BYKdb

Dataset for cluster orphancd of phylum planctomycetes

[Download (right click)] [Alignment] [Repertoires]

96 sequence(s)

>gnl|bykdb|A0A0J1B8S4 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Rhodopirellula islandica] (length=854 residues).
MTPNSNSTDPTAGKRGPNSFASYPSQNAGTMGLAATGSYPAMNEGWGSADQGDASDLLGAIWRYRWAAMGPTILGAMIGF
LVFIKTPETFQSATLLMFESDRPAVIDTMTGDRIGGVPSIEIIRAQLFSDEVNRSALSDGNMNVFREQFHGSPVELAALA
SKMLEFETDLKDERSASSLVAQMTFENTDPELCEAAIKAYSAALQKLFADKHKSSRSELLKLISIATNQMQPKMAELESR
YREFRQDAPLVWDENGQAINPHRERQLYLTARRSELFEELRKKAIELTAIDSISNEAKDPLVRLSIIGQLIGKNFEIPDS
KRISQDMRDGDVELAQIELDQQLVPLMIERNKFAAEFGEQHPTVKALDAELTMMKRELKRLITEQSERIVELMEQNKVEG
IDPAKRAEEAVNVVLIASRAEVNLLEQQIGEIDLQIASERKEAIKLAQFEQENTALLREIDRNRELINHLEEQMARVELV
EEEGGIRVTELVAPSTAYVIGPSIIKTLGIGTIAGLIIGCGLALLLEKNANTFRDPEEIVAAVGAPILTHVPFFKGRVRR
AKGETSNPFEQLDAHLAVVHAPSSVASEAIRSCRTSVLFEMAGIHGGKIIQVTSPLPGDGKSTIAGNLACSIAQSGKRTL
IIDCDLRRPQVTDNFAKADQLGLVDVLSGKCEHVDAAHDTPLSTLKMMPSGPIPANPAEALTLPEMSELLDVLREEYDYI
ILDTPPLLVVTDPSITASMTDGVVMALKVRRKSKPNAKEAASILANVGAKLLGVVINASDEAGNNDGYKGYGYYRYGRHT
SRYYRKTANNGSKAGTRRTPVVVSGRGPAPRSARPIAVPPTAMPPVEQERSSDV
>gnl|bykdb|A0A0S8H0S8 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Phycisphaerae bacterium SM23_33] (length=614 residues).
VLQAALERCGGAGLKILQGRPNPVAYLKEALKIEAGKKDDIICVSLDSPYPSEADLLVNNIVEAFVSSSPGGNRSTAREI
LKTLRSEKARQAEELTANFQAMEEFKRANGIISLADGKGSIMAQRLGELSAALTVAEVEAILAKAEYDAARAMMNDPGRM
RYFAEQGSRSHLAQAGPDDAELAAAINQMQLQLVALKRQRTEGHPAVQALQAQLARARQRQAKADKKFAENHLALCAQRL
SAAQQKQGEIRAALVDQQKQAEQMDARLARCALLEAAFKRSLRMNELLDSRISEVALASDVGPMFIRVLEEASSGDEPTR
PNRPHAAAMALGLGLILGVMLALLAARLDHRIHSAADVPAVLGLPLLGAVPTIRRRRSLQSGAQTVLMDPASPAAEAYRD
IRTAVCFGVREGQVKTLLVTSAQAGDGKTTLVSNLGIAMAQAAQRTLILDADLRNPMQHEVFDVACEPGLTGLLAGTAGL
QDAIRFSGVERLDVLPCGAAPDRPAEMLHSPAFRQMLAELSGRYDRIVIDSPPVVSVTDSRILGAICEVTVLVLRAEKST
HPVAQQAIEDLLDVGARLLGAVINAVPRGNRRYGRYSQYGYRRSHRRKASAPSE
>gnl|bykdb|A0A142WPR7 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomyces sp. SH-PL14] (length=752 residues).
MGIRGDFEDELSEKSDERTVNFLALTWRYLWLLILFGGVGTGAAYLHFLKQPPIYQSSSTVLVTGDRQQQANPLGTESGF
AQGITQTMPHQMLIGSPLVVRKAVETHDLRKHPAFAGESDPASRIVRGLNVLADSKTPDVIRMSFRDSDPEVCQVALEAV
LDGYRSYLGETHQTTSKDVAELIKEAKDVLLKQLETKEDEYHKFRQDAPLLFAKEEGAKNIHQERLAGIEQARSALLIAL
HEKTAELDSLKNAMARGGNREALALIINANKESRENGLPQEKSPVTELFPLLLDEQMLLETLGPDHPKVTAVQKRIEITR
KYLTESLAEERKNAGENPMLKGGKRPDLVSLYLESLQHEVDVIQTKQKEMNLLFDQEKEAAKSLVAYEVRDESLRNEIAR
TSKLFEGVVKRLDEISLVKGYGGYEMSVLSPPTEGFLTGPVMARYLALGAVAGIAVGYLLAYLLELNDRSFRDPEEVQTS
LGLPVVGHIPVIELARADRRSNDAVHPSLVTFHRPKSRLAEAYRAVRTSLYFRTRGEPLKVIQVTSPNPGDGKSTLSGNL
AISIAQTGKRVLLMDADFRRPRIHKLIGQNTSLGVSSVIAGTAELVDAIQDTPVENLAVLGCGPRPDNPAELLTGKRFDE
LLGVLREQYDFVIIDTPPLLAVTDPSAVAPRVDAVIVTLRIAKRTRSEARRAMEVLGSVGANVLGVVVNGISSRKGYGYS
GSGNRGYAYGEGKAGVYYSEEEHPASSLTSQS
>gnl|bykdb|A0A142XAP8 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Gemmata sp. SH-PL17] (length=747 residues).
MARPIAGDPPMMQPPYQVPQSGGPVPVALSPFNYTNQPNIPGPAVAATPTPLGLLNAFRRRWVLGTFIGGLVAVAVAVGI
WLALPTGKHQVRALVQLQPKQVEFVNKTQEDFEAYRRHQMFLLKSRDVFTRALADPAVSSLDTVKQSEDPVAMLEDTIRV
AVAAPEILEVTLTGNNIEDMKVILDHVVRRYVDDATVLDRKQRDDQSAALQATLTSIEKKLSDQKSKLELAGRTNGTTGA
EATSNALALLQKQHVEADALFVGAGREIEKAEAELKVVQKQLEDKDPKTPPDPAIVTQLVAADVRVKAAKSAYTARKEYA
DKEATKATNPDLDDGIATLRAEVKKLEAEVKGAEKLAATEALEVARAIDTANKKKRAEELAYTIEVKKGVREKHRLERDG
LQRVIATTAAGGLSIDEDRKNLQPQREMHDKIQSQLIQLQVAALQSGRVSARGGAEKIPNNNQNKKIVLSSAGGAVSFFG
VILLVSFLEWRSRRVDGVDQVVNELGMRVIGTVPAFPNRASLQAATEAGGANWRFVLNESINSTRTMLLHTAKAQAMQVV
MVTSATQGEGKTSLASQLATSMATAGMRTLIVDCDLRNPSIMKLFELPLAPGVSEVLRQEVDVSDAVQATAVPNLWVIPA
GHCSNATIAALAQGNPLKTLFNRLRGQFDFVIVDSCPVLPVADALLIAQHVDGVVFSIMQDVSQLPKVVTASEKLTQLNI
QLVGAVVNGIKQDVYSYGYNYVKQLPA
>gnl|bykdb|A0A142XL75 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Gemmata sp. SH-PL17] (length=728 residues).
MTGRAILNAVKRRPFTLLGVALLAAGTGAAVWLFLPLPKATAATVFHVSAQAPSVLGQADGQANFVSYRASQIATIKRQR
TLNNVIKVPAVENLAIVRKSPNPVAWLDHAIKIDAPANSEYMRVSLEGDDATESKIILEHLKTAYLADVDLRDNGAKWSR
LQKLEETKRGYRSELEKFHKQIDTIAAALGTKDEATLMTFDSFLRDELRLAQRDLQNARENLELAKPTPKIGINSLDEEG
AALTLPWDLGVVEIVPPLSPAELRAQIDAEIRQDAQLKQLAEAAASAKERLNKVKERYQEGERPPTVIKAEDDLKAAELR
RDKHRDELGTTLAREVQKKHAQQEILRRAETRKQIRILEKRFALAKEKHDNILRKISQTNDYKIELSTIQFSIGQTEKLN
QSLGETIERLKVELGAPSRVTCSEEPFIVTGIEGNRRLKYTVLAALAVFGIGFAGTIGLETRARRVTDTDDVTKALGVRL
LGTVPAAGQESGKPGAPPPSLVEAIDATRTMLVHGTDEPDLRVLVVTSAVSGEGKTSLTGHLAISLARAGFRTLLVDGDL
RSPTAHRVFDAPLAPGLCEILRGSTSVLEAVRPTGIPGLSALTAGQWTLATRHALVGDRWRETKDQLKAEFDFVVVDTSP
LLLVSDTLLLAREADGVVVSVLMGVSQVALVDEAVTRLQAVRAKVTGVIANGVRHAAHAYTHGYGTVDPVEHTPAPAISA
SPVTTERE
>gnl|bykdb|A0A177PV03 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium SCGC AG-212-D15] (length=661 residues).
