BYKdb

Dataset for cluster tadcd of phylum nitrospirae

[Download (right click)] [Alignment] [Repertoires]

18 sequence(s)

>gnl|bykdb|A0A0K2GIJ9 [Bacteria] Bacterial tyrosine kinase [Nitrospirae][Nitrospira moscoviensis] (length=737 residues).
MERRNGLPADRTAPGAADEPEHPLREYASACRQHARLIVLIGCGFAAAAGMWSVLQTPVYQSRATVVIESQAPGGLEKDK
SYYHLDNSPEYFQTHFELLKSHQVIRRAVDQLKLSNRPEYQPQPSLLDKVLPKWVQAWWQPKKKEGPLAEEAEQERLLKA
FLNNVEIMPIRGARLAHVTVSSVDPAFAALAANTLVSVYVERNQELSSIAREQAARWFTTHLEGLREKVQAAQEALYLYR
AKHGLLTGEERKSLAGQTMAELNSQLVKTEMAKAAAYSRLQQVESALNTQGQPGSGGGWPELDSLTQVLNSQLIQMLRAQ
EIALSSQVADLSEKYGPLHPDRAQKHAELQNLRQRIKQEVQKIYDSLKHEYNMTVAQERAVQAAIARYGNDKIRLEKNEI
EHGMLEREAESSLHVYNLFLKATKESDLSAGMQTNNVYLADPATPSAVPAKPKTKLNIVLALMTGLMSGVGLAIVLEARN
KKLQDPGDVERYLPEVSLLGVVPLLPKASTPEKALVHPDAMSPAAESIRIIRTGLLLSRPDTLPSRVLITSPGDNEGKTT
LAVNLALALARLERRRVVLVDVDFRKPNPHRIYEVGLHKTSAPGLAQLLAGQADIADVVHDSFVPNLSIVPSGDRPGNPT
ELLHSKYLTQLLEWALRQDCHMILDCPPTLPFADTAVLASKVDGVLMVVCAGKTTREACRLAIQRMAFAGGKMLGVVMQK
ARVEDSPYYTAYYQEQA
>gnl|bykdb|A0A0S4L511 [Bacteria] Bacterial tyrosine kinase [Nitrospirae][Candidatus Nitrospira nitrosa] (length=748 residues).
MTRDDDSISPQSAESNGRETVLAEYAGACRRRVWLIVVIVVGCAAAAAVWSFMQIPRYQAKATVVVEQVGRSGLEYDRDY
RQGDLSPEYFQTQFELMKSHYIFQRTAQLLHLSEQPEYKPRPSILSSTMGDILPAAVAGVVGFKGDVDAQVLGDEDERLL
KQFAEAIEIVPIRGARLAHVMATSNDPEFAARIANTLASTYIERTQELNALSKEKAAAWYIAHLDELRKKAEDSQQALYQ
FRLKHGLMGGREQQTARAHTNTELDSELVRAEMKQAEAKSRLEQIESILRSRTGHNGAIETDWSSLDASTEVLSSTLMQT
LRAQDIRVSGQVAELEDTYGPLHPKLIHAKAEMQDLHERIEQEVQKIFDSVKQEYDSARGRVRVIKEAASRHRQEKIKLE
QYEVDYGILEREAESTQHLYDIFLKQTKEADLSAGLRSANVYLADPAVPNAIPVKPKKQLNIMLGLLVGLMTGVGLALFL
EARDRTLRGPDDLGRYLPKVSLLGVMPLLPKTKIGEGVSLLTQQSSGVAAEHVRIIRTSVLLSRPDELPSCVLITSPGEG
EGKTTLSVNLAVALAQLENTKVLLIDADLRNPSHKYIHGVQREGIDTNGLANFLAGRASLREIIYRTDLANLSVIPRGDR
PPNPSELLHSKQLRELLNRCREERYHVILDAPPVLPVTDPVILASQVDGVLLVASAGQTTREACRAAIDQLTSAGGRILG
IVLQKVRVSTNLYPSYVGKKFEENGIPL
>gnl|bykdb|A0A0S8DH48 [Bacteria] Bacterial tyrosine kinase [Nitrospirae][Nitrospira bacterium SG8_35_1] (length=780 residues).
