BYKdb

Dataset for cluster orphancd of phylum nitrospirae

[Download (right click)] [Alignment] [Repertoires]

18 sequence(s)

>gnl|bykdb|A0A0F2J1D3 [Bacteria] Bacterial tyrosine kinase [Nitrospirae][Candidatus Magnetoovum chiemensis] (length=376 residues).
MELAKRIVIDAITIEVYKEKTKILKNYLSKYKEELIKLPAISEDNAKVNLELSVNKDIYQKLLEYILQIEIAESMTMSDR
ILVEPAELPEEQKYPWNKLNYILGFILAVFWAFTVALFLEYIDDTIKDPDELKQTSKQPLLGSIPKTKVFKDIKNISNLP
PTSPFVEAYRTIRNSLLFASIDKPVKTFLVTSSIEKEGKSSIASNLAVTFSAEDKNVLLLDLDLRRPSAHTFFNKTSAKG
ITNVLADTMTLDEAIEKTDIKGLDLLLSGPIPPDPSRLIESEKIKNIIEALKQKYSLIIIDTPPVVSVNDAVVIGKLVDG
AVYVVEAGRASGSMVNHFVDAASKANINIFGLILNKFRPHASNYYHYYQHYRYYKK
>gnl|bykdb|A0A0K2GDM9 [Bacteria] Bacterial tyrosine kinase [Nitrospirae][Nitrospira moscoviensis] (length=269 residues).
MKDVNPALRAVPPPESGSSSAYQRGDSRGDAPVLEKMLGRAKPDEHLVSLLTPATFEAEQYRTLGLMLEQRRQTGLLQVV
AMTSPTMGDGKTLTAINLAGAVSQSPSARVLLMDVDFRKPSIAAQLGLRDNIVGLRDAALNAGLRLKDVVRRHPAWNLSI
ATAGRAQGLPHEIIKSARFAELLNEARRDYEWIFLDTPPLMLAPDCLILGRNVDGFLMVVYANKTSRQEVAEALNSLGPS
KLLGLVYNGDDRLLSSYNYGAYYMTPESG
>gnl|bykdb|A0A0S8DM58 [Bacteria] Bacterial tyrosine kinase [Nitrospirae][Nitrospira bacterium SG8_35_1] (length=262 residues).
MSKIEEALEKANKLRASNVRKKTQSLNIFERVEPREVENDYLVSLNEPNSPVAEEFRKLKSMLLRITKKDFLNTVMITSS
ISGEGKTITAINLAVTIAQEIDHSILLIDADLRRPMIHNYLGMNPKYGLSDYLLKDIDISEILVKTGIGKMVLLPAGKTV
PNPQELLSSVKMEYLIKELKQRYMDRYIIIDTPPILSFAEAISIGHCVDGVIYVVKEGQTQRKAVQNGLHLLKDINVFGV
IFNAVRGMNSNGYHKGTDYYAY
>gnl|bykdb|A0A1G1F9B9 [Bacteria] Bacterial tyrosine kinase [Nitrospirae][Nitrospirae bacterium GWC2_42_7] (length=220 residues).
ISEAYSSIRTLLLFSTAGKPPKVMMITSPLREEGKTTTAINTAISLTKSDARVIIVDADMRRPRLHKVFKVENISGLSSF
LSGNTEFSEELIKHTDVPWLDVLTSGPLPPNPAELLSSSRFRDLIDGLHPLYNFILFDTPPMLGLADAAITSTHTDGVIL
VVRSGQTPKEAAQQARKILDSVNAKVLGVVLNAINESNFKYGYYSYYQYYYQNYGSSEEK
>gnl|bykdb|A0A1G1GRK8 [Bacteria] Bacterial tyrosine kinase [Nitrospirae][Nitrospirae bacterium GWC2_57_9] (length=270 residues).