MVLGDAASALATKGLSSLEGLSQSEILAVLKGGFGANRVFKDGVTNNVLYLSFRGTNRDDCQVILDAIMQKYDTYLKSKY
ERLNDKTVREVLNIIKELKKGMDETKQKEDAWLAKNPPPTEVSETLLTNLRTRRSNETILRDSLQRQVKDLDHAIKIGQG
AEMFNDMRRVSAHPQTGNTKLDEKLWELYMQMALLQADYGEGHPQIQSVKRQIEAVRALYYGAKAKEVEMPKPGPDDPAR
WHLQSLKRELVAAQANLDEIEKQCNAAEYKARAREEWIKQEARFKESALSARQSYEEVGKRLNELQLSKNFGGVTADVIE
PATPALKVAPVPAKIFIVAMMLGLLLGAGLAFVAEAMDQNFHTLEEIRERLGLAVVGHIPIVEPVGHVPGTPATAMESIL
CTYYQPKSVQAEAFRGIRTALYFSLRSGDYKVIQITSPEARDGKTTLSANLAVSIAQSGKKVVLLDADFRKPRMHEIFGV
SADVGVASVIAGTAKLKDAVKPTAVEGLSILPCGPRPANPAELLTSPAFEQLLADLRKEYDFVLVDTPPLLAVSDPSAVA
PRVDGVLLVVRFSKNARPSARRAKEILESMRADVVGVVVNGYGRNGSGYGYDAYRYGYDQAYGYGSNESGYYHEHEGSSR
KPANGNGHGGGIVARLFRWLR
>gnl|bykdb|A0A177Q3B7 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium SCGC AG-212-D15] (length=731 residues).
MSGPDSGRATAPSPWELLRAFRRCWFPATSLGLLVALLAAGAVWYLLPNRFTATTLLHVSAQEPTILATSEAHTDFGLYQ
KAQAALISSRLVLNAVLKRDAIASLAILPRDPEKQIAWLQAELKVDYKTGPEFMRLSLTAERAADVKTLVGEITDVYLKE
VVYKERTRKLERLKHLQEIQSKYEESLRSHRETVRKLILALGSGDAQVLAVKQRYAAEALGQAERELLQTQSELRRARLA
GEVKRRRIKAITEKGLSGSATPIDLEVDADPSIQTLLAHKARVEKDIERIEQVSVRGRREPAMKPLLDQSAALDAQLEKR
RKLLRPEVVKRFADRAVRDLQAEFASLEERASLLQDLETSLVETVERLRKQTQAATVGQSDIESFRTEIAQSEKIADRIG
SEVERLKLEVDAPQRVHLIEEPVVMESASTRFRAKALLGAAFGALLLAIGLMTWREYSFRRVELAEEITQHLPVVACLPR
LEASATLAAGANGTHARDLVFVEHVDAARTSLLHLAKHGEVQAILVTSAVGGEGKTSLACQLAASLARAGFQTLLIDGDM
RRPACHRVFGAPASPGFSELLRNENSLEEVLQATPLDHLTLMAAGRWNYQTSQFLARERMPDILAALRQQYEYIVIDSAP
VLPLVDSLLLAQHVDGVVLSVLRRVSQLPLFESAVERLQSVGVNLLGAVMNGMSPKVHASRYHYEPASSTLAPESLLDID
LSGVPSESSES
>gnl|bykdb|A0A177QX42 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomyces sp. SCGC AG-212-M04] (length=782 residues).
MFHLEIRVSTTTTDWQAPNNPALEEQPNEKGLDFFTAIMGRKFLVVAFIGIGLGLGHLHFTRQPPVFASFAKVMVLRPQS
VLPNEDPERGTKKSANAVNLLENHQYLLTQPKILKGAVDPPIKDDASEEEKKHAKEASLSRLASLAASSNPAATIATGLR
VIRSEVSEDVLEISYVGPNAGDCKKILDSVLASYKRWLESTQAGNRKVLEEILVSAKGDLDRRLGENRQKYDDFRNTATL
IFQDNKGINYYEERLRKIEDERHQKMIALQELQATRNAMKDALSRGASKEALLLMANMLKPNGDEKSDPAASLQPKVDPF
MEKMMPLLLERDTLLERVGESHPQVKMLDRKIESLRGLLREEAGAKGSKLDLLSIHLESLDERINAYENEVAQLNSAFDN
IKGDALKMQGEQRTNERLNEEHANLKQTYEALVSKLVSLDLAKDAMAMQAEITSEPSPGVQIGPSMVQSLGFGGIGGLLA
AIAIALLLETADKSFRNPDEISRQLRLPVIGHIPELAADRDWKMVKDAQVDSSISVHHRPKSRLAESYRAVRAAIFFGTR
GQTHRVLQITSANSGDGKTTLCSNLASAIAMSGKKVLLVDGDLRRPRIHKLFGLDLERGLSSVIRDGMDLPDAVQTTLVP
NLDVMTVGPRVDNPAELLLSPQFTELVQQLREKYDFVLIDTPPILIVTDPAAVAAHVDGVILVVRNTKRSRPQTRRVRET
LDLIGARVLGVVVNGISERAAGYGYGDSYSYNYTTSYRSRSGKYYSDERVGHSYYDDSRKRR
>gnl|bykdb|A0A1C3EBY9 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctopirus hydrillae] (length=778 residues).
MRQTPQDSELASSFETEGEGGLSIDWMNLVFRYRWWLCAGVVLGLGLGIAAYIKLGPEYMAIGQVMVSRRNAVPLKEQSA
IGDWGERSEHIALIMSPMIASEAVRLGKLDKLKTFAGESDPTQMVLDDLKVKRVAGQDRSYLNVLDVTFQSASADDARHV
VKAVIDAYASYLNESRSEKTTEVFKTAQDAHDTLQKSLREKEEAYLKFRESAPLQWRAPIGAIAADGTSGATNVHQERVI
AVEEQRRLNLLRRTEINSRIQALQKAQDQGESTSTMEMLIRRFIANDGSGAELQQQQQEISAFENRLLPLILEEEKLLRD
FGPDHPEVKAVRKSIDTTLDFYRKHGLRMPDDMTPGPDGKPLIKERANLVQNYMETLRQQLKELDIREQQLNVLFELESN
KAKEYARFQAEDQAMTAELNRLRGLWGQLVDRMSQLTIDKESSGYTLRQTGPIKDEWVLKRLLKIVGAGMVAGMGLIISL
IVLKEFLSNQVRTVREVRQLLPEAYLGAVTSFDPEQSRLDPVQNVHPSLRYLRSPASIEAENYRTIRTSLLVTAEALNTQ
VIQVGSPEPGDGKTTLVSNLALALASSGKRVLLIDADLRRPMATRLFGLRPDPGLVDVLQGEIALENAIVETVVEGLTIL
PSGRPPHNPAELLEGGPLRQLMAKARTLADIVLIDAPPVLAVSDACIIGQHVDGYLLTVRLGKNRRPMLKRSRDLLLAHH
IPILGVVANGVEPSDREEMGYYADYNRNEAFFPQDQSLPEKSSTHRDLTISASPVRQP
>gnl|bykdb|A0A1G2XSU7 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium GWF2_41_51] (length=450 residues).
MVQTTTSNVANLEQVLITAKQHLAPTNPELARKESLLNALKQRLEELRQQADKNFDEMAEKEFKESDMLEIQEYKYKLEQ
ISLHQQQLRDMLVHEDSKTIELGRKQLAMQDVKEQLDNSKDMYSTIQKRIGELEMERKRLARISVAYLANTAPYQDRRMQ
YSLAITMGSLVFGLGLALITNKLDLRLKTPDDITKRIGVRIIGTTTSRDKIKKAMWPRQLADDYHSICINLGLMNNCTIP
NKLVISSASPREGKSTLAVNLATNLAKIGKKVLLIDGDLRKPDIAKYLKLDNKGKGMHQLLADFKLRDLLLYSDVPGLSV
LTAEPCDISIINRLIHHKNMVEFINEISRIFDHVIIDTPPVLAAVDALLWASMVDGVILTSLAGHTETPDLKDTIERLKQ
INVNLLGIVLSNVKYNQIYYPYGYGYYGKTNVIKDVKQEPADNIVIPEVK
>gnl|bykdb|A0A1G2YIM0 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium GWF2_50_10] (length=753 residues).
MNDIEKISAGRIISTELAGYGTMASNASNSEGASMNLWPAICRHWRALLVTFMIAAGMGTPLIWFAVKPMYESAGAIRIS
PIVPSILFSDRDSEQAMPNYMNFMNTQAELIASFQVLNRAADDLKTKNVAMVGRDPFTFLRDAASNGRLIIEPAKKSELI
RIVMSSKNPREGEQVVNAIIRAYMAVEVSNSVRGGDEKLSVLEDEYRTLTDKLQRQRKIVRQMAEEFGTSALTGRQDMML
QQVTMLQSEMTRIQTQKLSLEAQIMMLEKAEEETLPLEKVLTMKNEILRNDAQEQSLSSQISQLEQALIVANQTLTAENP
EIKRRSELLENMKKKLRAREEELTKNFNDMLTKEIARNRVYKLKESRAELERINAYEEKLMAMLSKHNVQTIELGRKQLA
MQDQKDQFALTEEMYNTIRRRIQELEMERKRPARISIAFNADSMLAKDKRPKYVVANIFGSGFLAILIALVFDKLDRRVH
TTEDITRRLGLRIIGTTVSSENIDKALLPAKLADDYQAIRANLGLFNEEKIPHILAITSARPQEGKTTFAINLASSMAKA
GARVLLVDGDLRKPDIAKILNIETGHNALRKVLLGYNTLDESVWPMPSVGLDVLISDGNDSYDAFELLTRSQTPSRLKAI
AAHYEHVIIDTPPVLAVPDAIIWAKMADAVVLASYAGHTQGPDVQRSLERLRAAGVKIIGTVLNSVRINKSYNEYGYGYY
GAAKSGYAKRVHNRRAIIVPVQEEKTEVTNAAS
>gnl|bykdb|A0A1G2YRE4 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium RBG_13_46_10] (length=757 residues).