MDVFRYDTQEIQEEPQIDVRHYLRVVHKRRWTIIATFVIVLLTVAINVFTEEPLYQANARMIIEKSNPNIVSIQEVMAID
TWDPDYKETQYKIIESRSVARRVIKKLNLAESEEFNPAPKTGVIVSLKSSIRGMLSSLKKAVKGLIKTEPKVAQKPGLMS
DEEERLPDSGLVSAFIGRISVSPVRDSRLVDIGFTARDPEVAVRTVNALAQAYIDHNMELRLGTIQDAMAWMNERIEEER
RKVEASERKLQEYREQEGIVTEFSGEVETVTAQKLAQLNSQVVQAESSRVEAETRYKQALQLKDNPLILDSIPEVLSNSL
IQSIKKSEVELYNRISELSGKYGKEHPKMKAANSELGSLQKRKTSEINRIIDSLRNEFEVAQAREASLKAALERQKQESL
ELNKKAIEYSVLKREAEGARELYDLLIRRFKETSVTEEIDAGNIRIIDRAEYAYQVSPNTRRDMRLAAVIGLMLGLGLAF
FIEYLDNTIKSPEEVEPYFKVPLLGVVLGHQVKGRREEDMNKKDELVTLKDPKSAVSESYRGIRTRILFSSTVSQPKSIL
IVSAMEGEGKTISAANLAVIMARTGSRVLLLDCDMRKPRMNSIFGLEREKGVSNILVGDCSISDAVHKTDIENLNLIPCG
QIPPNPSELLGSKAMREMLATLGRSYERIVIDSPPITAVTDAVVLSKAVDGVVVVLQANKTERVLAKRAIEQMQAVNAHI
FGIILNRLDERMTKYYHLYSYFYRDYSEEKNLEEKSHRKFWKMKEKKRKEKERRKTSMIT
>gnl|bykdb|A0A136JVD6 [Bacteria] Bacterial tyrosine kinase [Nitrospirae][Nitrospira sp. OLB3] (length=731 residues).
MNAKPMVLDEAEQTLSEYATACWRHRWLIVLVAGCFGFGAAVWSFLQVPVYQAKATVVIDNPTPGGLDKDKSFYPDNSPE
YFQTHFELMKSHFVLQRTARLLDLAERDEYQPKPSVIRQFVKSLMPESVLAFVRPPKKEEVDPADDAEEALIKQFAQDIE
IMPIRGARLAHVTANAIEPELAAQIANTLVSVYIERNQELSANSKEQAAQWFTTHLEELRQKVQNSQQALYLFRAKHGLL
TGEERKSVAAHTLAELNSQLVKTEMAKAEAHSRFLQIRSVLNPQGAGTAGLDWSKLDSQIQVLNSPLIQTLRAQEITVSA
QVAELSEKYGPLHPKLAHMKAELQDLRQRTQQEVQKIYDSVKHQYDMALAQDKAVKEAITRYNTDKIRLEQNEIEHSMLE
RDAETSQHLYDVFLKATKETDLSSGMRANNVYLADPAAPSSVPSKPRTKLNIMLGLLAGLMSGVGLAIFVEGRSKKLMAP
ADVERYLPNVSLLGVVPRLSKAAAQKKALAPPNALTPVAESFRIIRTSLLLSNPDMLPSRILITSPGENEGKTTLAVNLA
MAMAQLEDTQVVLIDVDFRNQQIHPLYEVGSPEQPPKGLGHLLRGEASLADVVHQTFVSNLSVIPHGGRPANPTELLHSK
SMAQLLNWGATNRYHIILDCPPVLPIADAAVLASKVDGVLLVVSAGETTRDACHLAIQRIKQAGGRLLGVVMQKAPVADS
PYYYGAYQQQR
>gnl|bykdb|A0A1G1E4S2 [Bacteria] Bacterial tyrosine kinase [Nitrospirae][Nitrospirae bacterium GWA2_42_11] (length=721 residues).
