BYKdb

Dataset for cluster tadcd of phylum nitrospinae-tectomicrobia-group

[Download (right click)]

1 sequence(s)

>gnl|bykdb|W4LNG9 [Bacteria] Bacterial tyrosine kinase [Nitrospinae/Tectomicrobia group][Candidatus Entotheonella gemina] (length=745 residues).
MCQRPWLIVTLVLVSLVLGGLKVAKTRPIYRATAKILIEQGKSKVNPFEDVITPRKTVADYQTQFEILQSRSLARRVVAH
LGLRSHPEFALKKPAQPRMAMQAFQSWPVMQSIRSWMDSLLNAFSRPPVPAANGEAPASQLGAKSSSSDAALVSAFLGRL
QVKPVPRANLVNVSFQAYDPALAANAANSLARLYIDFSMETRFATLQDALDWLERQVGGMRQQVEVSEKALQQYKDLHDV
HLIDDRLPSLMREISNLNTSLTQSKTERIELETLYNELQDALNKGKGVEWMPSVVENPLVQNLKARYVDLQRSFVHLSQK
YGDNHLRTSQLKAQLNDLEAKIDQEVKRIVQAFKIKYQVILAREQALRSEIGNLKREVRDLNDKSVKYGVLKREANSNQR
LSDLLLNRLKEASVSADLTNGNNIRVIDPADVPSRPINVNPARTIGIAGLLGLLGGLGLVALMGYLDNTLKTPEEAEEFL
DLPVLGMIEQYRQKRGESHEGLITLAPSQAKVTEAFKTLRANLLLSYTDPPRKVFLITSPHAHDGKTTIATNLAVVIAQT
ERRVLLVDADLRNPSVHKMLNMENHGGLRERLLTETYDLTDGAPDHGLSLDGLSVITAGEEVPNPSELLESKRMERFLAY
ARQHYDTVIIDSPPVLAVSDALVLSPLVDGIVVVLRAGMTPYNHAQQAISSFLTLYADSMSPEDPHRVQSLPAASLGLVM
NCIDPREGGTYAAYHSYASTASNES
© 1998-2019