MNNLEKYADRLLEQKLVNTGTPPEFNGQGSPDLIKGILHRWYILLLGFSIMCAIGLPAIWLSIKPQYTVTGALRFSPVLM
NILTGEQNSAQISMLTEAELITSERVIQRVADNLANRNLSFFEAESTDLAGKMKQKLTGDNTKLDAVTKLKRAISSGVIS
AKAVRNTELLKLTMVSKKSEEAQQIINAFINAYMAVEVSSSSEEQDRKLNLLDAERKLLEDKLRSTNDSIRQLGTEYGSX
XXIDRQDMKLRRVTALQSTLTAVEARRISLEAQVQFLEQIKEQSITPEDMLRIRNENINSDPMVQELTRNIVSLERDLIT
AKQMFAASNPIIKQKQDLLEAFRSRIEEQRQKASEDFNNVASEEIAKVNKEKTLNLKTELEQTKVHEKHLREVLAQEDTQ
VIEIGRRQLNIEDLQFQQNLDQETYDTVRRRIRDLELERKRPARVSVAYNADISGIQDKRAKYSAALLFGALFCGMGLAF
LKDKTDQRLRTPDDITKRIHIPVIGTTTSLHNIKPALIPDQIAGEYQTIRANMGLLSKNEMPKILVITSPWMREGKTTLS
INLATSLAKSGKKVLLIDGDLRKPDIAYLLNLPKSTKGLKDVLLGTEFEQAVSSIRSTGLNVLAMHSCHRVDAYELVASP
ETANIINKLSPKYDYIIIDSPPVLLFPDALMWAKIAGSVMLTSFAGQTTTQDLREANQRLTQINVKVLGTVLGNVQAQYS
FHRYDRYYQNPSSRKTAEQAKIQLLLPDTAVNETDKN
>gnl|bykdb|A0A1G2ZG92 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium RBG_16_41_13] (length=712 residues).
MEFLKIWEILSRRKWIFISAFLGFFGIVVIGTILITPTYKAKAKLIIETSDTISSLLSSLGTKGTKIGGVIPPKTGKTGS
TDYETDIALAKIRPLIEKLISLLNIKDRHGKTIRPDKLTELSLISKLKNKVLPRPYIEVNQYKDADMLEIAAYSPNPFEA
ANMSNKLATLYIEDRLERKREEYKAAKIFIKCQMKEVKEEYYKSLSALSDFKISKKTVNLDTETQNLINKIATLQGEYED
NEKTILESRRKIVDSNKKLKEMEKFRKESKELTRSDALKSLQTKLDGYLVDIAQKSVEYTKEHPDYKILEKEIETAKELI
KNEKKVALNSVSISIDPIYDELSKNLIDAHIDKNIAIAKKGLLQKYINAYQEELLNIPLKDSENSKLELTLTINKDMYQN
LLEYLMTVSIAESMTLSNIRLIEAAIEPYKPHFPRRYLNFAIALFLSVFWGLVLSLFVEYIDNTIKTPEDIKHIKSLNFL
GIIPNTKLLKDMSIISKLNPTLPVVEAYRTIRNSIQYASLDKPMKTIVVTSSMESEGKSSMSSNISITYSMEKKKVILVD
LDLRRPTAHKFFKISNNNGITNILSGGFSLDETIVHTDVSGLDLLTSGPIPPDPSSLIESQKLRDIVNKLKEMYDMVIID
TPPVMAVNDATVVGRIADGILLVIESGRATFSIVDHIKELFTKAGLNTIGIVLNKFKAYEAGYYYYNRAYYK
>gnl|bykdb|A0A1G3A0W0 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium RBG_16_55_9] (length=795 residues).
MNPAEKEFQPQTDPIVQERDYSNGPGKESRSSEIVLSAEEIINPPHVTPWPNRLMRAGGSGPSVPLANDILGSFLRFKWT
VLFVFLLVSAPAIAIIWMQIVPKYRARAEVRVRPIVPHLVFRTDENGAIPFYDSFVNTQVSYMRSSTVLQRVLDQPAIRQ
TQWYKNPRSSLMQRFYGNKAPPLERLRDTLSVRPRQRTEIIDVDFVDPSANEAKLIVDTVLEQYIRYIAEMSNENEEELY
RQLSERHTSLRSEIQGHEEFVANLSKTLGTATPGELVSSKRVRLDQTKARLNELKQSIALLEWKKKALIDDSNNVAFASS
PAIQSEYSDDEEWRKLDYDVRAMKLQIANSGLTSKHPDMIRMEKNLEFVEESLRLRQMQLNERWHHRPQDVPGTPSTIAQ
WRNQTINVLGAPVTIANSGMPDLDEDSAGVERQLAQTKHEEQLLAAEIDKQQVEFDTLFATAQSLEKANNDLNHKRDLFE
AVRQRMDQKTMERDIPPSIEVLSKAFVPSQPHSDRRMVFMAMALILGVGAGGGMGLLRANRRQTVYVPDDMPYAMQVPFL
GYVPVLPVRRFPQKPFGKSLCEQKYAQDRMAESIRLVRTALLSRLGGPRNTALLITSAVAGTGKSYFTMTLGESLARAGK
KVLMIDADLRKMGLTRRFNLAGKAGFIESLRSRSADKRHIFPTDTFGLNIMPAGKHNDGAVIEETANGAFKACMSQLRQW
YDFILLDSTPILPVADAMILSSQVDGTIMVERELVSQRGTQIDALMRLTSGGGQLLGTVFVGSSDSKDYRYSSAY
>gnl|bykdb|A0A1G3A880 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium RBG_16_64_10] (length=764 residues).
MVYAVLYFLRVVRYRRSVMVTALLITGLLGGLYFTTATRYYEADASLLILQTGGDVLTPSLSVDGAKQEIIPTYCQLIES
AVVLQGAIARLGPQHQVDFRGQPRDQWIEILEDNLTAVAIRRTNIIRVSYQSRSASAAVAVIRAVMQSYFDFIEKTHRGT
AGQIMDVLGQEKVRVEAKLDEKKAALLAARRNFGDLGIKPGGQVVHPLVQRAVRLNEALVEAQEKRVELQSALAAIQNAV
RSGADLQHHLLSVEEAVGREILLTGLGFNTRDAAVQANMERSLLEYQSEMKSMQQFLGPAHPRLTEVAERVRATEQYLTA
YQTRVSERLTQLKDTRLGPMLIQMLSQALANASQREMALRDSFETARAEAVRLNGDLAQLEILEHDVEQLRSFHDVLVNQ
IANTDLRQEHGDIRATVVKEPMASQQPVSPRLMTVALLVLVIGLLGGGISVYVLDILDDRFRSADELRLRLGVPVLAMVR
QLPNAGVPGWAGVQANAAPDAVESEAFRTLRTALAFSPHATERIAVSSSEPGDGKTTVLVNLAVSFAQAGKRTLLIDADL
RRPGLTTLLGMKGAAGVSDVLRGDGEVARLAAQCVCRSAVAGLDVLGSGPRRPNPSELLAGPRFADLLAWAESQYEQILV
DSPPVLAASDAQILGRLVDGVLLVVQPDSNRRRVVERAVESFAALGVELLGVVANRIRPESNDRYDDGCAYAYGYGAAYR
DEADQDGLIGADRDHEPQGADEAIERPRPANEAADQIGPVKRVA
>gnl|bykdb|A0A1G3C300 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium RIFCSPLOWO2_12_FULL_40_19] (length=652 residues).
MDYKDSPEFNPVKKANIFSIKELTRGNSSPTVRKPEPGKESQEPETPVKYDVDDALINNYLSKLTVQMTGNSDIISISFT
GTHPETLAKMCNMHAKKFLETHLELRFAASQDAVKWLQDQLVDKKLKVEEAEEALILYKEKQNIVGLGETAGIIEQKLEG
LKSNLTEIKIEKIKLKALSDQIKQYSKDPTLTKLIPEIVKDGSINTLKAKYADLQANKTMLSEKYGEKHPNIANIDLQLK
EVENRIKLETLSLITKVETDYNVLLASEESYEKAYNEQSLVVFDLNRKITVYRRLQREADSERAFYDILLKRMKESNIAG
DLQTSNVSILDPAMEPRTPIGASRNSQIMKGVMIGLALGIGLAFFLDYLDNTVKSTEDVENYLGVTLLGLVERAKQSKEN
KDANLELLTSEAPKSVFSETIRNIRTGIMLSTTDTPHKSLLITSTKQGEGKSFIAANLAIAFAQTGKKTLLVDTDFRKPR
QHKIFGIDLKPGLSNHFIGEIDYESIIKHVNIPHLNIITCGLIPPNPSELLGSHSMEKFCDNVRNRFDIIIFDTPPTMTV
TDAVVLSRNVDGVVFVIKSGQTPKELTRRALLQYKNSKSDLLGIILNLVDVSKGGYYSYYYSHYYKYGYGYGAEPPKEKR
KREKREKKEINV
>gnl|bykdb|A0A1I3GSP0 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomicrobium piriforme] (length=788 residues).
MTAPQKQPNAAAEFDFAPFGFHKATAGRSIDIVSFVLSLWKPMAIGLFLGLLVGVGLYLMMGPVYSATTSVLVSKKASVP
ANNGEANRYGERGDHVQLIQTDLIVERAFKDHGLNEIPALANAYDPLREVTEGLSVSRSAGQESSFDNVLSITYLHPDKR
IARAVVQAMVEAYRDYLEDTRDENAQQLYKSLLERQQQLENDVKSLEAEYQKFRHDAPVFLKASPIVSINGMPAPAQNQY
ETELASIETAQNENLRKRSSIQARLATLDRKLKDNASREELEFWVMHSLSTGTAGAGGGNGGGGASIAGPPEKGALDSQL
LTARLLEQRLLHSLGDDHTQVRNVRRQINTILDFYTRQGLTPPDLKQTGKGPISSRSAALGLDLVSVYRDTLQGQLKELE
LDNQNLALLHTDAQKKAKQAEMFEVEDQRRKDEIAQKKQQLERMFDQIAEYDITRGQEGYRLQQISQVRIERSMKRVIKL
VGTCGVMGIAIIFCLAYFREWYDTSLKTLDDVTTFTHEPLMGSVPTFSSSTDLDRIAQQRGLSPALCYYHRPGSREAEAY
RSVRTTLFVSMREDHKVVQVSSAAPGEGKSTTAANLAIAIAQSGKKVLLVDCDLRRPTQHTLFQVPQEVGLTDVLLREID
WQNAVRPTQIENLSLMTAGLCPENPAELLSTGTLQVMLRRAREEYDVVLLDSPPILAVSDPCIISPHADGLLLVVRMKKT
KRATVQRVHETLQSHGVQVYGVIANDFQPTTSGESGYDYDSYGTYYRENQTPAASKAKSAYVPQTAGK
>gnl|bykdb|A0A1N6KY57 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Singulisphaera sp. GP187] (length=737 residues).