MELKKIFEIIWARKWVIIQAFIVITLTAFIGSYLIKPTYMAIAKASVSSSNASSSIASSLGMEDIAPSLSRFSVDSMENV
IAQVTLLPYMENMIGKLQLRNEENELMLPQNLISTGILYQIRSSIFPVRHIEVLPYKETNMFQINATSRDPEEAMMMANT
LAGVFISELQKLTRQEANSARIFIEDQITKIRGEWLSSLEGLKEFQKTNKTVNLDQEISIAIAKMSELMKQKEDNIIDLA
EEEARLKALKGQGNIKGDLGITPEALVDNPQIKILMDRLAGLKIELAGALATATEEHPKVIGLRMQIDRTQKELKKEMAT
HRELSPQIEESSRKIAALKAHLSLVNGNIEKYSSFFMSIPDKSTEMTRFKQSMGASEKIYNALLDYNYKIGIIEATTLSN
IRLLEPAGVPLFPFKPNIFLNTILGAFLGLMSGVGLAFFSEYMDDTIKSPGDIEAYDNTPLLGTIYNYGKALPQLISGME
IRSPAYEAFRTTRNSIRFASIDKPVKSLLITSAIAGEGKTNIVANLGISLAREDKKVLLIDTDLRRPRLETLMGIKNQSG
LTNVLVGDITIEDAICHTSIDKVDLLPSGTTSLDPGRVIESQKLMSLIASLSQVYDYVLLDSPPILSFDDAVIMAGYVDG
TILVVESKKITPQAIIRIKAIFERARLKPLGVILNKFVDRHYSGSYYYGDYYNYYYQDRKSKWGLWSGKLLGAIGNKKGH
S
>gnl|bykdb|A0A1G1GFA6 [Bacteria] Bacterial tyrosine kinase [Nitrospirae][Nitrospirae bacterium RBG_16_43_11] (length=729 residues).
MLFKNDNLHLLDYWRVLSKRRYAAIIVFAFIVGIVTVYSFVATPVYKGSAQILINLEKNPTMTFSEGDVAYLQMKDSDDY
FRTQIEILNSRGFADKVVKKLLLDKNPYYLEKKSKPDNGMINKIKDTVFMLFPGRTKPDNPFPESLAQREIDPELVDIIL
SEMRVETGKEGNIIKIHYLSENPNVAVAMANGIAAAYIEHNMYIRIKPFRDAVEWLSARMVELRAKVESSERTLQKYKEE
RGIASFETRENIIAQKLQELVSEVVRIEGRRQEAEIRYNQIKSVIDSPELLATVPDVMNNLVIQGLRIEELRIKKDISEL
SEKYGPRHPHMMKIVSELNTVQKNLVEEARKMLSAAKTEYEIAKSRETSLKRALDEQKQEFLDLSRKSIEFNVIAGESES
NKLFYEMLLKKLQEASLSSGINISNAQIIDNAVTPKSPVSPRRGLYIFLAAIAGVFGGVFAAFFVDYLDDTIKGQADVDS
ILGLPFLGLVPAAKGTGPLYITADPRSVMAESFRTIRTSVMLSSVEKPPKVIVITSTFPKEGKTTIASNLAVAMAQMGER
VLLIDADMRKPYIDKVFGMDNSIGISNVIARHSDFPDAVRTMPDFPNLSILPGGRIAPDPSELLSSSLMKDLLNGLRDRF
DRIIIDSPPLNAVSDPLILSSLADSVIMVIWGGVTGRDVVKKSMQSLKGVNAKILGVVINNLAMSKRDGYQYYYSYYSYS
EGKGIEKTV
>gnl|bykdb|A0A1G1HA47 [Bacteria] Bacterial tyrosine kinase [Nitrospirae][Nitrospirae bacterium RBG_13_43_8] (length=785 residues).
MRNRKNDDIKDRLEIQRYDRRDLPLSTHLEYLDHKVTEEVHLRDYLNVILKRKRIVLVFSICIVIITVILTFMMTPLYKS
TAVVRIEGESPNVLSVNGVTGVPLGADYYQTQYEILKSQSLAEKVIRNLSLDKNKDFLPVQSIPDKAKELIFNNTLGLLS
RLYSSFIVSDHPVREGPVQKVSPSENAIPTYLINSLIDRLEVTPIKNSQLVKVSFLSDDPEISMNVTNAVAESFIQLDLE
STVGASKDARDFLKEQIEIMKDKVEESEKRLNDYASKKEIVFDKADQNLITQKLSDLSAALNSITAERMQKEGLYREVRE
SGASNPVILGNQLILGLKKDFSSLEAEYYNLSKVYTPDYPKMKSLKSQMDAIQRRIEEETSRIADSVNSDYKASVKKEEN
LLRALNVQKQMALSFRDTISDYEVLKREVDANKDLYNTLLKRFNEVGVSAMSSATNIQLLDRAVYPKAPYKPNVPFNFLL
SLFFGLTGGVGLAFLAEYFDNTVKDTDIIERKINLPTLGIIPDFEIATQKARFQVIDKISPRKGTAPSRLPMPLHPQKGG
PVAEAFRSIGAFIVLSSASTPPKTILVTGPGEKVGKTTICVNIARALLESLGKGIIIDADLRRPALHYHFNMDNSTGLST
FLSGNMEFDSTEGVLIKPASEKGLSVITSGPVPPNPSELLGSARMQDLLYALQATFEFILVDAPPVMGLPDAIYLSKIVD
GTVLVAKAGETMKNELTEIKRVFRTIDAKILGVILNGVKKCDLKYGTYNYYYSSYYSSYFKDKVS
>gnl|bykdb|A0A1G1HPN4 [Bacteria] Bacterial tyrosine kinase [Nitrospirae][Nitrospirae bacterium RIFCSPLOW2_12_42_9] (length=721 residues).