MSRTENALEKASRIRRSPQPVPAGRNGEPAATGAQGARIEHPHLVTSRSTFSPVAEEYKKLKARVMRMTKQEPFRNVLLV
TSSVGGEGKSVTAANLALSLARDYDHSVVLIDADTRKPSLHTLLNVKPGIGLADCVADDIDIGSALVKVGNGNLQFVPAG
KRHENPVELFSSQRMRTVILEMKSRYPDRYIIIDTPPVLLFAETKMISALADGIIFVVREGLAPLQHIIEALDLLKEEQL
LGIVYNDAGPEGVNGTYPYHSYYRHYHSRT
>gnl|bykdb|A0A1G1GZ72 [Bacteria] Bacterial tyrosine kinase [Nitrospirae][Nitrospirae bacterium RBG_19FT_COMBO_42_15] (length=237 residues).
MIKGFIEKIMEMKDNLRRDNLLPHEKTIRSGNIQTVITEQYRLLRSRLSSLNGSHGNKVIAVTSTQKGEGKSITSVNLAI
VMAEDTKKKVLLIDGDMRKPSIHAFFNCKSEYGLVDLLTNKIDIESILVPSGVNNLTILPAGGPVESPSDIIANPRFKEG
IERLKKRFDYIIMDSPPIIPFADMNILGDIVDGILLVVKAETTPKERVVDALKSLNKENIIGVVLNDSKKRLTKIYY
>gnl|bykdb|A0A1G1I4J7 [Bacteria] Bacterial tyrosine kinase [Nitrospirae][Nitrospirae bacterium RBG_16_64_22] (length=271 residues).
MSKIEEALAKIQSKPRPGGAREPLPRVDLPAAMNVDRDAFIERRIVTAVFESGPAVEEYKKLRTRVLAWLRAAEGNVVML
ASAGGKEGKSLTAVNLAVSVARELHQTALLIDADLRRPHLHQLLDVKGQPGLSDFLMGEGDLSGLFHSTGIPKLTLVPAG
TPTARSPELLASQRMSEFLEEVRRRYKDRIVILDAPPVLPATDAVILANHVDGIVFVVRAGGSAREDVQQAVRQFDPRKV
IGVALNGAVDTGHYSAYGYHYVTSPVMAGVG
>gnl|bykdb|A0A1G3XWL5 [Bacteria] Bacterial tyrosine kinase [Nitrospirae][Thermodesulfovibrio sp. RBG_19FT_COMBO_42_12] (length=665 residues).
MKIEREKPNFVISEGTVGFDLSEENYFQTQCKVLKSRNLAKRIIRSLGLDTNPEFIQDMENKKSSSNENIILAINRPSEK
EIEPKLIDVFIGSINVNPVQRSSLVNVSFASDNPELSARVANTIGESFIELNIESRFEATYKAREWLQGQINIMKAKLEQ
AEEALNKYASAHGIIFLDENEKGVENENIITKRLSELSTHHTEASADRMNKEALYNTVRSDDSDSSPVVMGNSLIMELKK
NLASLESEYNQKLKTYKPAYPKMVKLKEQIDQIKKKMDSEAKKIITGVKKDYDAALKREKYLKSEFEVQKKEAINLKDYF
VQYQILKREVDTNRELYNGLLQKLKETGVSETLKASNIQVIDRAEIPESPYKPNKRLNIILSIIVGLFGGIGLAFFVEYL
DNTIKTPEDLEKRVSLPTLGFIPFHGDYEGDLPVEYITHADSKSPVSEAYCTLRTFLLLSTGGRPPRIIAITSPAREEGK
TTTAINTAISFARSGAKVLIIDADMRRPKLHRLFDVDNTSGLSTYLSGIEELTEDLMKETNIPNLHVITSGPIPPNPAEL
LNSLRLKELINSLYLYNFIIFDTPPVIGLPDSLILSSYTDGVMLIAKSGKTTKETTLETRRMLEAVGAKILGIVLNAVDQ
SAMRYSHYYNYYRSYYRSYGDENKK
>gnl|bykdb|A0A2H0YFB4 [Bacteria] Bacterial tyrosine kinase [Nitrospirae][Nitrospirae bacterium CG08_land_8_20_14_0_20_52_24] (length=268 residues).