MMLNSNPGSRPDSVNLPATIPPHRKDSFADSSAVMGSSTSLDPFMLLKALRRRWAMALGIGLVGAGVIGFTTYLLVPAAK
YTARSMLHVNSVQPRILLTTGEVHTEYGAYQRTQLALLHSRLVLSSALKQPEVAKLPILTKVSDPIEWLENELKVDFAPG
SEILRISISAEKPDLPMLLVNAVTQAYLDEIVDVEMKQSRQRYDLLKSTWNRYQENLREKRQQLKGLTELAGSDNKSTIA
TIHQHELDRLGRAEDELSRIQSELRSLRIESEVLHEKAALNQMMVTPAMIADAISRDRSIELLKDKEALVQRAIDRVSHL
VRNRNDPAVKKHRDDLEAIHVALAAQRRKLYPIVTKQLQDMGRDSDESKEILVQHRCVILEKIEAALQDDVKRLTERSRS
IGQNSVDLFSIQEEIANADEIARLIGKEVEALTVELQAPPRIRLLEKAELPRTKDETRKFKLAGVAGCGAFALALLGISF
WESSARRVDSASDVVQCLGMDLFGTLPILPRRRLMLGSGAAQHRRWGSMLIESVDAARTALLHVSRTESVRVVMIASALG
GEGKTSLASHLATSLARAGRRTLLVDGDLRRPSVHELFDQPCVPGFSEVLRDEIELIDAVQPTLISGLSLLTAGFSDSDS
IQTLASRDLRAMFDQLKEQFDFLVIDSSPVLPVADALLIGQHVDAVIFSIMRDVSRIPTVQAAYDRLARLGIRMLGAIVT
GEQTDHYGSNYLPSGRA
>gnl|bykdb|A0A1U7CLW1 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Paludisphaera borealis] (length=763 residues).
MEPFRSSSFINGIPTVLSQEQGASAPTPVELLPVDRIVPGYGASLKAVEPPPGLSEMPDLDGLLRALRRRWLFALLGGLL
CSSLSAAAVYLYLPPPKYTARALVHVAEKRPRELFETRESEVGFRTYQETQVILVKSRKVLEAALNPPAIASLPTVRKLL
DPIDWLSGVLMVDFPRGSEILSISMTASCPPLDLSTLVNAIADSYLTEIVDKERLARVERLERLKELFADYQKDLTEKRL
KFKEMAGSIGTSDKQAAAVRQQMMVEHLGLARQELLKLNSDVRKSQARLNVLASKPELEPTSNQTVSTLDTLSTAEVDPQ
VMELRSRLAELRRKHASVKRISRQGNVDPSILAIQREIKLVTGELEGRRQELRAAAAEFNRAEPAAIPDARLEEVKEYLE
ILHEQEKSLIDEIASLESQMSSLNVKSMDFHWLEDEIAVASDTAKMVGAEVQSMTVEMQAPPRIRLIEKASVPTMNDPLR
RCKLSTIVGAGVFLAFVGCVSLWEFQSRKIDVPDEVAFRLGLRIIGDLPKLNGPRRGDQKQIERDRLVQSIDAVRTMLLN
AGRHQPFRVVLVTSALKGEGKTSLSCHLATSLARGGRKTLLMDCDLRKPSLHDVFDFPSGPGLGDILRGEIGWTDAVRQT
PVPGLSLIFAGRCDPATIDLLPREDFPNLLQELRDQFDFIIVDSSPLLLVTDALIVSQHVDAVLLSVLRAVSQLPQIYAA
SERLASMGVRILGAVVSGVPLKPNRYYGSYTSPQWNPVEEEPS
>gnl|bykdb|A0A1V6CUG1 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium ADurb.Bin126] (length=302 residues).
MANVWDAIKKHQAEQEQQRAAADQVSAETEAAPREAWRVTPAADAAPAPAPAPASQDAKAPALQAPPIIQSVGAAKVIGH
NGSFSEVLVTHHDRGGRITEEYRSLRTHLLAQYPDERFCLLITSAMAGEGKTVTAANLAMVMAERIDRKTILVDCDLRKK
KLTAMLGCKQQAGMAELLQGKATLRDVVVPTVYPNLFFLPPGNAAGNVGELMGRPELMEIVGELRRKYDYVLFDTPPINV
VSDAGILSKAANEALLVVRMHRTHRESVDKALRLLHATNAKLVGLVLTHRRFIIPSYLYRYS
>gnl|bykdb|A0A1Z8MBT6 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Rhodopirellula sp. TMED11] (length=796 residues).
MPSERFWTPLQIVLMTTESTSNIASRQSSHSNASTGEGAPIDPWIIWVTFRRCWVWAVPIGLVIGTIGAVMVLKSFQPEY
TARYIVAANQDWVIYKGINEAPRDLAASEKTWVIDHPGVIQAVMGDQTVCKAPSLADPTTRETNLRKNLSVAGAGTKDKM
MIKYTDTDRDAAAAVCNAVVAEYLQRRAEFDGTQSRRLISVIEKQIDELDVEISAKEAEVRQYEVEAQGFSSNNQVSVIE
DQSQTSRLRELIDQRFELEQQISLIEQDLESIEAGENPLAVISGDLLEEMDEQDFTPPRSMVKKRLVTRPVLDQAISQXR
KVVTQKGVVDRHQAALIAIKADRRFGPGYVGIQETEDLLVTAQTELDRLMDSVKDEVRQELEQQFEAQYQQDLEDEGKEL
ERLEDAWAKNRDLQIKNASKSSAGQRELVVKRLQFDLGRRKRQLEMVKNEYQIEGDKRSKRVNDSWDVDKHVNHLAMLRE
RYAAAEQRLDAIKTESENMSRVQPIAAATPPTKPNEEVPTKKLAMVALAGFCVPFGLGLLWELHTKRITDSHHIEALAVP
PVIGELARAPRASGARQSRGRRVFXESVDSLRANLALSQDTRTARSFCIASSMSGEGKSTAASQLAISLAKSSGKTVLII
DADLRCPDQHDIFGLALEPGLSDVVEEKSTLDDAINRELGDLIHILPAGRLKASPHRILTTEAVQGLIARCMEEYEYVIF
DSAPILAAGETLAIAAVVDSTLMCVMRDVTRTDSVLRSTRRLEAAGANIVGTIFSGVTPSKYVYRYGDYKYSNLVS
>gnl|bykdb|A0A1Z8MCI4 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Rhodopirellula sp. TMED11] (length=702 residues).
MDDLDKIETSQAIGLGLILQTARRHLLWVLPTGFVLCALVFLLLHDWKVDRYQASHWVEIAPNHVAFSDVRARGGSDAKG
EEALLKSPMVLESVLAQPFIKELKPTTDGGPRNLAYLVENVALTSKGAQGRYAISFIDNDPVAAKQLSDAIAESFMAVRT
LLDSTQISNVRESLRPAISEWESTVLNQQERLQLAARSAGIPLDEMTQQREFLASLKRAHMDATMQLKAVQQELSSLPDA
DLSDSEGVRVAELEDGEATDLTRLRAGLVAEKHRIIVEDSENVFKEGLVRIEAKIRDIDEQLSLRKAQASSEAEAVLRDK
AGKAAKQQIADLELRIKTLNDGINAEKARLAGEQSKWNAIQFELDNVEVSKDVLISLRRREAALKTEGGYKDVVSSLASA
SLPETPLENSNTKRQLLAYPLVFAALFGLGLTVEVFSQRFXRARNVTEITQLSLLGELAKFPRWGSKSGRQFYERSVMAL
ALRLGCLKVLSAGKVVGVVSGVSGEGKSTVTFGLACMLGHSKHLKVLVIDADVRKPSLHSLFDVSNEVGLVDVLMQRSEL
DDAIVAVGKLDFLPAGRLSAPPFGIFSEGNVSGFIDSLREHYDLILVDTSPLNLTPETMLVAESFDHAIVSFMRDKSRAA
YAAKMLDKLELLDSNVVGAVFSGTPIREYKYQYGSYYYYGGKKAIEMPVSKDACSGIGSVPX
>gnl|bykdb|A0A1Z8MHR4 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Rhodopirellula sp. TMED11] (length=871 residues).
MLDMPPSTPVGFDTSGAYGSQNQSPANGESVLTILWRYKWLIGMLLLAGLIIGYWNYKRTPTTFLSSTQLMFKSETPLSL
DTATGLVQGGVPSGNLMESLVISDAIVKRVAMSPQLRQSPSMRGRSEAQVVSAIRGSVRFHTITAVKDSRDRMIVGLNYQ
SQDPYACVAAINGFYSAIRQHFDAERQATIKEIENLVNNARNKLLPDQEKLEQEYRRFRETAPLQWDLDGQAINPHRERQ
VMLQKNRLDLEQQLRLLSSDLRLAQKTIQRHQDPAIVAQVIGLLGSLNHEGMTGIKRALNGENQRQDDLTLQRLEVQRKL
IPLQIKRDQMELQFGPSHPEVKSIALQIESSQRKLNELNQLMSNRIAELQAKNQNDPESQRPRDASKNAASVMVDAYVNG
ITERINILDEDMQSIDVQIERERQLADELKKAEENDASFNRRLETIHALRFQLEQQLAALNLAHVNDGIMVKQIQETSPA
IRVGPELTRYLLIYGLFGLGISGLLAMTFEASAKMFRSAEEVHSDLRLPVLSHIPLDDSMVQSAKVGDPHVDQLDPKLAV
VHRPYSAAAEAVRGVRTAMLFEQRQFNSKVFQVTSPLPGDGKSTLVGNIGCLVAQSGKRTLLIDLDLRSPRLSLRFNLST
NVGLTNVLNGELAPEEAVCHSPIDNLDILPCGPLPANPAEALALAEVAEVFRWARENYDYVIVDTPPLLMVSDPAVVTTY
VDSTILVMRIRRRCRPNAREAVAMLRSAGASILGVVINKMDEFTGKSYYRSSASGSYQSIGYGYGDSYRRRYQHDAIAHD
AYVVRGYRPAGSDAQYDARYDSYAQSGPGMGGPSSGGVVPPGHYPNGAEAPGLPPQPPQSSGGSYDSSIGS
>gnl|bykdb|A0A1Z8MPL5 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium TMED10] (length=702 residues).