MELKKIFEIIWARKWVIIQAFIVITLTAFIGSYLIKPTYMAIAKASVSSSNASSSIASSLGMEDIAPSLSNFSVDSMENV
IAQVTLLPYMENMIVKLQLRNEENELMLPQNLISTGILYQIRSSIFPVRHIEVLPYKETNMFQINATSKDPEEAMMMANT
LAGVFISELQKLTRQEANSARIFIEDQITKIRGEWLSSLEGLKEFQKTNKTVNLDEEISIAIAKMAELMKQKEDNIIDLA
EEDARLKALKGQVNIKGDLGITPEALIDNPQIKILMDRLAGLKIELAGALATATEEHPKVIGLRMQIDRTQKELKKEMAT
HRELSPQIEESSRKIAALKAHLSLVNGNIEKYSSFFMSIPDKSTEMTRFKQSMGASEKIYNALLDYNYKIGIIEATTLSN
IRLLEPAGVPLFPFKPNIFLNTILGAFLGLMSGVGLAFFSEYMDDTIKSPGDIEAYDNTPLLGTIYNYGKALPQLISGME
IRSPAYEAFRTTRNSIRFASIDKPVKSLLITSAIAGEGKTNIVANLGISLAREDKKVLLIDTDLRRPRLETLMGIKNQSG
LTNVLVGDITIEDAICHTSIDMVDLLPSGTTSLDPGRVIESQKLMSLIASLSQEYDYVLLDSPPILSFDDAVIMAGYVDG
TILVVESKKITPQAIMRIKTIFERARLKPLGVILNKFVDRHYSGSYYYGDYYNYYYQDRKSKWGLWSGKLLGAIGNKKGH
S
>gnl|bykdb|A0A1G1HUY8 [Bacteria] Bacterial tyrosine kinase [Nitrospirae][Nitrospirae bacterium RIFCSPHIGHO2_02_FULL_42_12] (length=721 residues).
MELKKIFEIIWARKWVIIQAFIVITLTAFIGSYLIKPTYMAIAKASVSSSNASSSIASSLGMEDIAPSLSNFSVDSMENV
IAQVTLLPYMENMIGKLQLRNEENELMLPQNLISTGILYQIRSSIFPVRHIEVLPYKETNMFQINATSKDPEEAMMMANT
LAGVFISELQKLTRQEANSARIFIEDQITKIRGEWLSSLEGLKEFQKTNKTVNLDEEISIAIAKMAELMKQKEDNIIDLA
EEDARLKALKGQVNIKGDLGITPEALIDNPQIKILMDRLAGLKIELAGALATATEEHPKVIGLRMQIDRTQKELKKEMAT
HRELSPQIEESSRKIAALKAHLSLVNGNIEKYSSFFMSIPDKSTEMTRFKQSMGASEKIYNALLDYNYKIGIIEATTLSN
IRLLEPAGVPLFPFKPNIFLNTILGAFLGLMSGVGLAFFSEYMDDTIKSPGDIEAYDNTPLLGTIYNYGKALPQLISGME
IRSPAYEAFRTTRNSIRFASIDKPVKSLLITSAIAGEGKTNIVANLGISLAREDKKVLLIDTDLRRPRLETLMGIKNQSG
LTNVLVGDITIEDAICHTSIDMVDLLPSGTTSLDPGRVIESQKLMSLIASLSQEYDYVLLDSPPILSFDDAVIMAGYVDG
TILVVESKKITPQAIMRIKTIFERARLKPLGVILNKFVDRHYSGSYYYGDYYNYYYQDRKSKWGLWSGKLLGAIGNKKGH
S
>gnl|bykdb|A0A1G3XRU6 [Bacteria] Bacterial tyrosine kinase [Nitrospirae][Thermodesulfovibrio sp. RBG_19FT_COMBO_41_18] (length=760 residues).
