQNVQRTSAEAAQSLQFLQGQLPQVKRDLAKASDALNGYQTRGKTVNI
SLETQSVLEQVVSLDTRISELKMQQAEMDRKFTRQHPAYRALMTQIGELTQQQKALESKAQDLPATQQELLNLTRDVEVA
SQIYTQLLNKSQELDIVRAGAVGNVRLVDSADVDLTSPVKPKKALIVLIATFLGAFFGVALVLLRKSLSRGLEGPEAIEQ
LGLPVYASIPYSALQQEEDSKKVRAKDGTDKPAYLLALRNPTDLSIESIRSLRTCLHFAGLDSTNNRIMISGPSPQVGKT
FVSSNLAAVMALSGQRVVLIDADMRKGHLHKTLDTPITNGLSDLLVKRCSIEQAINKVEIDNLHFISRGQVPPNPSELLM
HANFRELLAQLSERYDVVIIDTPPLLAVTDAAIVGRDAGISLIVTRFGVNPAKEIELTIRRFAQNGIELKGAVFNGVEKR
AASYGTGGYYNYEYASDKS
>gnl|bykdb|A0A3R3UIB9 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=754 residues).
MDMTVSARERNWIAQRLANDAPDILQIWQILWRRKWSILALVLIVMMVTALGTFVITPTYRATSTLLIEHKSANVVSIEQ
VYDPEGMGNEYLLTQFELLKSRALAERVVKKLNLTTHPEFDPRQQPEPLIDIGGLLASFSIGEAIPVILPEDLEEGVDPT
EAKIFDEVTKTFMKRVSIAPLGKSQLVQLQVEMADPRMAAKAANAMANGFIEGQLDATMEMSMTATNWMNTRMLELRTKL
KEAEDKLQAFREKENLVDIGGVSTINAAELSATSDRMIDARRQRAEAQSQYRQVESMRRGGWAKLATIPAVLGHPLIQQF
KADEARARAKVDELSKRYGDRHPALEAARSDLKAASASLRGQVEQIVAGIERNYQLAVANENSLQASVDANKAQIQKISR
KEFQIRELQREVEANRALYDTFMTRLKETAATSDLETANARVVDQSVVPTQPIKPQKSLIISMAGILALMAGIGLSLLLE
MLNNTFKGAEEVEAKLNLPVLGILPLVKNKHRSQIASLFSSNEDKSFSESIRTIRTSLVLSGMSDPHRILVVTSSIPGEG
KSTVAANLAYAFGQMEKVLLVDADLRRPTLAKNFKFPVGTPGLANLIAGTAKVDECIKTIEGIDMLCAGAVPPNPLELLS
SERFTKLIEQLKDSYDRVIIDSPPIQAVSDATILAIHADAQIYVIKSESTSVPLARRGVGQLLQSNSPVTGVVLNQVDIK
KAQKHGYHYGGYYDYYGYTNPQKTDAQTTQGSKA
>gnl|bykdb|A0A3R3W6C3 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=753 residues).
MSLPIESFEPNVPARQQETPLSSHVDAIISNRWMIIAITLLAFLGALAYVMVTPSVYSADIIVQVEEEAPNGQARSLLGD
VSSMFDTKAETSGEMEVLRSRMVVGPAVDKFLLYIHAKPRYFPVVGEWLAQRYEALPYPSSLPRGGYAWGGETIAISHLD
VPNEWLGKPFIVTTQGEGRYTVTDKFTGATFSGAVGKPEQFRLPGGGVMDVHIDALTGRPGTQFTISRSSRLAAIENVQS
HMGIFERGRASGVIGVTLEGNDPALTTAVLNQIGQEYVQQNVNRKAAQAEKSLGFLEQQLPLLKSELDAAETKYNALRNK
RGTIDLSEEAKLILGQSVEAQTRVMDLRAKRQELITRFSPSHPSIVSIDRQIASLSNDVSRIGNNIKQLPDLEQDVVRLV
RDVRVNTELYTGLLNNAQQLRLIRAGKVGNVRILDAAVQPDRPVRPKAAIIIGVATVIGLIFGMLCAFVRNALFGGLSEP
DDVERYTGLPVLAAIPYSDMQDKLWRRSRRKNATVPALLAQSQGNSPPIESLRSFRNVLQASLRQSANNMVMFTGPVAGV
GKSFLSANFAFIQGGVGKRVLLIDADFRKGQLNRYFGVPKEDGLFEVLSGTIPLTRVRKHSVSEGVDFIATGAVTFDPSE
LLASPVFGATLRELSSQYDMVILDTAPVLSSPDAAVVGTHAAAVMVVVRSGMNTVGEIRETAKRLIQAGAPVDGVLFNGL
KLMPERFGFRSKYGNYRYSRAAYYGDFKQNGPK
>gnl|bykdb|A0A3R3XUC2 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=759 residues).
MNARWYPPLPAPYSPEPERPHSRFKEYVDLMLDNRWLIASVTAAVLVLGAGYALFGPRVYEANVLIQLEDAERSPGGAGD
AAVNGVGVKTPTSGEAEILKSRMVLGQAIENTKLFIKARPHYIPVVGAFIARHSKTLSRPGFLGMRGYVSGTERIAVAQM
DVPPALEGKKFLLTAGKDGTYTLTHPDLDTPLHGRVGEPQDSSVPGGTVHLLVASIDARPGGAFELTRHSTQLTMLELQR
ELRVIEKGKQSSVIDVSWQTDDREHLANLLNEVARLYMRQNIDQKTAQAERTLNFLGTELPKFKQQLEQSEEAYNQYRNQ
NGTISLDDEARNALSQNVDLQAKLLDARQKRLDLASRFTSQHPMLITLDAQIASLRKELGGVDNRIRRMPMLQQNSLRMQ
RDIKVNTELYSSLLNSSLQMRLAREGRIGNVRVLDQALSPEKPVRPKAVIVMALALVVGLFLGAVTSVLRKVLKNTVATP
DEIEMRTGLNVYSTIALSTRQGTLDRAIRQGKPGVKLLAASHPDDPALEGVRRLRTALGFLMAGAQNNRILLTSATPGAG
KTFLSANFSAVLAASGRRVLLIDADMRRGKLASQFGLKATTGLSELIAGTATLAQAVHAQVLPHLDVITTGKLPLDPATM
MGSTAFTRLLETLSALYDAVVIDAPPILLATETVAMSPDVGTLMLVARAGDSELGDLVESAKRLAHVGAAFHGVVLNAQD
ARQRHNAYGYDYGPYGLPPNIYPPALGHTPRAEPERATS
>gnl|bykdb|A0A3R3ZKH7 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=742 residues).
MQQSHVQQDIDNDEMDLLGLFGAVVDHKWMIAAITGAFMVAGASYAILATPIYQANALVQVEAKKNDLLGFSDVSSMLGK
ESPSVTEIELIKSRSIIGEAIDSLGLNITVRPNYFPIVGHFLARRYVKKNPDSVSDPLLPLSGFAWGGETLKIGTLQLPD
SLLGTKLVLIVEDKGGYIILNEDGDKIAESKVGELYSNNDISVNVEQIRANPGTKFFIVCSPRLTSILDYQDALDISERG
KESGIIGLSLESEDPNLAIKTLNEIADIYVRQNIERTSAEAAKSLGFLNEQLPKVRRDLEKAEDALNSYQTRSKSVDITL
ETKAILDQIVSLDTNISELKLKQAEMDRKFTREHPAYRALMTQLGELTNKQDGLAKKVQSLPSTQQELLSLTRDVRVGTE
IYTQLLNRSQELDVMRAGTVGNVRLIDGADVDRTKPVKPKKILIVLVATLFGAFLAVALVLLRKAINRGIESPEVIEKLG
LPVYASVPYSLLQKTEEQKKPRTPNRTGKAPSLLAIHHPTDLSIEALRSLRTSLHFGMLDAKNNLLMISGPSPGVGKTFI
SANLAAVVAQAGQRVLLIDVDMRRGYLHDLLGVPYKNGVSDILVNRCDVATAIHKTEIEGFDFMSRGERPPNPSELLMRS
SFTELLNKVSSMYDLVILDTPPLLAVTDAAIVGRQCGTSLIVARFGLNPAREIELTINRFAQNGIKLAGAIFNGVERRAS
ANYGYSGYGYYHYEYKDEKAKA
>gnl|bykdb|A0A3R4AM40 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=742 residues).
MQLPSVVSDRDKDRDEIDLLGLLGTLIDHKWLIGAITGAFMVTGAAYSILSSPVYLANALVQVEPKKNDMLGFSDISSML
GGQSPAATEIGIIKSRAVIGKTVDDLRLDIVTTPKTFPIVGGFIARRYKSTPAQSVSPPLFGMNSFAWGGERLEIEKLKL
PDELLGEKLTLIAAEQNRFQLYDEDGGLLADGTTGATVMENGVEVLVAHMDANPGAKFEVVRNPRIVTIQNYQDILEVSE
QGKESGIISLALASTDYALAVKILNKIASLYVEQNVQRTSAEAAQSLDFLQAQLPQVKEDLAKASNALNSYQTRGNTVNI
SLETKSVLEQMVVLDTRISDLKLQQADLDRKFTREHPTYRALMAQLGDLNKQRHGLEKKVQDLPATQQELLNLTRDVEVA
TQIYTQLLNKSQELDIVRAGAVGNARLIDTADVDITSPVKPRKALIILAATLLGGFVGVALVLVRKSLGRGIEGPDAIEK
LGLPVYASIPYSVLQQEEDSKKLRLANGVNSQSFLLAQRNPTDLSIESIRSLRTCLHFAGLDATNNRIMISGPSPQVGKT
FVSSNLAAVIAQSGQRVVLIDADMRKGHLHKSLATPISNGLSDLLTKRCSIEQAINKLEVDNLHFISRGQVPPNPSELLM
HANFRELLAELSKLYDVVIIDTPPLLAVTDAAIVGREAAINLIVTRFGVNPAKEIELTIRRFAQNGIELKGAIFNGVEKR
ASSYYGNGSYAYYNYEYASDKS
>gnl|bykdb|A0A3R4E576 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=762 residues).