MLFAIPAGLGTWFLVPVNYTAHSLMQSRRNTLIFDVQNAEESGWEAQEQLIRGYRVLNTALNDGLMELEYIKEAQEDGID
PIDYLANVLIIEVPDSEKEMKGYGGQILRISMRGDDPDQLKQILEAVTDAYLEEVVTEERAEWLKQKDVLQAQYLEKVDE
LRLKREDLQELAKTVGTSDPDTANATQQLLLDQILYLRRQISEVREQSVQKQRDLRAYEQQVGSLALAGSILPEDIEAEL
SENEDLAEYQVSIAELQAELDAYKQIYRDSSAEAIKSREAEITRLQEEQAGFAQQLRNEILAAVRRGERKSDAQYNHERL
EAESIEANNYLASLQAEYSKLALQVQEIGEYSADLERRQDELVHLTQVTNELGYELEKLDLELRANQSRVRRVDGGVRKP
KTGDTSKRDQLTLVASFGALLLGIGAPTLLDVIRRKVSSVNQMSEGLGIRVLGNLPLLDKPKRRLGFRAPTPEAIEDLQV
TMEESIDGLRAMLLHLPAAKDVRTLMVTSALANEGKTTVASALATSMGRSGRRTLLIDGDLRCPSAHRFLEMPLDEGLAE
VLRGDVAIENAIRPSRMPGLRFLSAGHCDPTSLQALTKKNLSEIFEKLVDEFEYIVVDSAPVLSVVDSLLIGQQCDAAIL
SILRDKSRIVPVYETNERLRTTQIPVLGCVFNGQQNNIFSPGYYTYGYGSPQPLGSDTESPS
>gnl|bykdb|A0A255QXF5 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Rhodopirellula sp. MGV] (length=784 residues).
MQQHTPRQHQGAPYHFNGPSSGPDSGGFDPWLIWVTFRRCWHWAVPAGLVLGSIAAFGVLSTFEPQFEAGYRLEANKDWL
LDRGVMPTPDDLAKSEGPIIASPIVLSSILANDTLHQFSLADPESREQHLKQRLKIHGGGTKSTMVVTYTDADKNFSAEV
CNAIVGAYLQKRDEYDNLRISRLVQYLGRQIDELKRRVEEQKEAVAKFAREASGAAPGERVAEIESAESFLLIEKLRSQI
SNLEIQLAMIDAGVSIRNPSADDNIDDLPMTHFVPPYIPVVKGKIDDSDVQDFIEKDESVKLANERYERHRREVVNLEVA
EGWRRAQAYYADQQKLRDEWKTKLDEARAEASARAISVLNADLEADYQQRLRERDDEIERQRKEFADLADIKQAELARRA
DYMSEHEAENLKQGRERLERQLAVLQKQYDAEADRLRKRDNNNVALEFAKTDLQQSRAMLQKVTERLDSIQLESQRGSSV
ISVAKATPPTRPVEDMPFKKMLAAGGAGFFVPFLLGLLWEFRVKRITDSHELERSQMLAPVIGELARAPSATGSRNSKGR
RVFEESVDSLRANLALSKDTRDARTFAIVSSMSGEGKSTAVSQLAISLAKASGKTVLIIDADMRCPDQHDVFGLPLEPGL
NEVLREVVPFEQAINKELGDLVHVLPAGRLKASPHRLLSTSSMRDLLDQALEKYEYVIVDTAPVLSAGESLAVASAVDST
LVCVMRDLTRMDSVVRTTHRLEASGANVVGTIFSGVSHRQYAYRYGDYRYSDYTDLLPAGSNAE
>gnl|bykdb|A0A255QXY0 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Rhodopirellula sp. MGV] (length=836 residues).
MLPLHSSTSSNDLRSIADGSQDEHGQAVLSILWRFRYLVAICVVIGVGVGHWYHRQKPAQYQATSKLMFRSDAPMALDTS
TGLIRGGLPSGQLLKSLINSRAIVGRVKNDRQLREVAAVRGLTDREVMRLVRQRIRFDSVTDLKDSHDRLIAVLSFEHDD
PQVCEAAVDAVSRAIGAHFQEERESTINEFTRLINKAQDKLLPQQLALERDYKEFRREAPLEWDTQGNVINPHRQHYDHL
QTMRQGLERRRRQLGTELTFVTNMRTQQRHPELVARVISELSDEAHDLGDVPFGMRKLMDVKEDIGIQQIEIEKSLVPLK
IKLEQMQMAFGASHPEVVSLSTQIEASQRRLHELNLMGQQRRKEIAPEDLPTEDGSSPTNKSNASELVDAFICGLQERLK
VTQKEIDDLDLQIEAEKRAADELKHFEEDESSYKRRIASVQGMLIQLEEQLAGLKLIDMDGGIIVDQLWGSGGAARIGPD
QKKDLLAGGMIGFILGGILSILIEFWSMTFRSADEVQRALRAPVLTHIPVDSSRVKAHDSMDGENGSSLCDKISVVHRPH
SPAAEAVRAVRTAIMLERKKNGSQVFQITSPLPGDGKSTLAANVGCSIAQTGKTTLLIDLDLRSPRLSLRFNLQSDKGLA
NVLNGEIGISEAIHETSIDYLDVLPCGPLPANPAEALTMPDLVEIIAWARDRYDCIIVDTPPLLMVSDPSIVASYVDAAI
MVMRIAHRCKPNAKEALSMLRWSGTRVIGVVINKLSPRNQAYKASASGGYQSIGYGYGDKYRRRYQREVNSKDTYMIKAK
GSTHRVDGPELDLEADAVVDPVDMAETGAVKTPTFK
>gnl|bykdb|A0A257WQ92 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetales bacterium 12-60-4] (length=551 residues).
SLQWKAPVGSAAADGQTTTNVHQERVLAAEEQRRLNLLRKATLQSRLKSVETAVANNEPRDALEVLIRRFLAQDGAAGSE
FQQQQQQDIAIFESRLLPLILEEKQLLRDFGPDHPDVKLKRQTIQTALDFYRRQGVRLPEERRQQQADGSAPGEVDFVAL
YAESVRQELAELDVRDQHLAQLVEDESVKARGVAKFQAKDEAMHAELARLRDLWGQLVTQVNQVSIERDGNGYVMKQIAP
VKEELSMKRILKFVGGGGVAGMFLIAGICLLRELRDLRIMSVGELRRATNYSLLGTISRFTSVIDPHVIRGGMHSALRYL
LAPRSMEAESYRSLRTALNVTSDNAHANVILVTSPETGDGKTTTISNLAIAMAQSGKRVLLVDADLRRPSVHTLFNLPTD
IGLADVLAGEIQGLNALRPTFVENLQVLPAGQPPANPAELISTPRLTQFLKSVRDEFDMVLIDSPPLLAVSDPCAIARHA
DGLLLVVRLGKTSLVTARRAQELVKTHGLSVLGMVANDTPAHDLNSYSADAYYRDVTPRQPVTREALVTQA
>gnl|bykdb|A0A2A2W6A9 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Rhodopirellula sp. SM50] (length=787 residues).
MDHQSNQLQPYHTGPVGRMPVSNEPPNAFDPWLLWITLRRCWYWAFPVGIVLGVIAAFVVLQSFVPRFRATHQLAANKDW
LIDRGVMPTPDNLSSSERMLITSPIVLSQVLDNPEFQAFSLQDPDPDVRDQKLRSSLSIGSAGSRSTLTVSYTDTDKQFA
ADVCNAIVESYLQKRDEFDNRRIGRLESWLTPQVEQLRRKVEEREHLVSQLAKEAHGVAPGEKVAALENSDSLSVAQKLR
NQISDLEIELAMLDAGVGIRNPSESDDIIVPSVAEFVPPEIRVQRGEIDPKRLAAMVENSRDVFLAKERYEIYRKQVLEL
EISERWRFDKERYARLQKDRDEWEAKLASAKQAASEAAVQILEDEIEEDYQQQLALAEKEKERLRAEFPAKVKAKQEELE
RRAEIMSDQEKQQIADRREQMVKRLAVLQEQYEAEADLLRQRDGNSVALQFAQDDLARSRTMLHRIMDRLESIQMESKRG
SSVLSISEAVPPSRPVEAVPVKKMLMAGGGAFAIPFLIGLFWEFMTKRITDSKDLERSLALAPVIGELARAPRGSTGRNS
KSRRIFEESVDTLRANLALSKDTRHARSFAVVSSMSGEGKSTAVSQLAISLAKSSGKTVLIIDCDMRCPDQHDVFGLALE
PGLNEVLRKAAPLKEAINRELGDLVHVLPAGRLKASPHRLISPDSMKELMDEALESYQYVILDTAPVLSAGETLAVASTV
DSTLVCVMRDLTRLDSVVRTTHRLEASGANVVGTIFSGVTPRQYSYRYGDYKYSDFGQMLAETAHRS
>gnl|bykdb|A0A2A2WC24 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Rhodopirellula sp. SM50] (length=874 residues).