MSNHEEKSSSQANIQKIEEFPVSTSLNLAPEEKEEEIHLRDYLHILLRRKWTFITFFIVIITTVLIGTFMTTPIYRSTAT
IKIDRENPQVLKFEDIYKIEMGEDDYYQTQYKILKSRNLAKRVIRTLKLGEEPEFGGNAGLSHKVASVASVDVSKQNMSE
GINKRFVDGFLGRVTVTPEQRSRLVKVSFDSPNQELSAKVANEIAKLYIQFSIESRFEATQQARDWLQEQLEDMKAKVER
SEEALNKYAADNGIIFLTEGETTETKTVQGQNIITRKLAELSTELVQATSDRISKEALYREAQQGEGSLLSAVQGNPLIQ
TLKKDHASREAEYYQLSKKFKPEYPKMGRLKEEMDKIEARINTETRKIVSSIEKDFKAAQRREDSLRSTLEKYKKEALDL
NDRMVQYLILKRESDTNRELYNGLLQRLKETGVSASLTSSNIQVLDWAEVPQSPHKPRKTLNLLLATIIGLFGGIGLSFF
VEYIDNTIKTPEDLEKTISLPSLGVVPNLGKQSDRSSISMITFEDKKSPLSEAFRSIGTYIQFSSPIRPPKTMLVTSARK
AEGKTSMAVNLAVTLASSWGKGIVIDADMRNPQLHKILGLDNSKGLSSFLTGLLEFDNGLIQKTDIPNLDVITAGIIPPN
PSELLGSQRLKDLLYELVPLYSFIIFDSPPLLGLSDSLILSTVSDGVIMVVRSDSTPKEAALQARKSLQGVNAKILGVVL
NAIKQSNLKYGSYSYYYSYYYGEEDDHKGKKKRREKGDKA
>gnl|bykdb|A0A2N6GR48 [Bacteria] Bacterial tyrosine kinase [Nitrospirae][Nitrospira sp. CG24E] (length=761 residues).
MDRNAEFIPHQSAQGDAAETALTDYVGACRRRIWLIVAFAGGVAVVAAVWSLLQTPLYQAKATVVVNQEGPSALDKDRGY
NPDLTPEYFQTQFELMKSHHVFLRTAQLLHLSERPEYKPNPSALQSLLSSIFPAPPSLDAVGPKNGASEPSSEEVDDRLL
KHFSETVEIVPIRGARLAHVVATSEDPKFAAQVANTLASVYIERTQELNALSKEKAVQWFTNNLEGLRKKAEASQQALYL
FRVKHGLLGGRDRQSVTAQTNSDLDSELVKAEMKRAEAQSRMEQLQSVLRNRTDRNGVIEIDWSSLDALTEVLSSPLIQT
LRAQEIRASGQVAELSEKYGPLHPKLARADAELQDLRERIRQEVQKIFDSVKHEYNAAVSRVRVIKDAAGRHRQEKILLE
RHEIEYGTLERDAESTQHIYNVFLKQTKETDLSVGLGSANVYLADPAVPSSIPVKPKKQLNTILGLLLGLMTGVGLALVL
EARDRTLKGPTDLERYLPKISLLGVLPLLPKTGTGDSAHLLTDQSSGATAESIRIIRTSVLLSSPNKLPSCVLITSPGES
EGKTTLSVSLAIALAQLKNARVLLIDADFRKPAHRYIHGIQRDGSQTKGLAGFLSGSIKLEEIIHRTDIPNLSVIPRGKR
PSNPSELFHSKQMSVLLNRCREEGYHVILDAPPVLPVTDPAILASQVDGVLMVASVGQTTREACRLAIQRLTAAGGNILG
IVLQNVQVPESSYYCHVPEEGDQAEENGVFSDADHWTSSSK
>gnl|bykdb|A0A349BQG7 [Bacteria] Bacterial tyrosine kinase [Nitrospirae][Nitrospiraceae bacterium] (length=721 residues).