MQLHNRDFQRNWRVDDTDDDNSPRGIDFEAIFAIVRRQWLVVAVCIAVALALGVVNIITAVPLYTASTKILIDRGNSEVV
QQLSTIGGVTDDEPTVLSQVELLMSDTVALTVVDKLDLSNDPTFMTARPSLIQTIMGTVRSLVTVTGWLGSKPAEIPTSE
EKRRAAADAVLANMSVMRVDRTYVLEVSYRSPSADMAARVANAIGDSYLVDKLNSKYDATRRASDWLQDRIAELRQKALD
SDLAVQKFRGEHGLVAAGSVLMSDQQLSELNSALIVAQSDTSKAQARLERIESIIASGQSDAMVTDLLDNPVANELRQKY
LAASKRETEISDRLGSNHIQAARLRSEMAEYQRQMFAELNRIAESYKSDLDVAVAREKSLTQSVSQATGVSATANLTQVQ
LRELEREAETYKNLYQTFLQRYQEAIQQQSFPVTEARIITNAVPPAGPSHPKKPLTLALFFLLGAAAGAGVGGWREYRDR
FFRTGKQVQDYLGLEFLGMTPLVPNAASPAKSGVQQKPGLIQKTSPLVTYVVEHPLSPFAETLRSAKIAADLRFSDKPCK
VIGIVSSLPAEGKSAISINFAELLARQGSKTLLIDADLRNPGTTRAIARHADAGLLEALLDGQDLDRLLLSDDATGLSVL
PAVVRQRTPHSSELLASSGMRGLLKKVSEQYDYIVVDLPPLGPVVDARAIADRIDGFIFVAEWGATARRVAIEVLNANPQ
VRDKCIGVILNKVDQDRLKLYHDYGSNDYYYSRYSRYYHESN
>gnl|bykdb|A0A3R4EU13 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=734 residues).
MSTTIEIPAARSETFGLRNLLAIFRRRLRLFAAIVLIVFLAALVVTARMTPRYTAQAQVMLNTRQEQVVDTKAVLSNLPA
ESGVIDTEVEVLQSRDLARQVAEKLQLERDPEFNWALRPPTGLKALIARMQGKSVAPSPPPTTPNEILMGRERAASALQG
GLAVRRSGLTYIIVIAYTALNPEKAAQIANAYAEQYVQNQIQAKYAANNQANTFLDSRLNQLRSEVLAAEAAVEQYRSAN
NLLTTSGATLTEQEISSYNQQLATTQAEQAAEEARLRAARSQLARGSSGDDVGEALQSSVVSQLRGQRAVVTARVADLQA
RYGPRHPEMLRAQQELAAIDGQIQAEIQRVISNLEARVQVARDRTNSVQSSIGRARGTLAGNNAAAVRLNELERNAEAVR
TLYKGLLDRYQETTSRAGVETADSRIVSAAKAPGSPSSPNIPVNLVLGFIFAVGAGLTAVVIMEMLDDGLLTADDVEARL
GLPTLGSVPLLMSIADRKDRHMPPTEYLLARPLSGFAEAFRSLRTSILYARLGQAVKVVTVTSALPGEGKTTTSVCLAIS
AAQAGSRVVVVDCDIRRRNVSRLLGVTAEKGLLDVLDGSAPLNQAVLQDETSGAWILPLAKREFTPHEVFNTPAMHDLLK
QLRAQFDLVILDTAPLLAIAETRVLASQSDAVVFLTRWRKTPAKASNAALQTLRQSDAKIAGVVLTLVDVNEQARYGYGD
PGYYYSSYKNYYAT
>gnl|bykdb|A0A3R4Q9I0 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=744 residues).
MQSPNSLPIQEHRDDDDDIDLLALFGTLIDSKWIIVGITAFFCAVGVAYALLSTPIYQANALVQVEEKKGGMAALGGMGE
MSEMFGGTSPAVTEIELLKSRAILGKAVENLKLDILIEPNYFPFIGHFLSRRFEPASEHQVAAPLLGLDSYTWGGEKLDI
FQLEVPDAYLGKGLKLRSEGNGTFTLLNDDEVLLHGQTGEKLEQNGFKLQVSTLNANAGALFNVTKQRRLNTILQYQDDV
SASERGKESGIIALSLENEDPAKANKVLDEINRLYVLQNVQRNSAEAAQSLEFLRTQLPDVRKQLEKAEGQLNAYQSSAR
SVDITIETKAVLDQIVALETLISELKLKQAEMEHRFTREHPSYQALMTQMGQLDQQKRGLEKKVKNLPETQQELLRLTRD
MQVTTDIYTQLLNKTQELDIVRAGTVGNVRVIDSADANIEKPVKPKKMLIVLIATLLGGLIAVAYVLVRKAMNRGVEDPE
VIEQLGIPVYASIPLSKGQSQIEGTLKGSNRASTGSLLLAVNNPADLAVESLRSLRTSLHFATLEAKNNILMISGPSPAV
GKSFVSSNLAAIIAQTGQKVLLVDADMRKGYLNKMFRMDVNSGLSDLLAGKIDLNKATHSTEVDNLHVITRGQIPPNPSE
LLMHSNFTRFLEQVSSQYDLVIIDTPPILAVTDAALVGRQAGTSLIVTRFGVNAAKEIAVTKRRFEQNGIVVKGAIFNAV
ERKASAYGYGSYSYYQYEYASDKK
>gnl|bykdb|A0A3R4QTV3 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=702 residues).
MVTGAAYSILSSPVYLANALVQVEPKKNDMLGFSDISSMLGGQSPAATEIGIIKSRAVIGKTVDDLRLDIVTTPKTFPIV
GGFIARRYKSTPAQSVSPPLFGMNSFAWGGERLEIEKLKLPDELLGEKLTLIAGEQNRFQLYDDDGALLADGTTGTTVIE
NGVEVLVAHMDANPGAKFEVVRNPRIVTIRNYQDILEVSEQGKESGIISLALASTDYALAVKILNKIASLYVEQNVQRTS
AEAAQSLDFLQAQLPQVKEDLAKASNALNSYQTHGNTVNISLETKSVLEQMVVLDTRISDLKLQQADLDRKFTREHPAYR
ALMAQLGDLNKQRHGLEKKVQDLPATQQELLNLTRDVEVATQIYTQLLNKSQELDIVRAGAVGNARLIDTADVDITSPVK
PRKALIILAATLLGGFVGVALVLVRKSLGRGIEGPDAIEKLGLPVYASIPYSVLQQEEDSKKLRLANGVNSQSFLLAQRN
PTDLSIESIRSLRTCLHFAGLDATNNRIMISGPSPQVGKTFVSSNLAAVIAQSGQRVVLIDADMRKGHLHKSLATPISNG
LSDLLTKRCSIEQAINKLEVDNLHFISRGQVPPNPSELLMHANFRELLAELSKLYDVVIIDTPPLLAVTDAAIVGREAAI
NLIVTRFGVNPAKEIELTIRRFAQNGIELKGAIFNGVEKRASSYYGNGSYAYYNYEYASDKS
>gnl|bykdb|A0A3R4YGM2 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=742 residues).
MQLPSVIGTRDNDQDSIDLLGIFGSLIDQKWLIGALTGAFMVTGVAYAVLATPVYLANALVQVEPKKNDMLGFSDLNSML
GGQSPSVTEIGIIKSRAVIGKTVDDLRLDIDVTPNTFPMIGGFLARRYRGETETSVAAPRFGLNSYAWGGERLEFARLNL
PKELLGKKLTLIAGEQKHFQLLDDNDNLLVEGVAGEAFAQDGVEGQITQLLANPGTRFEVVRNPRIVTIQGYQDALDISE
QGKESGIIKLALASSDAAEAVKILNKIAALYVDQNVRRTSAEAAQSLAFLQSQLPQVKRDLAKASDALNAYQTHGKTVNI
SLETQSVLGQSVALETRISELKMQQAEMDRKFTKQHPAYRALMSQIGELTQQQKSLEGKVGDLPATQQELLNLTRDVEVA
SQIYTQLLNKSQELDIVRAGAVGNVRLVDAADVDLTSPVKPKKALIVLIATFLGAFVGVALVLLRKSLSRGLEGPEAIEQ
LGLPVYASIPYSALQDEEDNKKGRARDGVDKPAYLLALRNPTDLSIESIRSLRTCLHFAGLDSTNNRIMISGPSPQVGKT
FVSSNLAAVMALSGQRVVLIDADMRKGHLHKTLNTPITNGLSDLLVKRCSIDQAIHKVEIDNLHFISRGQVPPNPSELLM
HANFRELLAELSERYDLVIIDTPPLLAVTDAAIVGREAGISLIVTRFGVNPAKEIELTIRRFAQNGIELKGAVFNGVEKR
AASYYGNGGYGYYNYEYASDKS
>gnl|bykdb|A0A3R5D942 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=750 residues).