MRSIEKGLEKAIRERESRSSPDLFKLQKEWNDKSLDFSKLSAYLVTILDSKSLAAEQFKRLRTQVMKKMRSRMENTLMVT
SATRGEGKTTTALNLAVSVAQGMNETVLMMDTDFRKPGVHTYLGIEAKKGLVDFLRGEAEIPELLVKTEIPKLILLPSGQ
PPENPSELLSSERMSQLIREIKSRYEDRFIILDTSPINVFTDASILIPLVEGVLMVVQDGVTPREYVLRAISQIEREKLL
GICLNMISAPESLQDSYYYYRDYDKEGK
>gnl|bykdb|A0A2H0YJQ4 [Bacteria] Bacterial tyrosine kinase [Nitrospirae][Nitrospirae bacterium CG08_land_8_20_14_0_20_52_24] (length=267 residues).
MSKIEEALEKAKQARSGVKENKAVPEAPEETAPRYTHTVFKEVNPDMMEENRIVTLAGKSSHITEQYRMLRTQILQRTEG
NGDNCLMVTSAADGEGKTTTAINLAVSIAQEVQKNVLLVDADLRRPSIHKMLGLKPEKGLVHYLMDQVPLEDLLIRTGVE
KLTFLPAGGTLPNSTEIFNSSRMKNFIREVKDRYKDRYVIFDTTPILSTADPVVLSQSMDGIIFVVQADRTQRGDLAEAL
ALLQGRNILGIVMNNHSDTGETYYYEA
>gnl|bykdb|A0A2M7FB38 [Bacteria] Bacterial tyrosine kinase [Nitrospirae][Nitrospirae bacterium CG17_big_fil_post_rev_8_21_14_2_50_50_9] (length=267 residues).
MSKIEEALEKAKQARSGVKENKAVPEAPEETAPRYTHTVFKEVNPDMMEENRIVTLAGKSSHITEQYRMLRTQILQRTEG
NGDNCLMVTSATDGEGKTTTAINLAVSIAQEVQKNVLLVDADLRRPSIHKMLGLKPEKGLVHYLMDQVPLEDLLIRTGVE
KLTFLPAGGTLPNSTEIFNSSRMKNFIREVKDRYKDRYVIFDTTPILSTADPVVLSQSMDGIIFVVQADRTQRGDLAEAL
ALLQGRNILGIVMNNHSDTGETYYYEA
>gnl|bykdb|A0A2M7FBY9 [Bacteria] Bacterial tyrosine kinase [Nitrospirae][Nitrospirae bacterium CG17_big_fil_post_rev_8_21_14_2_50_50_9] (length=268 residues).
MRSIEKGLEKAIRERESRSSPDLFKLQKEWNDKSLDFSKLSAYLVTILDSKSLAAEQFKRLRTQVMKKMRSRMENTLMVT
SATRGEGKTTTALNLAVSVAQGMNETVLMMDTDFRKPGVHTYLGIEAKKGLVDFLRGEAEIPELLVKTEIPKLILLPSGQ
PPENPSELLSSERMSQLIREIKSRYEDRFIILDTSPINVFTDASILIPLVEGVLMVVQDGVTPREYVLRAISQIEREKLL
GICLNMISAPESLQDSYYYYRDYDKEGK
>gnl|bykdb|A0A2M8DK40 [Bacteria] Bacterial tyrosine kinase [Nitrospirae][Nitrospirae bacterium CG_4_9_14_0_8_um_filter_70_14] (length=295 residues).
MSKIEEALEKATRERQGGGHEAGGVPQRSSVREAHTAVVAEVAVVNPDPLHLAENRVVVASGPSLGASDAYRQLRATLML
AADHQRLAFVVTSPLQGDGKSITTLNLGYAIAQELQLDAVVVDTDLRRPVLAKFLGIEGQRGVSDYLNDPSVTLDDVVVR
LAGGPLWVSAGTVRLHNTSELLGSRRMEQFCGELRHRFPTAILLFDSPPILPAPDAMTLVQWLDGGIIVVSAGKTSRRAL
SDAVRQFGANRIAGVVVNRSDRSSYGYGYGYRYYYGGYGYGGEGAPTAETGEKDG
>gnl|bykdb|A0A2U3QDU5 [Bacteria] Bacterial tyrosine kinase [Nitrospirae][Candidatus Sulfobium mesophilum] (length=279 residues).