MELKKIFEIIWARKWVIIQAFIVITLTAFIGSYLIKPTYMAIAKASVSSSNASSSIASSLGMEDIDPSLSRFSVDSMENV
IAQVTLLPYMENMIGKLQLRNEENELMLPQNLISTGILYQIRSSIFPVRHIEVLPYKETNMFQINATSKDPEEAMMMANT
LAGVFISELQKLTRQEANSARIFIEDQITKIRGEWLSSLEGLKEFQKTNKTVNLDQEISIAIAKMSELMKQKEDNIIDLA
EEEARLKALKGQGNIKGDLGITPEALVDNPQIKILMDRLAGLKIELAGALATATEEHPKVIGLRMQIDRTQKELKKEMAT
HRELSPQIEESSRKIAALKAHLSLVNGNIEKYSSFFMSIPDKSTEMTRFKQSMGASEKIYNALLDYNYKIGIIEATTLSN
IRLLEPAGVPLFPFKPNIFLNTILGAFLGLMSGVGLAFFSEYMDDTIKSPGDIEAYDNTPLLGTIYNYGKALPQLISGME
IRSPAYEAFRTTRNSIRFASIDKPVKSLLITSAIAGEGKTNIVANLGISLAREDKKVLLIDTDLRRPRLETLMGIKNQSG
LTNVLVGDITIEDAICHTSIDMVDLLPSGTTSLDPGRVIESQKLMSLIASLSQEYDYVLLDSPPILSFDDAVIMAGYVDG
TILVVESKKITPQAIMRIKTIFERARLKPLGVILNKFVDRHYSGSYYYGDYYNYYYQDRKSKWGLWSGKLLGAIGNKKGH
S
>gnl|bykdb|A0A354F6L6 [Bacteria] Bacterial tyrosine kinase [Nitrospirae][Nitrospiraceae bacterium] (length=721 residues).
MELKKIFEIIWARKWVIIQAFIVITLTAFIGSYLIKPTYMAIAKASVSSSNASSSIASSLGMEDIAPSLSNFSVDSMENV
IAQVTLLPYMENMIVKLQLRNEENELMLPQNLISTGILYQIRSSIFPVRHIEVLPYKETNMFQINATSKDPEEAMMMANT
LAGVFISELQKLTRQEANSARIFIEDQITKIRGEWLSSLEGLKEFQKTNKTVNLDEEISIAIAKMAELMKQKEDNIIDLA
EEDARLKALKGQVNIKGDLGITPEALIDNPQIKILMDRLAGLKIELAGALATATEEHPKVIGLRMQIDRTQKELKKEMAT
HRELSPQIEESSRKIAALKAHLSLVNGNIEKYSSFFMSIPDKSTEMTRFKQSMGASEKIYNALLDYNYKIGIIEATTLSN
IRLLEPAGVPLFPFKPNIFLNTILGAFLGLMSGVGLAFFSEYMDDTIKSPGDIEAYDNTPLLGTIYNYGKALPQLISGME
IRSPAYEAFRTTRNSIRFASIDKPVKSLLITSAIAGEGKTNIVANLGISLAREDKKVLLIDTDLRRPRLETLMGIKNQSG
LTNVLVGDITIEDAICHTSIDRVDLLPSGTTSLDPGRVIESQKLMSLIASLSQEYDYVLLDSPPILSFDDAVIMAGYVDG
TILVVESKKITPQAIMRIKTIFERARLKPLGVILNKFVDRHYSGSYYYGDYYNYYYQDRKSKWGLWSGKLLGAIGNKKGH
S
>gnl|bykdb|A0A3A0BU62 [Bacteria] Bacterial tyrosine kinase [Nitrospirae][Nitrospira sp] (length=737 residues).