MTPSASTSPLSAALARDDDDDAINLSEYLDILLDRKWLVAGVTAVALAIGTAYALLATPIYQSNLLIQVEDSAPDAKNFL
GDTANLFDVKTPATGEIQIIRSRMVIGGAVEAKQLYIDAQPRYLPIIGEWLSRRAKELSNPGFLGMGGYVSGTEAIDIAK
FNVPPTLEEQKPFTITALAGDQYTLTHPDLAESLTGTVGKVLSQQLPAGTITLVVSRLDGKPGAEFLVSRASLLATTEDL
QKRLQLAEQGKQSNVISASLEDSDRDRLQRTLNEIGAQYVRQNVERKAAEAEKTIEFLDRQLPEFKRQLESSEDAYARFR
NQNGTVAFDEEAKAALTMSVQLQTKLLESQQLRRELLSRFTESNPKVRMIDGQIAAVRHEIEGLETRVSAMPAIQRDALR
LERDVRVNGELYKSMLDSSLQLRLVKEGKIGNVRLLDTAVEPRRAVKPQKPLVVALSLVLGLLTGVALAILRSKLSSGIR
NPQEIEDRLGLNVYSVVPLALEQETILEHIAGGAKGVQLLAVTSPESLAIESLRNLRVSLQLTLMESGNNRVLITGATPG
VGKSFVSGNFAVIMAQAGKRVLLIDADLRKGHLQKAFGLPRKGGLAEILAGDLTPEQATHVQVIPNLDVLTTGAYPFNPA
NMMLSAALGELLNDFSERYDLVVIDSPPVLVAADAAAVAAHAGAVLLVARDNLTQLGELNESIKRLAHAGQQVNGVVFNG
MDLSRRHYGSYGYKYGGYRYTEYKYKEEAA
>gnl|bykdb|A0A3R5EJ70 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=751 residues).
MTPSASTSAPLTPNTIRPRDDDDDVINLSEYFDILLDRKWLVAGVTAVALGLGLAYALLATPIYESNLLIQVEDSAPDSK
NFLGDTANLFDVKTPAIGEIQIIRSRMVIGGAVEAMRLYINAQPRYVPVIGEWLSRRSTELSNPGFLGMGGYVSGTEAID
IAKFDVPSALEDQQPFTITAQADDHYTVSHPGLPEPLTGTAGKMLSQQVPGGTITLMVSRIDGKPGAEFLVSRASSLATT
ESLQKRVQLSEQGKQSNVINVTLEGSDRGRLRRTLNEIGAQYVRQNVERKAAEAEKTIEFLDQQLPEFKRQLEDSEDVYA
RFRNKNGTVAFDEEAKAVLGMSVQLQTKLLDTQQQRRELLARFTETNPKVRMVDGQIAAINHEINGLETRVSAMPAIQRD
ALRLERDVRVNGELYKSLLNSSLQLRLVKEGKIGNVRLLDTAIEPKSAVKPQKPLIVALSLILGLLAGVALAILRTKLSS
GIRNPQEIEDRLGLNVYSVVPLALEQETILEHIAGGAKGVQLLAVTSPESLAIESLRNLRVSLQLTLMESGNNRVLITGA
TPGVGKSFVSGNFAVIMAQAGKRVLLIDADLRKGHLQKAFGLPRKGGLADVLAGDMSPEQAIHGQVIPNLDVLTTGNYPF
NPANMMLSSKLGELLNDFSERYDLVVIDSPPVLVAADAAAVAAHAGAVLLVARDNLTQLGELNESVKRLAHAGQQVNGVV
FNGMDLSRRHYGSYGYKYGGYRYTEYKYKEA
>gnl|bykdb|A0A3R5H8M2 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=731 residues).
MNQNSSTSEDTIDLKELFFSLIAQWKLIALCTIFSLICALLYLRVTQPVYSTDALILVEDGKSAASAALLGELSQLSGGV
GQKSPADAEIEVLKSRMVLGQVIQDLNLNIKIKDSADSVLNRLVSTKQSQVNYTPNEVIYQNGATSVQIKHLNIPAFYLD
KPLQLNFNTPNTFQIHYNDAVVFEGKTNIKNQVPSQYGLWEVYVAKDRTSTPELEVTKYSLPTAMKNLTLDYAVAERGKM
TGVIGLNYQGTDKEHITKVLNHILSVYHKQNIERKSLESTQTLAFLDKQLPVLKQQLEDSEIQFNKFREKYNTVDVTQES
ELLLKQNIELERLMIELKQKQAEFSAKYTNDHPLMAEINAQLKELSSKKEQLNQALKQLPETQRLYLQLYRDVKVNAEQY
TALLNNYQQLKIANAGEIGNVRIVDTAIAPVDKIKPKTLIVLILSIFVGGFLGTLLALLRNMMRSGIKDSAQIENELDLP
VYATVPRSPVQESRINILKKKKNIPILAVKNSDDIAIESLRSMRTAIHFALSSARNNLITISGPAPEVGKSFISTNLATI
LAQSDKRVLIMDADLRRGYLHKYFNLDTQPGLTELLNGQQSLETVIRHTEVPGLSVISRGKSPANPSELLSSTQFKALLE
QLSEKFDHVIIDTPPVLAVTDGIIISQYTGVNLVIARYAKTQMKELELTLNRFEQAGVKVNGFILNDIQRSAGSGYGYNY
AYAYKANKELD
>gnl|bykdb|A0A3R5LMR4 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=729 residues).
MTISSTSSTSSSRQNNAAVENDEIDLGRLLGYLIDGRWWIVTITALFMVLGVAYALLATPVFKANALLQVEKKASGAALL
GDMADVLGGEQPDAAAEIELLTSRMVLGRTVQELHLDTVVTPDFFPLVGRGLSRLMGHPYPKMAVSRFEVAPELVGTPLT
LTVDADKHFTLEIEGRVLEGQVGKLLEKDDVTLLLSDVAADEGQVFTLVKQPVLDVIAELQRDLQVSEKGKNTGIISLAL
EGEDKGRIRAVLDNISQNYLQQNVVRKTEEAQKSLDFLQTHLPQVKGELNRSEELLNVYRQQNESVDLSLEAKAALDTMV
GLEKQLNELTFREAELQQLYTRQHPAYIALMEKRQTLMNTKNVINKSIKRLPKTQQEILRLTRDVQVGQEIFVQLLNKQQ
ELNIMKAGTIGNVRIIDDAAVETRAVKPKKPLIVVLATLLGGMLSVGLILVRAAFHRGVESPEQLEEMGLSVYATIPYSE
DQAKIEQQQKKKRRQAMPLNEALLAARNPADLAMESLRSLRTSLHFAMMEAKNNIVMISGPGPGLGKTFVSTNFAATLAM
GGKKVLVIDADLRKGYMQKVMGQEMGAGLSAYLAGQTEMMQVISKTGFDGLDFVCRGAVPPNPSELLMHPRFKALLDWAS
EHYDFVIVDSPPILAVTDAAIVGQHVGASLLVARFAKTAVKEVEVAIRRFEQNGVVIKGILLNAVEKKASSYYGNYGYYQ
YSYGDKTKA
>gnl|bykdb|A0A3R5Q2V2 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=725 residues).
MTTSSVSSRQNSAAVENDEIDLGRLLGYLIDGRWWIVTITSLFMVLGVAYALLATPVFKANALLQVEKKASGAALLGDMA
DVLGGEQPDAAAEIELLTSRMVLGRTVQELHLDTVVTPDFFPLIGRGMSRLMGHPYPKMAVSRFEVAPELVGVPLTLTLG
EDKHFTLEVEGRVLEGQVGKLLEQDDVTLLLSDVAAQDGQVFTLLKQPVLDVIAELQSGLQVSEKGKNTGIILLALEGED
KGRIRSVLDNISQNYLQQNVVRKTEEAQKSLDFLQVHLPQVKDELNRSEELLNVYRQQNESVDLSLEAKAALDTMVGLEK
QLNELTFREAELQQLYTRQHPAYIALMEKRQTLMNTKNTINKSIKRLPKTQQDILRLTRDVQVGQEIFVQLLNKQQELNI
MKAGTIGNVRIIDDAAVETRAVKPKKPLIVVLATLLGGMLSVGIILVRAAFHRGVESPEQLEEMGLSVYATIPYSGEQAK
IEQQQKKKRRKLMPLNEALLAARNPADLAMESLRSLRTSLHFAMMEAKNNIVMISGPGPGLGKTFVSTNFAATLAMGGKK
VLVIDADLRKGYMQKVMGQEMGAGLSAYLAGQTEMMQVISKTGFDGLDFVCRGAVPPNPSELLMHPRFKALLDWASERYD
FVIVDSPPILAVTDAAIVGQHVGASLLVARFAKTAVKEVEVAIRRFEQNGVVIKGILLNAVEKKASSYYGNYGYYQYSYG
DKTKA
>gnl|bykdb|A0A404B052 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=725 residues).
MTTSSVSSRQNSAAVENDEIDLGRLLGYLIDGRWWIVSITGLFMVIGVAYALLATPVFKANALLQVEKKVSGAALLGDMA
DVLGGEQPEAAAEIELLTSRMVLGRTVQELHLDTVVTPDFFPLVGRGMSRLMGQPYPKMAISRFEVAPELIGTPFTLTLT
GESRFTLEIEGRVLEGQVGKLLEKEGVTLLVTDVAAQDDQVFTLIKQPLLDVIGELQRDLQVSEKGKNTGIISLALEGED
KGRIRAVLDNISQNYLQQNVVRKTEEAQKSLDFLQTHLPQVKDDLNRSEELLNAYRQQNESVDLSLEAKAALDTMVGLEK
QLNELTFREAELQQLYTRQHPAYIALMEKRQTLMNTKNTINKSIKRLPKTQQDILRLTRDVQVGQEIFVQLLNKQQELNI
MKAGTIGNVRIIDDAAVETRAVKPKKPLIVVLATLLGGMLSVGLILVRAAFHRGVESPEQLEEMGLSVYATIPYSGEQAK
IEQQQKKKRRQAMPLNEALLAARNPADLAMESLRSLRTSLHFAMMEAKNNIVMISGPGPGLGKTFVSTNFAATLAMGGKK
VLVIDADMRKGYMQKVMGQEMGAGLSAYLAGQTEMMQVISKTGFDGLDFVCRGAVPPNPSELLMHPRFKALLDWASEHYD
FVIVDSPPILAVTDAAIVGQHVGASLLVARFAKTAVKEVEVAIRRFEQNGVVIKGILLNADEKKASSYYGNYGYYQYSYG
DKAKA
>gnl|bykdb|A0A404I461 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=762 residues).