MYSSMLDQTSPQPVNYDSSVTLDPAQEQHHGETILTVLWRFKWLLAAFVAIGTSIGYWMYKQKPTTYRATTQLMFKSDTP
ISLDSNTGIVRGGIPSGKLMQSLITSDAIVRRVAANPELKSIPSLESSSETQIVSMVRSGIRFQTLTDQGDSRDRMIAAL
NFDGRDPQVCVATVNAVSQAISQHFERERQSTINEVGELVRNAMDKLIREQKDLESEYLTFRDNADLEWNVEGQAINPYR
ERQFQLQSYRTDLEQKKRELNSDLRLAINTRKLHSDPVLVAQIIGHLGSVVNEFEPLRQIVGPGNAAPDDLTLKKLEVER
ALIPLQIKRDQLELAYGASHPEVKSIAMQIESSQNKLNELNQQMSERIAELRAQSQRVDYDKEAREARDERARMAVDAYI
RGLEAQLTVLAQDMSDIDLQIEQQKDEADKLKIVEERDASFNRRIETMRGLETQLEQQLAALNLADVKGGILVEPLLDTG
QAYETGPDLKKDLVLFGMLGLGLSGLLAMIFESTAKMFRSAEEVQRELRLPVLTHIPLDEGRIQQGKGLVDSEIAKLDPK
LSVVHRPYSPAAEAVRGVRTAMLFDRRQYNSKVFQITSPLPGDGKSTLAANVGCSVAQSGKRTLLIDLDLRSPRLSLRFN
LEAKTGLTNVLNGELGPAEAIHQSPIENLDILPCGPLPANPAEALTLAELAEVFQWARENYDFVIVDTPPLLMVSDPAVV
TTYVDAAMLVMRIRRRCKPNAKEAISMLRAAGARVMGVVVNEIDDVSGGASYKSSASGSYQSIGYGYGDKYRRRYQQEAK
TQDTYVVKGRHASDPVSVPAAPVESGDPPGTYEGEIADPEFTDPEFTDRKITAPDAAPFAPKVAPDRRRTNVRS
>gnl|bykdb|A0A2A2WFP6 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Rhodopirellula sp. SM50] (length=842 residues).
MLEQLPPHVHSDTGHAMERDGGRLQGEAIGTVLWRYKWLIGILLPIGTLLGYWVNRHKPVTYRATTRLMFKTDTPLTLDT
STGLVRGGIPSGNLMQSLISSDAIAGRVHLSEQLRSIPALRELTDDQFVALVRRGIQFQTITDLKDSRDRLIAAVHFDGH
DPEVCVAAVNAVSDSIRSHFQEERELRVNEFEQLVSQAQEKLLPQQAELEEAYKSFRESAPLEWDPNGQVVNPHRHRQFQ
LQSFRDQLEQKQRQLDGELRFAESMRSRHKNPLMVAMIIGQLSDVFEDSRLMLNGKSTDSLATDDLEMQKIEVEKKLVPL
VIRREQLEMAYGRSHPEVKSVAMQIESSQSKLNGLIAQVDRRRKELSEQSQQGADADGSTQAQVVRAGEAVDAYIRGLSE
RLRVANEDLAEVDRKIEAEKLAADELKKFEDTDASFRRRIASLQGMLIQLEQQLAALELIDINGGILVEPLLATGKAHRT
GPDLKKDLAVFTMLGLGLSGLLALLFEAGAKTFRSAEAIQQELQAPVLTHIPFDGGRRQNRKQMPTNSIARLDPKLAVIH
RPHSPAAEAVRAVRTAMLLDRRQTDSKVFQITSPLPGDGKSTLAANVGCSIAQSGKRTLLIDLDLRSPRLSLRFNLETKI
GLANVLNGELSAAQAVHQTPIENLDILPCGPLPANPAEALTLAELADVFQWARANYDFIIVDTPPLLMVSDPTVVTTYVD
AAILVMRIQRRCKPNAKEAVAMLRWTGSRVMGVVINKFTAPRSMASYQSSASGSYQSIGYGYGDRYRRRYQREVNAQDTY
IVTGTKNLERVDLVAPSNSSQPGKPHLRQVVPQDSASGPRPL
>gnl|bykdb|A0A2D5GZ77 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Gimesia sp] (length=790 residues).
MNTDFQPLDQQSDFGIDGMEENAEVNSSGPGVDIVRLLLRNKYLLVLGLATGLLLGQAAYMKLGPIFSANTKIQVSQKNP
VPIKDGEIQTFGELTAHIDVIKSPRIVGEAVKEAKLNQLSTLAGEKDPTQDIIDSLKVKRISGNDRAFLNILTLTYENPN
AKDARVVTQAIVDAYKRYLHEVREENTEDIIQQLKQAEKQIATELKLKKSEYQKFRENAPLYWESTPGSEAAVAGSTNVH
QERVKAIDNERRLNLLKLTELKSKIDSLKAAIASGESKETLELLAQQFLMGQTRGQAANGNTSEGQIASPGTSQVDRART
ALETHLMPLLIQKNRLERDFQKNHPDLDAVNRSIETIINLYRRQGLDISADNLESGEFQVAKTKDVDFVNVYLKSMEQQL
KELENRELELTKIFDQETELAKKVGDFQVVDQSYNEEIAQLKSQRDNIFKQLLVEKVSQGNSGYTLTQLAPVKDELVIKR
QLKFLMAGAGAGLGLILAFSYFREMRDTTMKSVDEIRNQLHLPILGEVPSFAESDAVVDDSEFAPALWYYYRPASREAES
FRSLRTSLLLKTDRSGAKVLQMTSAEPGDGKTTSISNLALAIAQTGRKVLIVDADLRRPTIHKLFGLANSIGLGDVLNGE
IDAQTAIRETRVTHLSILTAGMLPENPSEMLMSRGFSELVKQLRNEYDYILIDTPPLVVVSDPSVIASIVDGVLLVVRID
KNRRGVIRKVQQIIQTNGIKVTGLLANGVQSGKFGDYDYGSGPGYSDYYIVPPQVQTKQADAPAKTKLTH
>gnl|bykdb|A0A2D6A9B6 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium] (length=250 residues).
MSEPETNPALTDGVLVIVERTVNPYLVCFHEPNGFRSEQIRALRNRLTVMNPDGSARSLVITSAIQGEGKTATALNLAMS
MTELQDHRILVLDCDLRKPSVETFLGLNRGPGLADLLQGSTSLDEAIRPSGIPGLDIIGAGSRPKNPSELAASRRVDELL
GQLKEQYNYVLLDTPPIVPISDAGILSAKSDGTLVVVALERAARRMVKEALEQLESVGAQLLGTFVVGIRGADPATDERY
RYTWDGEAKE
>gnl|bykdb|A0A2D6SRY7 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium] (length=446 residues).
FELVGLLRKSEVNQDLYTRLLQKYEEARIAEAAEVGTAQLVDPALPPGGPFRPNTSVNVFLGALLGLVLGIAQAFLLEHI
DNSVHSVRELEKAMGLPTFGLIPQIPEKPGSGPSLAERGRRKRVRPDRLISSMELGSIAMEAYRCLRTNIQFAAPDTKTP
CYLVTSAGPGEGKSLTTSNLAIAIAQLGRRVVLVDADMRRPVLHGLFGVERGPGLSEILVGNATWQENLRSTSVEGLHVL
PAGQSPPNPAELLASERTRTLIRELSDNFDLVLVDSPPALPLTDASVLSTEVNGVFLVVRAGMASLEAARRAKASLQNVG
ARLLGVIFNGACVQEGLGLPGHYRYSYSHYSHYYHETDDDGEESTEFGWRRWLLKCRRALSSQRGETWAASAKGQTTDPQ
TTNAQIADPQAAALVTTTDPQTTDDETDEETDDETTERSRIVRSSS
>gnl|bykdb|A0A2D6ST10 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium] (length=760 residues).
MDHTTRTSDTSAPAAGNETNGANDNGTLSVPAPLVLPLSVVNAADGEEATVNFHVLWGAFRRRWLLASVLGLIFGVAAAA
AAWELLPAPFTATAQVRINSFDPFFFFKVDNQTPRFETYKQTQMILVRSPLVLMAALRSPELAGLSEWTDPGQNTQEWLE
ENLEVSSRASEFISISLSGERPTELKDTVNAVMGAYLQEEVAGAAAARRERLTKLENLFAKRRAELETKRRRTETLSEQT
GAITEGQRDWKYQNDLAIQRSLIAEFRQVKVQLINLRFDQTHLENDKASGQPAEVPDDVLEAALSRDPQYAAASKKVAEL
ERRVQQNDVELSETHPTLVKFKKQLADAQKHQQELQEELKPQIAQQILGGMAASGEMSNLERKKLIGDLLAWQAELEKKI
DEHKTTLTKNNIFNAELNRLDQDIAQDGALIDAIATQIEQIEVEIENSPKRIMEFRKADAPQRRDQKKKITGAAAAGFGV
FGLFVAAIVFLEYRSHRISRLEEVVDGLGMRIVGNIPTMPRASSRRPTGDNRGKTAFWNSVLSESIDSARTVLLRDAKVD
SLKAVMICSAVGGEGKSTLSCHLATSLARAGRKVLLIDCDLRRPSICRVFDLPQIPGVCELLRGESSLDDCTREVAPEGL
SVIPAGKIDHTVLRLLAEDAVGELFENVKKQYDFVIIDSAPVLFVTDSLLIAQHVDGVLFAVRRDISRAMKVASAQQRLS
MLGVPMLGAVVIGLDRDSYGYNSRYGRNYQSYQQYRQYPR
>gnl|bykdb|A0A2E0AW64 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Blastopirellula sp] (length=751 residues).