MVKGDSVNAKPMVLDEAEQTLSEYATACWRHRWLIVLVAGCFGFGAAVWSFLQVPVYQAKATVVIDNPTPGGLDKDKSFY
PDNSPEYFQTHFELMKSHFVLQRTARLLDLAERDEYQPKPSVIRQFVKSLMPESVLAFVRPPKKEEVDPADDAEEALIKQ
FAQDIEIMPIRGARLAHVTANAIEPELAAQIANTLVSVYIERNQELSANSKEQAAQWFTTHLEELRQKVQNSQQALYLFR
AKHGLLTGEERKSVAAHTLAELNSQLVKTEMAKAEAHSRFLQIRSVLNPQGAGTAGLDWSKLDSQIQVLNSPLIQTLRAQ
EITVSAQVAELSEKYGPLHPKLAHMKAELQDLRQRTQQEVQKIYDSVKHQYDMALAQDKAVKEAITRYNTDKIRLEQNEI
EHSMLERDAETSQHLYDVFLKATKETDLSSGMRANNVYLADPAAPSSVPSKPRTKLNIMLGLLAGLMSGVGLAIFVEGRS
KKLMAPADVERYLPNVSLLGVVPRLSKAAAQKKALAPPNALTPVAESFRIIRTSLLLSNPDMLPSRILITSPGENEGKTT
LAVNLAMAMAQLEDTQVVLIDVDFRNQQIHPLYEVGSPEQPPKGLGHLLRGEASLADVVHQTFVSNLSVIPHGGRPANPT
ELLHSKSMAQLLNWGATNRYHIILDCPPVLPIADAAVLASKVDGVLLVVSAGETTRDACHLAIQRIKQAGGRLLGVVMQK
APVADSPYYYGAYQQQR
>gnl|bykdb|A0A3A4W5D3 [Bacteria] Bacterial tyrosine kinase [Nitrospirae][Nitrospiraceae bacterium] (length=789 residues).
MNTIPQSYPEDKKDIHLYDYLEVLIRRKWVVIIFFTVLVATVAVSTYRMTPIYESDTTLLIEEKEPWEGTNILTEFAGMK
PSKVQTEIEMIKSRTIAEKVVKKLYYDINIFDVSGNLNPQITDVTIPDNRIGKIFAVTFQDNERFIVTDDSLDKDKVIGS
GRTGHPFSGGKDISFTLNNAGAGRDASFKIKKESFYSSVNKLMAATSVAPVKSTNVVKISTRDSNKQMAADMANSIVEFY
RQHDIRARSQQALQVIHFVDKQLDTVQGKVDDSLSALAEYKSSAGVTDLGEGTRAIIKNVTDLEKARAQLQVEKYQVGSL
YEEIRKNISSVSPSALSVFNDPVVENMIIRLSSLEVNRQSLLSDYTEKHPQVVALSAEINALRGRAHSSIMNILKSLENK
TENLSAEIERFKTQLRELPDREKKLADLTRNVEVSSSLHKFLMEKVNEANIMSASTLSQTQIVDEAVASLRPVMPNVMLN
IILSMIVGLIGGMALAFFIDYLDNSIKFTYDVEKRLGLPVFGRIPVVQANKAEFITGEEAVHANHSSLITLESAKSITAE
SFRSLRTNLQFAVMEKKGKIFHLTSSEASEGKTTITANLGITLALMGSRTLIIDLDLRKPRIHQIFGINKEPGITHLLTQ
KATANEITETASIEHLYIIPAGLIPPNPSELLSQQNLKDFLDEAREEFDYILLDSPPTLPVTDAQLLGRLADATFIVLEL
GVTKLPAAEQTIRKFRSVGVNVAGAIINKDRPSNGYGYYNYYSYYYGDDAPTGNGKKPLFKFWKKAGQA
>gnl|bykdb|A0A3N5I7D6 [Bacteria] Bacterial tyrosine kinase [Nitrospirae][Nitrospiraceae bacterium] (length=782 residues).
MDKRRNKDSNLLSVSRPGVETSVTPYLRPAEPTVPYYGFSESKDDSALVEYWTAIYRRKFLVLAVAALGALAGYIKNLPQ
QPVYQAVATLEVQDKNESFLNIGDLDPNAQRYSADSKLLTEMKMLEGRQLRQRVHDKLALQSDDAPLLPDDQLSKWLNSI
GFDAIGESPTRAGALEMAAATLTVSNPRMTRIVHLQSDSTDPIVASDFVNTLAQTYIDYTIENRLDSYQKVGLWLNQQLS
DIQSTLQKSEDQLIKYSKESGLLLTEGVDLKMNHIQTQLLDADTDVLNKKFKYEMARSLDPNSVTPILEDSLVGAYRMEL
MRKESALSELKTALKPEHYRLKRLTDELKERQKQLKLEESKVIQRLHDEYKSAEGHRDVLLGAYREQADAVAGQGEKLIY
YNMLKREVEASRELYSSMSKQVKQASIASALAASNVTFVDRSDPPVKPYKPQALREVVLGGSVGLFLGVVLVFVRRTTDQ
KFRSPGEVSLCLNTNELGAVPSVEGLRENGTLQIRMRFSGGKPGSTLPLFPSTLRKNSKEIEVWSARKSLFSESFQGVVT
SILSIAEEDKCFLITSPEAGAGKTSVVSNIGMTLAEIGYRAVMVDADLRRPRLHKIFGLDNTWGLSDLIDSAKPIDSYPI
EALAKPTSVDGVFVLPSGPPHPHISRLLYSSRAREIIVRLREEFDMVLIDTPPLLKVADARVLARYVDDTILVLRAGKTS
RAMGAAAYSQLVQDGRSVLGTILNDWNPKMDVPYGYSSRLYQEGYGATPKSGSASPPASGSA
>gnl|bykdb|A0A419FND3 [Bacteria] Bacterial tyrosine kinase [Nitrospirae][Nitrospiraceae bacterium] (length=750 residues).