MQLHNRDFQRNWRVDDTDDDNSPRGIDFEAIFAIVRRQWLVVAVCIAVALALGVVSIITAVPLYTASTKILIDRGNSEVV
QQLSTIGGVTDDEPTVLSQVELLMSDTVALTVVDKLDLSNDPTFMTARPSLIQTIMGTVRSLVTVTGWLGSKPAEIPTSE
EKRRAAADAVLANMSVMRVDRTYVLEVSYRSPSADMAARVANAIGDSYLVDKLNSKYDATRRASDWLQDRIAELRQKALD
SDLAVQKFRGEHGLVAAGSVLMSDQQLSELNSALIVAQSDTSKAQARLERIESIIASGQSDAMVTDLLDNPVANELRQKY
LAASKRETEISDRLGSNHIQAARLRSEMAEYQRQMFAELNRIAESYKSDLDVAVAREKSLTQSVSQATGVSATANLTQVQ
LRELEREAETYKNLYQTFLQRYQEAIQQQSFPVTEARIITNAVPPAGPSHPKKPLTLALFFLLGAAAGAGVGGWREYRDR
FFRTGKQVQDYLGLEFLGMTPLVPNAASPAKSGVQQKPGLIQKTSPLVTYVVEHPLSPFAETLRSAKIAADLRFSDKPCK
VIGIVSSLPAEGKSAISINFAELLARQGSKTLLIDADLRNPGTTRAIARHADAGLLEALLDGQDLDRLLLSDDATGLSVL
PAVVRQRTPHSSELLASSGMRGLLKKVSEQYDYIVVDLPPLGPVVDARAIADRIDGFIFVAEWGATARRVAIEVLNANPQ
VRDKCIGVILNKVDQDRLKLYHDYGSNDYYYSRYSRYYHESN
>gnl|bykdb|A0A404IBN2 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=741 residues).
MQQTPALTSHDDDEIDLMGLLGTLVDHKWLIAGITAASMAVGTAYAVLATPVYEATALIQVEAKKNDMLGFSDINSMLGK
ESPSATEIELIKSRAIVGKVVDNLSLDITVEPNRFPVIGDFIARRFKPDAVNTVATPWLGMNSFAWGGETLKIFQLELPQ
ELLGQELTFITGESGHFTLLDEDDNVLIEGQAGQAYDQDGIKLQVEVLQANPGTTFSIVRDPRLTSILKYQKVLDVSERG
KESGMIGLALESEKPAEAIQILNEIAKLYVRQNVERTSAEAAQSLEFLKDQLPQVRQDLEKAENALNKYQIRSKSIDISL
EAKAILDQIVALDTSISELKLQQAEMDRKFTRQHPAYRALLSQLGELTAKQDGLAKKVEGLPSTQQELLSLTRDVKVSTE
IYTQLLNKSQELDVMRAGTVGNVRLIDTADVDLKKPVKPKKPLIVLIATLLGAFLATAVVLFRKALSRGVENPDQIEQLG
LPVYASIPFSTLQKTEESKTFRSGRGRANNTAPILASSHPTDLAIEGLRSLRTSLHFAMLEASNNRLMISGPSPKVGKTF
VSANLAAVIAQTGQRVLLIDVDMRKGYLHKVFGTPAENGLSDLLVKRCDLATAINKTEFEHLDVIGRGQIPPNPSELLMH
ANFSAFLDQVSAQYDLVILDTPPLLAVTDAAIVGRQSGTSLIVTRFALNPAREIELTMRRFAQNGIELKGAIFNGVEKRA
SAKYGYADYGYYNYEYKSESV
>gnl|bykdb|A0A404TF61 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=742 residues).
MQQTPALTSHDDDDEIDLMGLLGTLVDHKWLIAGITAASMAVGTAYAVLANPVYQATALIQVEAKKNDMLGFSDINSMLG
KESPSATEIELIKSRAIIGKVVDNLSLDITVEPNHFPVIGDFIARRFKPDAVNTVATPWLGMNSFAWGGETLKIFQLELP
QELLGQELTFVSGESGHFTLLDEDDNVLIEGQVGQAYDKDGIKLQVEVLQANPGTTFSIVRDPRLTSILKYQKVLDVSER
GKESGMIGLALESEKPAEAIQILNEIAKLYVRQNVERTSAEAAQSLEFLKDQLPQVRQDLEKAENALNKYQIRSKSIDIS
LEAKAILDQIVALDTSISELKLQQAEMDRKFTRQHPAYRALLSQLGELTAKQDGLAKKVEGLPSTQQELLSLTRDVKVST
EIYTQLLNKSQELDVMRAGTVGNVRLIDTADVDLRKPVKPRKPLIVLIATLFGAFLATALVLFRKALNRGVENPDQIEQL
GLPVYASIPFSSLQKSEESKILRSGRGRANKVAPILASSHPTDLAIEGLRSLRTSLHFAMLEASNNRLMISGPSPKVGKT
FVSANLAAVIAQTGQRVLLIDVDMRKGYLHKVFGTPAENGLSDLLVKRCDLATAINKTEFEHLDVIGRGQIPPNPSELLM
HANFSAFLEQVSAQYDLVILDTPPLLAVTDAAIVGRQSGTSLIVTRFALNPVREIELTMRRFAQNGIELKGAIFNGVEKR
ASAKYGYADYGYYNYEYKSESV
>gnl|bykdb|A0A405AF34 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=725 residues).
MMKNNAMPIVMAEQDEKLDWERLIGPLWDNRWRILLVTGVAGVLGCAYALMATPIYQATALVQVEKQLSGDSLLRETLDN
SMGSMGQNSATQDEVSLAKSRYVIGKTVDDLGLTVRISPDYFPLFGKGLARLSGEPPPVLLISGMTVPAAMQGQELTLTV
QDKQRYSLSHDGKNLFSGTVGQPLKQGAWAMNVTALEALPGTEFSVVNVPRQQAVDDLRNLLDVAPGGKESGIMTFNLAG
EDPQRAEAVLKSITDNYLQQNVDRKTEEAQRMLAFLHEQLPRTQTSLNNAENQLNQFRQQNDSVDLTLEAKSVLDTQVQL
EAQLNELTFKEAEISKLYTREHPAYRALLEKRATLEAEKARLGKQVQTLPKTQQEILRLTRDVQVDQQVYMQLMNKQQEL
SISKAGTVGNIRIIDEAESGLRPIKPQKAMIVLFALLMGGVLSASIVVLRAALQRGVSDTEALEKRGINVYATVPLSPWQ
QKRNRTQQQLLVKNGGDKLPILAREEPGDLSVEAIRSLRTSLHFAMMEAKNNILMVSGASPASGKSFTSTNLAVVIAEAG
QRVLLIDADMRKGFLHRWFNNSARGGLSDMLSGLIAPDQSVKKTAIANLDFVPRGQVPPNPSELLMHQRFADFLQWARQN
YDLVLIDTPPVLAVTDAAIVGHHVGTALMVVRFEVDTVRQIETSIRRFEQNGVAIKGVILNGMVKKTATDAGYYAFAYPS
HQEKV
>gnl|bykdb|A0A405APZ8 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=719 residues).
MLDKELPQGQKEQSEEIDLHRLFAELLTNRWLITGITGVFAAISLIYVIFATPVYKSTALIQVEKNAGNSLLTDISSMLP
DSQPQSDAEIELIQSRMVVGKTVQDLGLETQVTQEYFPIFGKGWARLTAQKPAEIALSRLSVPDRLINEELVLTVLDDNH
YLLESDGDKLFEGQVGKLASADGVTLLVSGIKAEEGTKFSVVKRSELRVLEDMGQNLTVADKGKDTGVLGLNYTGEDPVL
IKKILSSISHNYLQQNVERKSEEAAKSLKFLEQQLPLVRFQLDEAENKLNAYREEKDSVDLSLEAKSLLDTVVGVESQLN
QLTLREAEISQLYTKDHPAYRSLMDKRKTLQGERDKLNKRISAMPATQQEILRLNRDVQAGQEIYMALLNKQQELSISKA
STIGNVRIVDDAVTLPNPIAPKRFLLVFLVTIIGAFFSAGIVFLKVLMHRALQNPNQLEEIGINVYASIPISEMQQKKDM
LLIRGKSRQKQDGLLLAEANPADLAIEAIRSLRTSLHFAMLEAKNKVVMISGASPEIGKTFVCANLAAVIAQSGERVLLI
DADMRRGRLHEVLSNDNQLGLSAVLSGQTTLDKAISKTEVANLDFLPRGKVPPNPSELLMHERFAEFVKWAAANYDMVLI
DSPPILAVTDASIIGRLVGTSMIVARYNVTTLKEVEVSVRRFENSGVNIKGVVFNAQERKSAGYYGYGYYNYSYESKND
>gnl|bykdb|A0A405JUY6 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=781 residues).