MNLSTSQPPPLNSSTESESAAQLSPMLVLEAARRWWAIATPVGLLAGLIVAAILYLQFEPLYEAKALLRITTPISFDGSK
NKADRSFLANQFAVLYSVVTLEPLLADKEIATIPDLVEADDPIAELKRNLSIKSAYRDSNQWYLTYRSTDPQVAAMLANR
IYESFIRTKGDFDVSLRSALLSRLEELRKDKEDDVDRLRQDFRNEAIRNLNWDPYAVAQTESDPGASALSYEKQLAKLAI
DQAIVQYQIERAQGIHQKVEENLNAQSESIEISDTDLATMVDQSADMLQHNEDLARAQAAIKLLRKELAEIEQIAAGDPA
NLPRYQSAQRQIALQQEQIEKLDAARQPLRESLMEVARKDRQGAWKTYQQEVISRQKEEVARLQEQTEQMAIEERVVTEK
YQAEIEEIQNAKGRTFDMVQLQTSLERAEEQALAFQDREDRLRLESKNLDSITLLKSASPPVKPAVIAPWKNMLMGGGIA
LLIPFGLAVLWELRVGRITDSKQIEKQSQLPVLAEIARFPSHADGQRHSRRVTRQLRLFEESVHHLRTSLVLSRPLEDIQ
VLAVTSSVSGEGKTTLAAQLAMSIARASGQPTLLIDGDMRAPDLYDVFEIPNQPGFADLLEDHNSLGGYVTKWDEHCHVL
PAGQLTSSPHRLLANGAFSGMLKEARATYKHIVIDTPPILAAGESMVMAKAADATILCAKRDVTRMEQLKKSRERLKGAG
AEIVGCVFNDVPPNRYSYRYGYYGYEDHGGI
>gnl|bykdb|A0A2E0SHG0 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomyces sp] (length=802 residues).
MPTAPLPETLSSQSPLHGILDVLSILRRRIGIILFFVVVGVALGTLGILQLKEKWKSEAQIHIIRRDPNLATEAAESTSP
GDFRRMEDELANQMKIMSSYKIVSAGLESGLEEDGKPVNLLTCPSLLEEVKEGETVVDYVIQHLFLSTQGEEGNVAVSGG
HWIYATFEHTNKEDTPRVLQAILNAYQDHVEETYRNPVNDAAENIRADFKKAEEEWESIQAKYKNFVESSQFYTSDSDSV
NVYLNTLNDYETQLRLLQFQRYASESRLEIIKESLKPENREKYNDFQRLALISAESVERMGLILSVENLGVQIATNTATT
EVSQANQILRAKTADTEFDTLVSARLSLAERQSEFGANHPKVREAEENLRDLEMLLDRSKEEIPDPSATNPEPIEPIQLV
SAYVTQLEKDLEDIKQREEMLKQYRDAAESQAKLVANFKLNQELLSDERELKKELRSVSIQRLNDIALLEDYDLLQVHSM
GNLNEVRSAKTSLLLGILPGAFFGFIFGGLMAAVIDLADSTFRSPEQIRETLRSPVLAHIPRLNVRRITKLADRGSRLSP
VLVTHHIPQSPEAEIFRALRTNLYYGTHGSTPKVVQFTSPNPKDGKSVTTANLAISLAQTGKSVLLIDCDMRLPMVDKLF
GLDTSVGLSSVLRGEAEIPDAIQETEVENLTALPCGPVPENPAELLNQESFSRLLAVVREQYDFVVIDSPPLLVVSDATA
VAPRADVVILNLRFKKNGRPEALRAIEILNGVAANILGVTMTGYDSQSGGYYSGGKYASYSAKESRSYYTNYTKTAARKS
KA
>gnl|bykdb|A0A2E0X6Y6 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium] (length=779 residues).
MNSELDSNLAQEGPASSEIVSAAMRFLRLIRRRQNVLLVALALCSAVGAAVYIAAPRYYASTAKLLIIEQKSDQLASVND
ADGSDNTMATQREIVVSPVVLRRAIERLAPEDRIDLVDEAPHEWIDRLAALSSSSVTRRTNLIDVKFRSKRPDTAAAVVR
AIIDSYLEWVRDTHQGAAGAEKRRLTEKLARREQELEEFEAGLRALRRQVGHLAVSSKDGLTDPIIQQALRVNEMLMDAQ
QQRLQLQATLAAVEEAVATGADVFQHLAGLEESVAAQMLQMTLGISEQDMTMLAEQESRLLKTQEELQDAVNYYGPNHPR
ISELKRQEQTLIAYLRDYRSNLGNRFAGGDSGEAGEATLKMLRQALAEAQRREQRLTETFASARQAAAEHSGHIVEIERL
EGQVEWTKTQREAILAQLQQVESLAGQAPIKASVVREPLPDPRPVSPRLKMVVVGALAGGLFLGSLIIYVQDVLDDRFGS
PEEMAAQLGVGVLTVVGNLKTLVGEGFDLVHAYVSPNKPETEAFRTLRTALTLSPQAHSRLLVSSSEPSDGKTTVALNLA
VTFAQAGRRTLIIDADLRKPGLTTRLSLKRDAGVAELLLADGEIADNAPRFVQKTVVERLDVIPTGLRRQNPAELLGSVR
FAELLAWAEANYDQVLVDCPPVLAVSDAQVVGRLVDGAVIVVRPDKNHRRMVIRAVENFAATGCHIFGVVANGVTADSNG
YGYGYGYGYGYGHDEDETDGFEEDSPVGHDDLTLAINGRRTADEDHDGHDAPIRPRRAA
>gnl|bykdb|A0A2E3Z6T8 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium] (length=490 residues).
MHYGPNHPRIIELQQDVRSLDQYINNYHSGAGDRLEAMGKSIPKEVVVNLLRQSTQQAIEKEKQIRQAYQQARAEAAAYS
GSLVQFRALERAVARDEAKSDILTDKIANIDFRQNQAPIRATVVREPIANNNPVTPQIRLIAAVCLLGGTCVGVVMAYAQ
DVLADRFNSPEELTLQLGVPVLAMVKKLDALNGENLETIHTHACPNAPETEAFRTLRTVLSLSEQNCERILISSSEPGDG
KTTISANLSVALAQAGHRTLVIDADLRRPGFTTLMQLKGQPGVADLLTSPETPAQSAPPLIHSTIVKDLDVLPAGLRRPN
PAELLSSKAFIELLAWAESKYDRVIVDCPPVLAVSDAQIVGRLVDGAILVVRPEKNHRRSVMRAVESFHATGCHVFGVVA
NGLSSDSSGYGYGYGYGYSYDGGYSHEEEQDMVDTADTMMTPMPEIVQLPSIASEEHLPSASPQEHQSHETPFQTKSANS
TTPLKPRRVA
>gnl|bykdb|A0A2E6AG00 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium] (length=768 residues).
MTRQSTSSVSNLLPTTGSHVLHNAMWLVRSVRYRKHYLIGALVASGLVGAVYFFTADRIYEASSQLLVQQMSPVVASGPI
GQVGXXXGMLPTYEKLFASAVVLNGAIXRIVEMPTDLQCDLKNYPREDWVRXLREQXTVRSFRSTHIIEIRYRSQRADAA
EAVVGAIVDACLEFMDEYHRNVASEVVAILHKERKEVEQQLVTRDRQLLNTKRSLGDLGMRDASNSLHPLVQRVVQINDS
LIEAQQKRIRLQATYDAVQLAMREGRDLRQYVTAVEPVVGREVMLAALGLNQHDVDAVAELDQQLVADRTKLANIRVHYG
DRHPKVQDXLKSIRDTQNYLENYQQSVADRAERTQAEQLQSFLXGMVKQEVDQASAHESQLKIEYVEARDSAVQXHXQIE
ELAIAEREVERLRSLHHTLQDRIANIDXNQNQADVRVEVVSDPKGRQTPVSPRLANVFVXSLLGGTLIGIGLVYVIDALD
DHVRSPDELKDQLGLPILAMIRXLPSTLATTGVNALHVATTPDSVESEAFRTLRTTIAFAGDDLKCVAVSSSEPGDGKTT
VVANLGATFAQANXTTLMIDADLRKPGMTRLFELRGQEGLSDLLRSDVDVRDRAASLICKTSCECLHVLPSGSRPLDPTG
LLASNQFGELLAWAEARYDQILIDCPPTLVASDAAIAGRIAGGLMLVVQPAKNHRRSVFRCVEETRSVGVXVVGLIVNRL
TXXEGRSYYGDSYGYGYGDNEGDXEPAADSSSSFSVXATPSQQIRRAA
>gnl|bykdb|A0A2E7D3V4 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium] (length=780 residues).
MDNSENRPVERPFEFAVLSENSDKPKVEFDVVQIALRHKKIISIGVICGLVIGHLAYKQAGPEYEATVKILVSKKADVMD
KDNLADTKGAGGRGEHIALIMSPLIVGAAIEEAGLDGLPSMLTSGDPEEDIVDGLKVERSAGHDRSLLNVLDITYKNRNK
DDARQILEAVVDAYEAYLKNSQQEHNSETRELIDEANVKLEAQLQAKMAAYVDFRQSAPLQWKRPPGTESSPADVVNVHQ
DRLEAIDAERRKNLLEREDLQSKIAVFEEAIASGQSMESLTMLVKFYISTSEKAVAPQTIVTGLPGQENTAQLLPLLIQE
QRLLRDLGADHPDVQSVQSEIALVKAYYRQQGIPIPGADVVPGADKKTPKSADANLVTTYMASLRQQWKALANKNVRLDS
LYDDEAKKAKEFSKFEAEDQKFVEEIARIKSLQAVIVKRLAEMGLVAKNYGYKLKQISPVRDQLVFKRKLKFWFMGLAMA
MSAVGAVIYWREWRDTTLKTFDDVRQSMQFPVLGGVPEFAAISLMDQMLYEQSPLQPSLCYFHRPGSSEAEAYRSVRTAL
FVSGSGRSQAIQVSSPEPGDGKTTFISNLAIAIAQSGRKVLLIDADLRRPTVNQLFGLPQDIGTCDVLLGDIELPNAVKE
SGIEGLQILTAGTPVGSPAELLSSARMASTIEAAKAEYDFVLVDTPPLLAVSDPCIVAPYTDGLLMVVCVGKNKRTTTRR
AADLLDTHNVEVLGVIANSIEQTQGNSYTYSGGYADYLAPSEQSLELQREAQQPTAQPVA
>gnl|bykdb|A0A2E8ATT1 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium] (length=775 residues).