MSRIERALEKANMVRDREEPVLPEQSVGQADITDVFVTDNTELPKNPYLVTLNEPDSPIAEEYKKLKSMVVKMTKQGKFQ
NTLMVTSTVAEEGKSITAMNLAITLACEYDHTVLLVDADLRRPSLSHLLGIETSPGLSDCLLNGLDIKDALVKTGIGKMV
FLPSGSHVSDPVELLLSRRMQELLSDIKHRYADRYVIIDTPPVLPFAEVHSLASGVDGLIYVVREGLAPLNGIKEALGML
KGCNVLGFVFNGVELDMMDDYHRYYNYRRYYSRGGNGKK
>gnl|bykdb|A0A3A4WKT5 [Bacteria] Bacterial tyrosine kinase [Nitrospirae][Nitrospiraceae bacterium] (length=268 residues).
MSKIEEALKKANILRESYGNTGNVKAHIPSDGEIIKTDNQYLVTLTQPGSPVAEEYRRLKSMLIRETKANFLNTVMITSA
VEAEGKSLTAVNLALTLSQEIDHTILLVDADLRKPTLHEYLGISCKYGLSDYLTRDIDLSEILVKTGIGNLLIIPAGHTV
ENPVELLSSVRMKTLIHELKHRYMDRYVIIDTPPILPFADAISLGSLVDGVLFIVKEGRIQKKSLENAVHLIKDLKILGV
VFNYAHAENLEGHYSRYYYYNYKKKEKK
>gnl|bykdb|A0A3C1G280 [Bacteria] Bacterial tyrosine kinase [Nitrospirae][Nitrospiraceae bacterium] (length=292 residues).
MSRIEQALEKAIKMRESMAGGDTGDMLTAMPHKPAQTEFEAGEVRVDLKGIDRHIVSLTDPYSQGAEEYRKLRVRLLRAT
QKNFLNTIMVTSSGVGEGKSITAINLAVSIANEIDHTVLLVDGDLRRPSLHRYLGIEPSLGLSDYLMGKTALSNALVRTG
VGKLVLLPAGTPPQNPSELLSSERMKETVRELKNRYKDRYVIFDSSPVLATADTLSLSNYMDGIIFVVQASETSPRDAQR
ALSLIKGRPVLGAVFNNVPPYLAKSHQRYSYQYAGKAKPEKSNGGSGEHDEP
>gnl|bykdb|A0A419FNZ3 [Bacteria] Bacterial tyrosine kinase [Nitrospirae][Nitrospiraceae bacterium] (length=264 residues).
MSKIEEALEKANKLRGPSGDVKSRLMDISRRPEHQVENEYLVTITRPDSPVAEEYRRLKSILIRETKADFLNTIMVTSSV
DGEGKSLTAVNLAITLAQEIDHTILLIDADLRKPMIHEYLGISHKYGLADYLSGDIDFSEIVVKAGIGNLMFIPAGHVAV
NPVELLASEKMNAFIKEIKHRYVDRYVIIDTPPILPFADAIAVGSVVDGVVFVIKEGRTQKKSIENAMNLMRNLRVLGIV
FNHASEENLDGHYYNTYYYNRTKK
>gnl|bykdb|A0A419GMT6 [Bacteria] Bacterial tyrosine kinase [Nitrospirae][Nitrospiraceae bacterium] (length=460 residues).
ADRISKEAIYKEVRKSDVDYGVVLQDPLIRSLTDRYVNLESEYFNLLQVHKPEYPKMIRLREQMEKLKETIGTQEQKIIN
TLSSDYQLALKKEKFLIAAIEKLRNEVSNLQDKIVQIQILKREVDTNSELYNALLQRLKEVGVSAALTESNVQVLDRAQV
PRSPFKPKKGFNAALSLILGLFGGVFLAFFVEYFDQTIRTPQDVEKWSRLPVIGMVPLIKDNLRESSSSVSDNTQVLTES
FRSIGTWIKFANSSVKPRQILVTSPLEGEGKTLVSINTAMSLLNVVGKGVIIDADFRRPCVHTSLDLDNSTGLSSFLSGT
SEFDQLIKKSSVTGLDVITSGPMPHNPSEVLNSDRMRELMDALSAMYDFIVIDSAPLLGLSDSLILSASVDSVMLVVKSG
QTPKDALIQSNKVLLKVATKILGVVLNGTDIKKKYGYSYCHTSYGNDKQVKKIPFIIKAS
© 1998-2019