MDQANFRPMTIFPPEPKDHDTFIDLDKLWSAAMRRLGVIGACVAAMVVLAGLYLVFAQPMYTSMTNILMDDNLSRYAEEN
ASDNQSAQMLDNRMSSAVEILKSKELALSVVDKAKLDQNALIVDPPKSPVDLVKGMLRGVTSIFSADAPALTEEQIAAGR
REKAAAIIQQWLTVERVGRSSVIAVSVRSPDKLLSAQITRTYAESYLTEQLNANFDATERASIWLQERLNDLNTRSQQAS
LAVEQFKRDKGLISPRGELLSAQQLSDLNSQLIVAQADAATAAARYNQYKAIIEKGPEAAVHNAVVSNRDTDNTVMQDLR
KRYIGINDREQAIIQQFGADHPQAIAMKAEKQDVTNQMFRELQQLTGSFKNELDVSQSRVESMRENIQRVAGNNSDANVN
MVQLQELEQKASALRTLYESYLQRFEQASQQQSLPIAKARVISDAGVPVSPSSPRKTLTIALSVILGLLIGCAAAAVLEL
RERFFRTGEDVQQKLGMRFLGYLPRIAGAAREDAPKPSAVPEQGEAANQPVGDPISFRRMMRVAVEAPRSQFAETLRNTK
LACDIVLQGKKCAVIGVVSCLPGEGKSTVAANFAGLIASSGARTLVIDADLRNPGLSKMLASEPEVGLVDVILNKASWTS
VARVDRRSRLTILPMTTRGRQVTHTSELLASSGMSQFLESIKDTFDVIVVDLAPLIPVIDAKAFEPYADAFVFVTEWGAT
PAKAVQSVLQSEPQIAAKTIGVILNKTDLSELHKYADPGAPERLRSNYLSYYRDYKEVAAE
>gnl|bykdb|A0A405V7W6 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=766 residues).
MSVIFRRYWWWVILLVLFFMSIAFFYLRYTKPVYESSMLIQLAEKDQAKELLAIDNINKRDDISTEIELLRSQLLFEMAI
ARMNINVSMFSKGKILTEEKYHQSTFTILPYALRDSSLCDVPIWIETLEHHKIRLSYTLNNKTYSKVSDINTKISTVHFD
IGLKVQNWEMLQHDDEANELYFTFNNQKNLAARLISNLQVNAIDANAKTIELRYNGNNFEMCRDIIQSVAITFFNYDEEV
KRKGADNILKFIQLQLDSLSGELKESKDSLTDFQRKTNLTDPENNGRKLSDNMDKYQDMLFELDNELATLRTVNSKLKSE
PNRLDIYRLIPEMLGKSFEISLTKQITDLNSLLERKEELLTNVSENNSELKNLGVRIQSKIQSIRRSVEVIEDRIKSQRN
VINSNLGKIEGEYLKMPQQKMEYNRLKSLQDLNEKYYTLLTEKKVMYSISNAGYTSSNRILNEASLNSIPVSPNRRLVYA
GFIFIGFVIGFAFLFFKYITFNEINTIEDLKQLLPEKVTILGNIPLLKESSEFSQLMIHNNPKSILAESMRNIRTNLSFV
NSNARVIAISSSISGEGKTFVALNLAGIIALSGKKTIVIDLDLRKPKVHLGLNVTNDKGISNLIIKQATLDECIRTSEIE
TLDFISAGPIPPNPSELILSESFFEILEELKSRYDLVIIDNPPVGLVTDGVQILAKADVPIYIFKAHYSKRIFAGRVREL
FEMNQISHLNIILNGTKAFKGKYGYGYGYGYGYGYYEEESKKKKKG
>gnl|bykdb|A0A405ZIS9 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=757 residues).
MQRHDPLTMADYDKSGLTAEFIDIDAALAIIRRQWRIVLAAIAVAGAIGLAFAATAVPVYSATATLLIDRNNSQIVEQLS
TIGGVIEDEASILSQVEVLQSETIGLAVVDSLKLTENQEFRATRASLLSSIFGTIRSLVNVSQWFSPAKKESVVDDGTLK
RSLSDQLLNGLSVKRIGRTYALELTYNSTSPVLAAQIVNAVASAYLLDKLNSKYEATRRASDWLSDRIAELRQRALDTDL
AVQKFRAEHNLISTGNNSLLSDQQLAESNSALILAQSETAKARARVQRIEHILATDDVDGVVTDILDSSVANDLRKKYLE
SSKIEAEITRRLGSNHIQAVRLRNEMQEYRRLMFQEISRIAQSYKSDLEVSEAKEKSLAESVAKATDISNSASETQVQLR
ELQREAETYKNMYQTFLQRYQEAMQQQSFPVTEARVISKAMPPRIPSKPNKPIILALFMIMGAAAGGGIAMFREFRDRFF
RTGEQVRDVLGLEFLGNTPLIPNKPATEAPESGHPGLTLPTSVARYAVDHPLSSFAETLRSTRLAIDLGISAKSGARIVG
VVSALPSEGKSTISINLAQLLAGQGARVLLLDADIRNPGATRAMARHASEGLLEVLLEGRSVQDVLLRDEKTRLAFLPTV
VKQRVPHSSELLTSAQMHKLLAEASNAFDYIIVDLPPLGPVVDARAMAGRIDGFIFVTEWGKTARRAVRNTVENEVHIRK
KCLGVILNKVDTEKLKLYRAYGSSEYYHSRYTRYYHD
>gnl|bykdb|A0A406JUR4 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=727 residues).
MNQNTNTEDTIDLKELFFSLIAQWKLIALCIILSLVCALLYLRVTPDTYSVDALVQVEDSKGASAALLGDLSQMMEQKSP
AQAEIEILKSRLVLGSVIKELHLNIQVSSTENTLTHRLLSDTEYKTEYTKKSVLFKDDLKSFEVREFEVPAFYLDKNLLL
NFDKQSLRLTDPTTEEVILTVPLNQANHVTGPHGLWKVAIFTKDQLDATYNISNLSLPAAVDAISSNYSVGERGKLTGVL
GLNYQGQDKEHITNVLNAILATYSAQNIERRSAESAQTLKFLDEQLPELKKQLDDAERQFNKFRQQYNTVDVTKESELYL
TQSITLETKKAELEQKQAEMVAKYTAEHPAMREINGQLGAINKQIGELNSTLKQLPDVQRQYLQLYREVEVKTQLYTALL
NSYQQLRIAKAGEIGNVRIVDTAIEPVEPIKPKKLLVLILSIFVGGFIGTLVALLRNMLRTGIKDSGQIENELDLPVYAT
VPRSPIQESRIKILKKKKSIPILAVKNSDDIAIESLRSIRTAIHFALTSAKNNIIMIAGPSPEVGKSFISTNLATIFAQG
NKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQADLQKVLHKTQVANLDVITRGKSPTNPSEILSSTQFKDLLETVQS
QYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSQMKELELTLNRFEQAGVKINGFILNDIQRASAGYGYGYNYAYA
YKAQKED
>gnl|bykdb|A0A406MXU2 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=742 residues).
MQQTPALTSHDDDDDIDLMGLLGTLVDHKWLIAGITAASMAVGTAYAVLANPVYQATALLQVEAKKNDLLGFSDINSMLG
KESPSATEIELIKSRAIIGKVVDNLSLDITVEPNRFPVIGDFIARRFKPDAVNTVATPWLGMNSFAWGGETLKIFQLELP
QELLGQELTFISGESGHFTLLDEDDNVLIEGQTGQAYDQDGIKLQVEVLQANPGTTFSIVRDPRLTSILKYQKVLDVSER
GKESGMIGLALESEKPAEAIQILNEIAKLYVRQNVERTSAEAAQSLEFLKDQLPQVRKDLEKAENALNKYQIRSKSIDIS
LEAKAILDQIVALDTSISELKLQQAEMDRKFTRQHPAYRALLSQLGELTAKQNGLAKKVEGLPSTQQELLSLTRDVKVST
EIYTQLLNKSQELDVMRAGTVGNVRLIDTADVDLKKPVKPKKPLIVLIATLLGAFLATAVVLFRKALSRGVENPDQIEQL
GLPVYASIPFSTLQKTEESKTFRSGRGRANNTAPILASSHPTDLAIEGLRSLRTSLHFAMLEASNNRLMISGPSPKVGKT
FVSANLAAVIAQTGQRVLLIDVDMRKGYLHKVFGTPAENGLSDLLVKRCDLATAINKTEFEHLDVIGRGQIPPNPSELLM
HANFSAFLDQVSAQYDLVILDTPPLLAVTDAAIVGRQSGTSLIVTRFALNPVREIELTMRRFAQNGIDLKGAIFNGVEKR
ASAKYGYADYGYYNYEYKSENV
>gnl|bykdb|A0A406Y387 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=741 residues).
