BYKdb

Dataset for cluster orphancd of phylum nitrospinae-tectomicrobia-group

[Download (right click)]

1 sequence(s)

>gnl|bykdb|A0A2S4DFJ5 [Bacteria] Bacterial tyrosine kinase [Nitrospinae/Tectomicrobia group][Candidatus Entotheonella serta] (length=315 residues).
IAAPLSGLVRVIILIILANIRAGFICLRVLNLSVVIIPTHYPVQPPEEVEQLLQLPMLGVVGHFHMHSTGKTAPAGLLEN
RLISVKSPHSQPAEAFKTLRANLLMSRVTPSHQVLMVTSPLPRDGKTTVAANLAMVMSQLGRRVLLIDADLRHPKLHHIF
DVDTALGLSSILLNDSYERILVPRVDDTSLHLIPAGACPENPSELLSSERVQRFIQAARQRFDVIILDTPPVLAVSDALV
ASEWVDGLIVVVRAGTTPKAHAKRMLAQLGDHDGQRAHSKLLGVVLNGLKPRDGGAYYGHYGSYYRSGRELDHAA
© 1998-2019