MSNIESTIEKATKLRQFISPVKGETLTPENVRLYIEDKDKSPHLRDYFEVILRRKWIVLGFLLTVVMTVALLSFLTKPLY
KATTTLQIKSENTNILTFKDVYQGEMPAEEYYETQYNILKSRNLAKRAVTKLPPEKASEAAPVEGPSMMQAVFGSIFNFG
EKPENGREDEREAAQINSFIKRIEIQPIKKSQLINISFVSRDPAFASLAANTLADEYINFSLESKVGPTLVARKRLEEQV
EATRSRLEASERQLNDYIARGQIVFLGKKGDDESLLNQKLAELSRELDTATANRISREAVYQEAKRSGTNYNFVLENPLI
QALTKDYIGLESQYSSLLNVHKPEYPKMQRLEKQMEDLKKRIAFEEQKIISSLDSDYRIALKREDVLSRAIEGLRREVLG
FQQQMVQYQILKREVDTNGELYSSLLTRLKEVDVSTTLSESNIQILDRAEVPGSPFKPLKAQNMALSLIVGLLGGVFFAF
FAEYFDNTVKNADDIEKKSRLPVLGLVPISKTDPKALTGSAGPGDGMPFVEAFRTIGTYIQFSNTVKPPKQILVTSPLAK
DGKTMFAVNVARSLVKSSRGKGIVVDADLRRATIHSSFDLDNSTGLSSYLSGAIGYDDLIKKLPHLGIDCITSGPVPANP
SELFNSLRMKELIDTLSGEYDYVIVDSPPVLGMSDSLVLSAFIEAVIVVVRASNTPADALAQTVKLLRGVNARILGVVLN
GLDVGTRYGYPYYYQPNGRDKEGNGRTAGR
>gnl|bykdb|D8PGN0 [Bacteria] Bacterial tyrosine kinase [Nitrospirae][Nitrospira defluvii] (length=731 residues).
MNAKAVMSDESEHTLSEYATACWRHRWLIVLVVGCFGIGAAVWSFLQVPVFQAKATVVIDNPTPGGLDKDKSFYPDNSPE
YFQTHFELMKSHFVLQRTARLLDLAERPEYQPKPSAIKQFLKSLLPDSVLAFVKPVKKEAVDSVDDAEEALIKQFAQDIE
IMPIRGARLAHVTANAIDPELAAQIANTLVSVYIERNQELSTNSKEQAAQWFTGHLEELRQKVQNSQQALYLFRAKHGLL
TGEERKTVAAHTLAELNSQLVKTEMAKAEAHSRFLQIRAVLNPQGAGTAGVDWSKLDSQIQVLNSPLIQTLRAQEITVSA
QVAELSEKYGALHPKLAHMKAELQDLRQRIQQEVQKIYDSVKHQYDMALAQDKAVKEAITRYSSDKIRLEQNEIEHSMLE
RDAETSQHLYDVFLKATKETDLSSGLRANNVYLADPAAPSSVPSKPRTKLNIMLGLLAGLMSGVGLAIFVEGRSKKLMAP
ADVERYLPNVSLLGVVPLLSKSAAQEKALAPPNALTPVAESFRIIRTSLLLSNPDMLPSRILITSPGENEGKTTLAVNLA
MAMAQLEDTLVVLIDVDFRNQHIHPLYDVGSPEQPPKGLGHLLRGEAGLDEVVHQTFVKNLSVIPHGGRPANPTELLHSK
SMAQLLKWGATNRYHIILDCPPVLPIADAAVLASKVDGVLLVVSAGETTRDACHLAVQRIKQAGGRLLGVVMQKAPVAES
SYYYGAYQQQR
© 1998-2019