MQQTPALTSHDDDEIDLMGLLGTLVDHKWLIAGITAASMAVGTAYAVLANPVYQATALIQVEAKKNDMLGFSDINSMLGK
ESPSATEIELIKSRAIIGKVVDNLSLDITVEPNRFPVIGDFIARRFKPDAVNTVATPWLGMNSFAWGGETLKIFQLELPQ
ELLGQELTFITGESGHFTLLDEDDNVLIEGQAGQAYDQDGIKLQVEVLQANPGTTFSIVRDQRLTSILKYQKVLDVSERG
KESGMIGLALESEKPAEAIQILNEIAKLYVRQNVERTSAEAAQSLEFLKDQLPQVRQDLEKAENALNKYQIRSKSIDISL
EAKAILDQIVALDTSISELKLQQAEMDRKFTRQHPAYRALLSQLGELTAKQNGLAKKVEGLPSTQQELLSLTRDVKVSTE
IYTQLLNKSQELDVMRAGTVGNVRLIDTADVDLKKPVKPKKPLIVLIATLLGAFLATAVVLFRKALSRGVENPDQIEQLG
LPVYASIPFSTLQKTEESKTFRSGRGRANNAAPILASSHPTDLAIEGLRSLRTSLHFAMLEASNNRLMISGPSPKVGKTF
VSANLAAVIAQTGQRVLLIDVDMRKGYLHKVFGTPAENGLSDLLVKRCDLATAINKTEFEHLDVIGRGQIPPNPSELLMH
ANFSAFLEQVSTQYDLVILDTPPLLAVTDAAIVGRQSGTSLIVTRFALNPVREIELTMRRFAQNGIELKGAIFNGVEKRA
SAKYGYADYGYYNYEYKSESV
>gnl|bykdb|A0A407T0V1 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=727 residues).
MSQTTNTEDTIDLKELFFSLISQWKLIALCILLSLICALLYLRATPDTYSVDALVQVEENKGASAALLGDLSSMVEQKQP
AQAEIEILKSRLVLGNVIQHLNLDLKISGTENSFTDRLLSPHHYQTQYQPKSVVFKDDEKAFDIRQFNVPSNFRDKNLEL
RFNDKQFSLTDKETEQVILTAKINQANILRTTDGLWNISIYTQDQLNDIYLIQKQSLPAAVDSMLVNYSVAEKGKLTGIL
GLNYQGTDKTHITQVLNAILVSYSQQNIERRSAETAQTLKFLDEQLPELKQQLDVAEREFNKFRQQYNTVDVTKESELFL
TQSITLETQKAQLEQQVAEAGAKYTSEHPVMQQMNAQLGAINKKIGELNATLKELPDLQRRYLQLYREVEVKQQLYTALL
NSYQQLRIAKAGEIGNVRIVDTAIEPVEPIKPKKLQVLILSLFLGGFLGTLLALLRNMMRSGIKDSAQIENELDLPVYAT
VPRSPVQESRINILKKKKNIPILAVKNSDDIAIESLRSMRTAIHFALSSARNNLITISGPAPEVGKSFISTNLATILAQS
DKRVLIIDADLRRGYLHKYFNLDTQPGLTELLNGQQSLETVIRHTEVPGLSVISRGKNPANPSELLSSNQFKNLLEQMSE
KFDHVIIDTPPVLAVTDGIIISQYTGVNLVIARYAKTQMKELELTLNRFEQAGVKVNGFILNDIQRSAGSGYGYNYAYAY
KANKELD
>gnl|bykdb|A0A407TZB0 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=744 residues).
MQSPNSLPIQEHRDDDDDIDLLALFGTLIDSKWIIVGITAFFCAVGVAYALLSTPIYQANALVQVEEKKGGMTALGGMGE
MSEMFGGTSPAVTEIELLKSRAILGKAVENLKLDILIEPNYFPFIGHFLSRRFEPASEHQVAAPLLGLDSYTWGGEKLDI
FQLEVPDAYLGKGLKLRSEGNGTFTLLNDDEVLLHGQTGEKLEQNGFKLQVSTLNANAGALFNVTKQRRLNTILQYQDDV
SASERGKESGIIALSLENEDPAKANKVLDEINRLYVLQNVQRNSAEAAQSLEFLRTQLPDVRKQLEKAEGQLNAYQSSAR
SVDITIETKAVLDQIVALETLISELKLKQAEMEHRFTREHPSYQALMTQMGQLDQQKRGLEKKVKNLPETQQELLRLTRD
MQVTTDIYTQLLNKTQELDIVRAGTVGNVRVIDSADANIEKPVKPKKMLIVLIATLLGGLIAVAYVLVRKAMNRGVEDPE
VIEQLGIPVYASIPLSKGQSQIEGTLKGSNRASTGSLLLAVNNPADLAVESLRSLRTSLHFATLEAKNNILMISGPSPAV
GKSFVSSNLAAIIAQTGQKVLLVDADMRKGYLNKMFRMDVNSGLSDLLAGKIDLNKATHSTEVDNLHVITRGQIPPNPSE
LLMHSNFTRFLEQVSSQYDLVIIDTPPILAVTDAALVGRQSGTNLIVTRFGVNAAKEIAVTKRRFEQNGIVVKGAIFNAV
ERKASAYGYGSYSYYQYEYASDKK
>gnl|bykdb|A0A407V607 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=699 residues).
MPLKSELHSDQGLVALGLRRWKTMAIVFTVVVATGAVVVQAMPRAYEASAKVLIMRTDQRLGGLNVMNDTLPELTNLTNP
LYTQVELLRIYPVFAEAVQRLDLRDEAGQPLDAQALAQRLKVGPVGKTDLIGVSYTGPDPEEARRVVQAVCEAYLQQGDR
HRREGVADGLKLVDDQLETARKRLVKAENNLLAFKRQSGSVALNEEISASVGEMSALNTQLRERQIELARVSARAANLRA
QLGMSSAEAMQAAAIGENPRIQALQRQLTEAEASPLKSQGLGARHPELVALNNRIASLKRAIAAEVRAQVGHNAPAGTLD
EIRMGLLRELAAAEAEIAAGRSSLSAAQGRRKALTASMTRFPGQEVTLTRLSREVTVASEIYQQLLQKREEARLNMAIAP
TSARVIEPAVLPTRPVAPLKGPTGPVLVLMGLAAAFAAGALKDLLDRTASPHDLAGYVQALQIYAAVPTLAWHERRAGEL
LVGTSQAPHYVEAIKTLALTLEEHHGAATGSVIGLSSTTAREGKSVTLANLALALSEAGHRVLLVDSDFRRPRVGALFGF
EGERGLSDVLMEQATPAEVVRRAGSIDVVTAGKTRLAASGAKIRHRLAPALEAWKLEYDFVLLDMPPLLVLSEVAQAARH
TDGVLMLANLQQVPPDALLAGVQQLQSLRAPVIGLVAISQMVAQSKGGYYLMAGEGLIS
>gnl|bykdb|A0A407WVH8 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=729 residues).
MLDNRWLIASVTAAVLVLGAGYALFGTRVYEANVLIQLEDAERSPGGAGDAAVNGVGVKTPTSGEAEILKSRMVLGQAIE
NTKLFIKARPHYIPVVGAFIARHSKTLSRPGFLGMRGYVSGTERIAVAQMDVPPALEGKKFLLTAGKDGTYTLTHPDLDT
PLHGRVGEPQDSSVPGGTVHLLVASIDARPGGAFELTRHSTQLTMLELQRELRVIEKGKQSSVIDVSWQTDDREHLANLL
NEVARLYMRQNIDQKTAQAERTLNFLGTELPKFKQQLEQSEEAYNQYRNQNGTISLDDEARNALSQNVDLQAKLLDARQK
RLDLASRFTSQHPMLITLDAQIASLRKELGGVDNRIRRMPMLQQNSLRMQRDIKVNTELYSSLLNSSLQMRLAREGRIGN
VRVLDQALSPEKPVRPKAVIVMALALVVGLFLGAVTSVLRKVLKNTVATPDEIEMRTGLNVYSTIALSTRQGTLDRAIRQ
GKPGVKLLAASHPDDPALEGVRRLRTALGFLMAGAQNNRILLTSATPGAGKTFLSANFSAVLAASGRRVLLIDADMRRGK
LASQFGLKATTGLSELIAGTATLAQAVHAQVLPHLDVITTGKLPLDPATMLGSTAFTRLLETLSALYDAVVIDAPPILLA
TETVAMSPDVGTLMLVARAGDSELGDLVESAKRLAHVGAAFHGVVLNAQDARQRHNAYGYDYGPYGLPPNIYPPALGHTP
RAEPERATS
>gnl|bykdb|A0A407XAA6 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=753 residues).
MSLPIESFEPNVPARQQETPLSSHVDAIISNRWMIIAITLLAFLGALAYVMVTPSVYSADIIVQVEEEAPNGQARSLLGD
VSSMFDTKAETSGEMEVLRSRMVVGPAVDKFLLYIHAKPRYFPVIGEWLAQRYEALPYPSSLPRGGYAWGGETIAISHLD
VPNEWLGKPFIVTTQGEGRYTVTDKFTGATFSGAVGKPEQFRLPGGGVMDVHIDALTGRPGTQFTISRSSRLAAIENVQS
HMGIFERGRASGVIGVTLEGNDPALTTAVLNQIGQEYVQQNVNRKAAQAEKSLGFLEQQLPLLKSELDAAETKYNALRNK
RGTIDLSEEAKLILGQSVEAQTRVMDLRAKRQELITRFSPSHPSIVSIDRQIASLSNDVSRIGNNIKQLPDLEQDVVRLV
RDVRVNTELYTGLLNNAQQLRLIRAGKVGNVRILDAAVQPDRPVRPKAAIIIGVATVIGLIFGMLCAFVRNALFGGLSEP
DDVERYTGLPVLAAIPYSDMQDKLWRRSRRKNATVPALLAQSQGNSPPIESLRSFRNVLQASLRQSANNMVMFTGPVAGV
GKSFLSANFAFIQGGVGKRVLLIDADFRKGQLNRYFGVPKEDGLFEVLSGTIPLTRVRKHSVSEGVDFIATGAVTFDPSE
LLASPVFGATLRELSSQYDMVILDTAPVLSSPDAAVVGTHAAAVMVVVRSGMNTVGEIRETAKRLIQAGAPVDGVLFNGL
KLMPERFGFRSKYGNYRYSRAAYYGDFKQNGPK
>gnl|bykdb|A0A408G2L4 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=717 residues).
MIDQKWLIGALTGAFMVTGVAYAVLATPVYLANALVQVEPKKNDMLGFSDLNSMLGGQSPSVTEIGIIKSRAVIGKTVDD
LRLDIDVTPNTFPMIGGFLARRYRGETETSVAAPRFGLNSYAWGGERLEFARLNLPKELLGKKLTLIAGEQKHFQLLDDN
DNLLVEGVAGEAFAQDGVEGQITQLLANPGTRFEVVRNPRIVTIQGYQDALDISEQGKESGIIKLALASSDAAEAVKILN
KIAALYVDQNVRRTSAEAAQSLAFLQSQLPQVKRDLAKASDALNAYQTHGKTVNISLETQSVLGQSVALETRISELKMQQ
AEMDRKFTKQHPAYRALMSQIGELTQQQKSLEGKVGDLPATQQELLNLTRDVEVASQIYTQLLNKSQELDIVRAGAVGNV
RLVDAADVDLTSPVKPKKALIVLIATFLGAFVGVALVLLRKSLSRGLEGPEAIEQLGLPVYASIPYSALQDEEDNKKGRA
RDGVDKPAYLLALRNPTDLSIESIRSLRTCLHFAGLDSTNNRIMISGPSPQVGKTFVSSNLAAVMALSGQRVVLIDADMR
KGHLHKTLNTPITNGLSDLLVKRCSIDQAIHKVEIDNLHFISRGQVPPNPSELLMHANFRELLAELSERYDLVIIDTPPL
LAVTDAAIVGREAGISLIVTRFGVNPAKEIELTIRRFAQNGIELKGAVFNGVEKRAASYYGNGGYGYYNYEYASDKS
>gnl|bykdb|A0A408J920 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=758 residues).
MLQRHDPLTMADYDKSGLTAEFIDIDAALAIIRRQWRIVLAAIAVAGAIGLAFAATAVPIYSATATLLIDRNNSQIVEQL
STIGGVIEDEASILSQVEVLQSETIGLAVVDSLKLTENQEFRATRASLLSSIFGTIRSLVNVSQWFSPAKKESVIDDGTL
KRSLSDQLLNGLSVKRIGRTYALELTYNSTSPVLAAQIVNAVASAYLLDKLNSKYEATRRASDWLSDRIAELRQRALDTD
LAVQKFRAEHNLISTGNNSLLSDQQLAESNSALILAQSETAKARARVQRIEHILATDDVDGVVTDILDSSVANDLRKKYL
ESSKIEAEITRRLGSNHIQAVRLRNEMQEYRRLMFQEISRIAQSYKSDLEVSEAKEKSLAESVAKATDISNSASETQVQL
RELQREAETYKNMYQTFLQRYQEAMQQQSFPVTEARVISKAMPPRIPSKPNKPIILALFMIMGAAAGGGIAMFREFRDRF
FRTGEQVRDVLGLEFLGNTPLIPNKPATEAPESGHPGLTLPTSVARYAVDHPLSSFAETLRSTRLAIDLGISAKSGARIV
GVVSALPSEGKSTISINLAQLLAGQGARVLLLDADIRNPGATRAMARHASEGLLEVLLEGRSVQDVLLRDEKTRLAFLPT
VVKQRVPHSSELLTSAQMHKLLAEASNAFDYIIVDLPPLGPVVDARAMAGRIDGFIFVTEWGKTARRAVRNTVENEVHIR
KKCLGVILNKVDTEKLKLYRAYGSSEYYHSRYTRYYHD
>gnl|bykdb|A0A408NUV2 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=625 residues).
MVLGRTVQELNLDTVVTPDFFPLVGRGLSRLMGHPYPKMAVSRFEVTPELLGTPLTLTVDDNTHFTLEVEGRVLEGQVGK
LLEKEDVTLLLSDVAADEGQVFTLVKQPALDVIAELQRDLQVSEKGKNTGIISLALEGEDKGRIRAVLDNISQNYLQQNV
VRKTEEAQKSLDFLQVHLPQVKDELNRSEELLNVYRQQNESVDLSLEAKAALDTMVGLEKQLNELTFREAELQQLYTRQH
PAYIALMEKRQALMNTKNTINKSIKRLPKTQQEILRLTRDVQVGQEIFVQLLNKQQELNIMKAGTIGNVRIIDDAAVETR
AVKPKKPLIVVLATLLGGMLSVGLILVRAAFHRGVESPEQLEEMGLSVYATIPYSEEQAKIEQLQQKKRRQAMPLNEALL
AARNPADLAMESLRSLRTSLHFAMMEAKNNIVMISGPGPGLGKTFVSTNFAATLAMGGKKVLVIDADLRKGYMQKVMGQE
MGAGLSAYLAGQTEMMQVISKTGFDGLDFVCRGAVPPNPSELLMHPRFKALLDWASEHYDFVIVDSPPILAVTDAAIVGQ
HVGASLLVARFAKTAVKEVEVAIRRFEQNGVAIKGILLNAVEKKASSYYGNYGYYQYSYGDKTKA
>gnl|bykdb|A0A409MU65 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=727 residues).
MNQNTNTEDTIDLKELFFSLIAQWKLIALCIILSLVCALLYLRVTPDTYSVNALVQVEDSKGASAALLGDLSQMIEQKSP
AQAEIEILKSRLVLGSVIKDLHLNIEVSSTENTLTHRLLSDTEYKTEYTKKSVLFQDDLKSFEVREFEVPAFYLDKNLLL
NFDKQSLRLTDPKTKKVALTIPLNQANHVRGPHGLWKVAIFTKDQLDATYNITNLSLPAAVDAISSNYSVAERGKLTGVL
GLNYQGQDKEHITKVLNAILATYSAQNIERRSAESAQTLKFLDEQLPDLKKQLDDAERQFNKFRQQYNTVDVTKESELYL
TQSITLETKKAELEQKQAEMVAKYTAEHPAMREINGQLGAINKQIGELNTTLKQLPDVQRQYLQLYREVEVKTQLYTALL
NSYQQLRIAKAGEIGNVRIVDTAIEPVEPIKPKKLLVLILSIFVGGFIGALIALLRNMLRTGVKDSGQIENELDLPVYAT
VPRSPIQESRIKILKKKKSIPILAVKNSDDIAIESLRSIRTAIHFALASAKNNIIMIAGPSPEVGKSFISTNLATIFAQG
DKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQADLQKVLHKTQVANLDVITRGKSPTNPSEILSSTQFKDLLEQLQS
QYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSQMKELELTVNRFEQAGVKVNGFILNDIQRASAGYGYGYNYAYA
YKAQKED
>gnl|bykdb|A0A409NVE8 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=750 residues).
MDKTSQHPEPAKLPQRLPQGLASDIPDLLQMWHPIWRRKWSILALMLAIMLVTALATFAITPTYRATTTLLIEQKKSNVV
SIEQVYGSEWGGNEYLQTQFELLMSRALAERVVRKLELTTHPEFDPRQQAAPLIDIGSLLGSIKNIAKTITGTLPEDLNA
VPDQEALILAEVTEKFMRRISVEPIAKSQLVKVQVDMADPDLAARAANTIARGFIEAQLETAMEMSVTATTWMNSRIVEL
RTKLKESEDRLQTFREKENLVDIDGVASISAAELAATSDRMIDARRQRAEAQSQYRQVQSMRSGGWQKLATIPAVLGHPL
IQQFKADEARARAKVDELSSRYGARHPALEAARSDLKAASASLRGQVEQIVAGIERNYQLAVANEQSLRASVDSNKAQIQ
KISRKEFEIRELQREVEANRTLYDTFMTRLKEATATADLESANASVVDPAIVPLNPIKPMRGLIVGLAGILALLGSTGIT
LLLQILNNTFKSIEEVENKLNLPVLGILPLMKNRQRSQIAHLFSSDEDKSFSESIRTIRTALVLSGMSGPHRILVVTSSL
PGEGKSTVAANLAYAFGQMERVLLVDADLRRPTLAKNFKFPVGTPGLANLIAGTAKVDDCIKTIEGIDMLCAGAVPPNPL
ELLSSERFAKIVEHLKGLYDRVIIDSPPTQAVSDATILATHSEALIYVIKSEASPIPLVQKGVGQLLQSNAPVTGVVLNQ
VDVRKAQKHGYHYGGYYDYYGYTNNQPQKV
>gnl|bykdb|A0A409NWS0 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][compost metagenome] (length=592 residues).
MGRQNDMVKVTTFELPKGAGDQVFTLEVLGPKQYQLTSDAGFSARGEVGQMLTKNGVTMMVSDIKAAEGGKFTVSKFSML
GMINNLQGNLTVTENGKDTGVLSMTFTGEDKDKIRDILNSITRNYLEQNVERKSAEAAKSLAFLAKQLPEVRAHLDEAEN
KLNAYRQDKDSVDLPLEAKSVLDSMVNIDAQLNELTFKEAEISKLYTKRHPAYRTLLEKRQALEDEKSKLNNRVTAMPKT
QQEIVRLTRDVESGQQVYMQLLNKQQELKITEASTVGDVRIVDPAITQPGVLKPKKALIVLGSIILGLMLSIMGVLLRSL
FNRGIESPQVLEENGISVYASIPLSEWQKSRDSVKTVKGVKRYKQSQLLAVGNPTDLAIEAVRSLRTSLHFAMMQAKNNV
LMMTGVSPSIGKTFVCANLAAVVSQTNKRVLLIDCDMRKGYTHELLGTNNVNGLSEILLGKEEIEQCAKPTSITNFDLVP
RGQVPPNPSELLMSERFTQLIEWASKHYDLVLIDTPPILAVTDAAVVGRHAGTTLMVARYAVNTLKEVETSLSRFEQNGI
EVKGVILNSIFRRATGYQDYGYYEYEYKSDSK
>gnl|bykdb|A0A445V3X4 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][ciliate metagenome] (length=760 residues).
MHQPTPDNQPVDRAHDLMQHEYLPQPRQQAPHYDTVEPQWYERDDEDSIDLREYWRILVRRRWTVFSVLVLAFVGGLLVH
FLTTPIFRATLLLQIEPEISKLLKYENILATDDENNFYETQYRLLRSRTLARRVMEELNLTNSENFLPLSEQSFFGSIRE
SITNTITGDRRSRVGKNPISEEIIQRNLTIQPVRRSRLVRIHYDGPNPREAALIVNAVAENYIDTTLERRFGASSYAKAF
LDERIQQVRRDLEDSERRLVAYAREREIVSPDNKMATLAERLKEASGQFRAAETRRIEVEAKYNAMRAGSSSAHEEILNS
PIIQSLKTRKQELQAEYDKNLRILKPGYPKMGQLRQQIADIGREISDESQNILESVEKDLMAYTAQEAGFRARVAEIKEE
MLSLQDRSTDYRTLKREVETNHQLYERLLQRMKEIDVIAGVGSNNISVVDPAEIPARPYKPSLSRNLTLALAFGFLGGGL
LAFLFEKLDDTLKTGEELEKHLGLPLLGVILDVSREEALDGEEVALLMHRAPNSTLAEAYRSIRTGLLFSTPNGAPKILH
FTSSVPIEGKTTSSVSVATAFVQAGKVVLLVDADLRNPSLHKIFEISHDEHGLSSYLTGDLKPQEITYSSEIEQLFVIPA
GPSPPNPVELLSSSKMLSLLNVAIERFDYIIVDGPPVVGLADALVLSNLAHATVFVVASGVPRLSVVDGSIKRLRSAKAT
LIGGVLTKVDHDSSRYSYYGYSYSYSYGTKTVQALDKPSV
>gnl|bykdb|A0A445VBS2 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][ciliate metagenome] (length=760 residues).
MHQPTPDNQPVDRVPDLMQHEYFPQPRQQSPHYDTVEPQWYERDDEDTIDLREYWQILVRRRWTVFSVLVLAFVGGLLVH
FLTTPIFRATLLLQIEPEISKLLKYENILATDDESDFYETQYRLLRSRTLARRVMEELNLTNSENFLPLSEQSFFGSIRE
SITNTITGDRRSRVGKNPISEEIIQRNLTIQPVRRSRLVRIHYDGPNPREAALIVNAVAENYIDTTLERRFGASSYAKAF
LDERIQQVRRDLEDSERRLVAYAREREIVSPDNKMATLAERLKEASGQFRAAETRRIEVQAKYDAMRAGSSSAHEEILNN
PIIQSLKTRKQELQAEYDKNLRILKPGYPKMGQMRQQITDIEREISDESRNILESVEKDLMAYTAQEAGFRARVAEIKEE
MLSLQDRSTDYRTLKREVETNHQLYERLLQRMKEIDVIAGVGSNNISVVDPAEIPTHPYKPSLSRNLTLALVFGLLGGGV
LAFLFEKLDDTLKTGEELERHLGLPLLGVILDVRHEESLDGEEVALLMHRAPNSILAEAYRSIRTGLLFSTPNGAPKILH
FTSSVPIEGKTTSSVSVATAFVQAGKVVLLVDADLRNPSLHKIFEIDHGEHGLSSYLTGDLKPQEITYSTEIAQLFVIPA
GPSPPNPVELLSSSKMLSLLDVAIERFDYIIVDGPPVVGLADALVLSNLAHATVFVVASGIPRLSVVDGSIKRLRSAKAT
LIGGILTKVDQDSSRYSYYGYSYSYSYGTKTVQALDKPSV
>gnl|bykdb|J9FGR8 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][gut metagenome] (length=786 residues).
MTDQKKLAQNAANEFAWVTDLWGMFAPRWIWFLASVLLFMSGAVLYLMSTPAVYTRTASILIKDDSKSGSSSNAMSEFSD
LGIFKNNTNIQNELLTLKSPELIAEVVSRLQLNETYTVRQQLKRVDLYKHTPCLLIGAAQTDASFSCTLQPVSAEQCQLT
EWSVNGDETDETYTVAFGDSVATSFGTFILTKTPAFTEQWVGRSIRFAKTNPQACADVYAESLVAALSNKEASVITLTIN
NPSIAKAEDFLNTLIEVYNEKWVQDRNQIAISTSKFISDRLGVIERELGHVDENISNYKSEHLMPDVQAASNLYMSQTVE
YKKQLQELNNQLSTAQYIRRELTGKQLSQLLPANSGIASTTLAGQIEEYNKLVLDRNRLVANSSEKNPLVVDMTETLRAL
KNTLIQTVDNLIRSLNTEMASIRRQSEAATSQLASNPGQAKYLLSVERQQKVKEELYLYLLQKREENELSQAFTAYNTRV
INAPRGSMAPTAPQRSKILLIAFVLGLALPAAVIYLMENMDNRVRGRKDLELLTVPLVGEIPFTGDKKKKKDASQHTILV
KEGSRDMLNEAFRVMRSNLDFMSGDTTQSQVFITTSFNPGSGKSFLTINMGMSFVLKGKKVMLIDGDMRHGSLSAYAGSP
KKGLSNYLSGQAATWQEVTVDHPHNPNLKLIPVGTVPPNPTELLENGKLARLVDALKAEFDYIFIDCPPVDIIADTQIIA
QVADRTLFVVRAGLLDRSMLPVLQGMYDDKRFQGMAMILNGTESSRGRYSYRYGYYYGHGNYYSQQ
>gnl|bykdb|S0DG33 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][termite gut metagenome] (length=778 residues).
MDDYPMNSLYPAASTERGQLSASGMLTLMRDHIWEIVVTTVVVLTLAVAYLLIATPIYSADVLIRVDPPEPNALGLALQD
QEALPPPAPAPVTEMAVMKSRSVLEPVIDKFRFDVSVTPHKVPILGDIAEKFATPGEPSAPWLGLKSFAWGGERVQIGTL
EVPIELEEEKLTLIALQDGAYELRGPADQLLVKGVVGTTAQDNGVSILVKELDARPGTKFEVIRWNALDAVKRFGDLVKV
GDKVKDSGLLQVEYADANPDKATAVANALGEQYLASAIASRQLNDTNTLAFINGELPRLLADLRKSEDALKHFRSTSQSM
QPTSEAQAYLQGGLDLDKQIAGLQLQRTQLLERYRPDSRWVQSVDTQLAQLKDAKAQFNGHFNGMPSSERESVDLLRAQK
VAETIYLGMVQKAEQLQVRRASTTGGAHIVDAAIRPHRPVKPRPELVLGGGLILGLISGVVLVFMRRYVMTGVTDPRYVE
RRMSVPVFGEILFSQQQVLLDRSFAARKSLPGLGGRSNLPFQRSAPDIDMRTGASAMSAAASYSGDNSRILAARFPHDTS
VEALRAVRTAVTRDLAHARNNILMVIGPTPSAGKSFVAANLAILHAEIGSRVVLIDADMRRGHLASLFDESNRGGLSEVL
SERMALRNALRTTGVDGLTFLSCGLRPENPAALLMKPRFKDVLERLAGQFDLVIIDTPPFLAVTDASIIANEAGASLLVL
RSGMQSEEEIADTVKKMERAEGRISGAVFNGIPLRRSTRNYGYETNYASDVGDLEATR
>gnl|bykdb|T0ZG59 [unclassified sequences] Bacterial tyrosine kinase [metagenomes][mine drainage metagenome] (length=676 residues).
IALILTLLATPIFRADTTLQINRDTVNVVQVQGFQPVESLNDQTFYQTQYDLLKSHSLARRVVVAMDLQHDAAFQGLLRP
SPLARLLGFLHGASARKPSQTDQLRADADALLHMVSVQPVLNSKLVDVSVDTPDPRLSAQIANVYADQFIRSNLDRRMAA
SGYAKQYLQDRLQQLKLRLEDSDKELVAFAQKHQIVNISDRQSLVGQQLEQLNVALAQAEQDRYKAEAKWRQLQGAPADQ
IAQVLGDPVIEKLQQAYAEDQAKYQDQLRIYKPAFPAMLQLHAKLDEIHRQIAARTALVSGAAQSAYGAAKARETLLRQR
VADLRQQVLNLEQRSIRYNILKREVDTNRQLYDAILQRYKEIGVAGGVGINNISVVDRAEPPMVRYRPRLKLNLTIGLLL
GLFAGIAAALVLDHLDDTVHIATDAEQKLGLAVLGIIPLARAGTPEQAMQDPRSALAEAYRSARTALQFATADGVPRSLL
ITSTRPGEGKSTTALALAQSFAQMGRRVLLVDADMRNPAQHNLGTVDNSRGLSNVLAGALTWREAVVGGENGPALLACGP
LPPNPAELLAGPRLATLLAEAQAEYDLVILDSPPVLGLADAPVLGHCAAGTLLVIEAGGARIDHIRDALKRLRAARARVV
GAAITKLDARHGAYGYGYNSYDYGDAYGGKTSRRNA
© 1998-2019