MSRDSHYNEQNSTSEAVRAVLRFLRVIRYRKSYLIVALTTAVLLGSVYYFTAARIYEAKASLLITQSSPDVWNGAASSEV
GRHGLIPTYEQLFSSAVILNGATQRLARLPAALRVDFLSVPRDKWIDVLRANVSARSVRNTNIIELSCRSRDPAAGEAVV
GAVVDSYLEFIERNHKDVSVEVVTILEKERQVTEAKLEQKKRSLLELKRQIKDFGLREGSIHPEVQRVLQLNKAIMEVQE
ERLQLQASLTSVRSAVRSGKDLRQHLINLEPVVGDRLISSALGLSPLSSQLVNDMERKLIEDRSKLAMYRGHYGPNHPQV
RQLQHSLQLAQAHREEYHAKVQKHMEKVQERELGPLLISMLEEKLFEAWTFEKGLLKEYQALEESALTLNDDMAELTITE
RDVERLSRLHDTLLERISNIDMTQHRANVRVSVVSEPAASRMPVSPRLAFVGVLCLTFGLGGGTGLIYVLDLLDDRFRSP
EELQEQLELPVLAMIGNLEVGNELGLGALQVHASPDAVESEAFRTLRTTLAFSESDTECIAVTSSEPGDGKTTVLANLGL
VWAQVGKKTLLIDADMRRPGLSRLLDMRGTSGLSDVLRGEGAVGEICERLVQSADVPHLDILPCGPRPADPVELLSGTRI
VDLLGWAQSRYDQILIDCPPIMAASDAAIVGHLADGIMLVVQPEKNHRRVVFRAVASLLGMRNKVIGIIANRIQPQDQRG
YYGYGYAYDYSSPEDENEQISTSKPAAGTPQEQVSPDPASKPSGAKKRVVPRRAA
>gnl|bykdb|A0A2G1WDS1 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Rhodopirellula bahusiensis] (length=856 residues).
MTPNSNSTDSTAGKRGPNSFVSYPSQNAGTMGQAAMGSYPAMNEGWGSSGSAQTAESADLMGAIWRYRWAALVPTILGAV
IGFLVFVKTPETFQSGTLLMFESDRPAVIDTMTGDLIGGVPSIDILRSQLLSDKVTRNAFENESMEVFRESLGGHPSALL
GLANKALKFETDIQDARSASSLVASLTFEHSDPELCEASVKAYSAALQQLFAEKHKSSRGELLRLIRDATDNLQPKLSEL
EKDYRAFRTKASLVWNENGEAINPHRERQLYLTGRRSELFETLRSQSVELSAVESIAKEAEDPLVRLSIIGQLMGKTFEM
PESNQISQNMRDGDAELAQIELDQQLVPLMIERNKFAAEFGEQHPTVKALDAELSMMKRELKRLVKEQSERIVELMEQNK
VEGVDPRKRAEEAVNVILTASRAEVQLLKQQISEIDSQIADERIEAMKLAQDEQENASMLRQIDRNRELINQLDEQMARV
ELTEEEGGIQVSELRAPSRAYRTGPNLVKMLGIGTFLGLALGCGLAVLLEKNANTFRDPEEIIAAVGAPILTHVPFFKGR
VKRKKGEASNPFELLDPHLAVVHAPSSVASESIRSCRTSVLFELAGVEGGKVLQVTSPLPGDGKSTIAGNLACSIAQSGK
RTLIIDCDLRRPQVTDNFAMADQLGLVDVLNGKCEHVDAAHDTPLSTLKMMPSGPIPANPAEALTLPEMSELLDVLREEY
DYIILDTPPLLVVTDPSITASMTDGVVMALKVRRKSKPNAKEAASILANVGAKLLGVVINASDEGANNDGYKGYGYYRYG
RHTNRYYRKTADNGAKAGQRRSPVVVSGRGGGARSARPIAVPPTVTSSTDQERSDV
>gnl|bykdb|A0A2G6JGH3 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium] (length=252 residues).
MSEEPQEERANDEERGDATPFVLVDRVVDPYLVCFHEPRGFRAEQFRALRSKLLVMNPERAPRSVVITSAIQGEGKSSSA
INLALAFAELEDQRAVLLDFDFRKPSVETLLGLNQEPGLTELLMGRLALHQAIRNSGVESFDLIGPGGMPTNPSELLSSR
RIDELIARLKEEYSLIILDTPPAIPLTDAGVLSAKCDGTILVVGLERAPRKLSKEARKQLVESGAHLLGSFVVGVRGADP
SKDPRYGYSRGE
>gnl|bykdb|A0A2S8F9B8 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Blastopirellula marina] (length=810 residues).
MTNGNLVIPSDRDRHASKADVPGAVIGMRPPEENGMQFGQVLHSLRRQWLAAVVLGLLCAAPIAVGAWLLQSPTYTSSAY
LRISASEQPLAFRTVEQAGRDDYRTFKSTQRQLMITPFVLNKALSREDIMNLPVVRENENPLEWLQEALVVSFPGDAEIL
QVSLTNADRQAAMKLVNAVVGAYKDEVIESERLARVQRLENLERVYNETETKARQKRSDLRQLAETLGTSDSETLSLAQQ
GSVQHYGLVRNELAQVRFDLMRSEGELDFLTSSNKAKMEAQAVAGNATAEPGKQENSGTGQTPAEDKGNSANSSGEEDAD
GSSDASEEIDLESIEYSETEMNEAIASDPISVKLQAELERFEEAKYTLTPAAYERYRQTNEAAISTLESRLEKRREHLVL
LIKERLAQQLLEGRSRQGSIANNGLVVPAEVDNSLPELRVHLGVLRQQEKTLAKEVAELENEVRTFGRSSVEVEMMRSEI
ESLDEIVQQLNAEIERTKIELRQAPRITLLSEAKLGVVSDKKRPLMITAAAAFAGFMLPAGLLLLRDFSKKHLSDLPTTR
DELGLEILGTIPKLPRGIVRKPKSLSVDLGSFEDQVRDSSDSVAATILRRAADQQCQVLLISSAMPREGKSSLACHLAIS
LAHAGRKVVVVDFDLRRPSMHAIFDCPISPGVGELLVNHVKLDEAIQPTNIPNVDLIPAGSSEQSIPRSATSGRLAELYR
ELRSLYDFVIVDAGPVLGAPSTRLLAQPQYADGVILSIFKDVSQVTLVEDAKRILTSFGAPIIGTVLSGYTSGMYYSYTN
RPTSTVEVEQ
>gnl|bykdb|A0A2S8FCC0 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Blastopirellula marina] (length=775 residues).
MSTDQTSLPVERTNREIRFDSPIDLTPGSSNEFPHINDVVEMDDTGGTGISHVFHAVRRRWLPAFSIGVLLAAVAATSVW
LLDVPEYTARALLRISSRHGTLLKQNGEANGDFEVYKLTQRQLIRGSFVINAALRDTEVLRLPMVEQEPDPVAWLQSALS
VNFPDNAEIMEVRLSGENSKAISKIVNAVVQAYMDEVVDAEAISRTTRLSSLERAYSETENDLRSKRSEFRRLADTLGTG
DTASLSLVQQNALQQFAALRSELTKVQLELLRARANVLGMEPREAPVEKDAVVAKKPVVDGDKEAPEASVANSDEESEEI
DFELERIMAADEVMVAFKSQIMQLENEILAIEQTAAPKIQNQYVSRLRDKISELEEQVSLRKDQLTKDKEQWSVATHRAE
LNKARSEVAILEQMEKQLDESVQLFEKEAKQFGRSSIDVEMMRTEIDSLEGILSRLGHEIENTKIELKSDSRVSVLQEAQ
PPKSKNPRSYAMVGVAGVFGFMLPVAGFVFWDLRSQRINVPSDVSDNLRMNVLGAIPLVPQRVLAQSRKNSKKQQYWKSL
IAESIGGIVARLFRQSGANKNRVVMISSALAGEGKTTLAGQIAYALAESGARTVLVDFDLRRPALDISFDIELTPGVTEL
LSGEVEFDDAIQQTGIGTLDIVAAGDWGHNSLRELTSDRMDSFFKSLRSQYDYVIVDGSPILPVVDARLIGQYVDGVVMA
VLRDVSRGAKVQAARDLLSVFGVPFLGVVVVGTTREDVYDYTSRRDRKKRLVHVG
>gnl|bykdb|A0A2Z3GYP4 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Gemmata obscuriglobus] (length=283 residues).
MADAAGNAVELDSGLATVHSAMSPEAEAYRGVRTALFFSTHGERHKVIQVTSPHMGDGKTTLIINLAVSIAQAGRKVLLL
DADLRRPRVHRAFGLTSRIGLAEVLTGTAELADAIQMTAIPNLSVLPCGRRPSNPAELLTTPAFEDVLDDLRAAYDYVLV
DSPPLLAVSDPCVVAPRVDGLVLTIRVTKNGRPAAERARDLLVRLKVNCLGVVVNGVGKQGAMAGYGYDYYRHADDYSAP
YTTADHDEPGMGEGQPLTPPARLSSEPAGHVEPVANGPAHAPE
>gnl|bykdb|A0A2Z3GZZ5 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Gemmata obscuriglobus] (length=752 residues).
MADTDKNTAAPPDDDEPASGLNPLHLVMRRWQFLAVGLIIGGVLGALIYSTSAPQYQSTAQVLVVKKGVEVTKEGDGRIV
EDHVATQVTLIKSEKIRLAAAAKARAAGGAGLPADDRAVADMIGTGLTVVRDKDSAGPTIGSGVLNLTLREPDPELCKRL
LEAVIAAYQAELYSIYEKASQDRIATLDRLLEAVKGQRKAAGEHRITHLTELRGITTEDVSSVRTRVSALRDQARALRTD
ISNLDAQVELVSRTGPAPEDRQLAFVQLTAQYRAPVVPNAANGGELTGTAALRALEFERRELTQATGLGKDHPRVLAVDA
RIAVLKEELARPPAAGGPVLDELGAHILWVEQKRRTAGRQLVQLEAQLSKDEETMKRAGGLLDLAEAMAVQSQHADAEIM
RLEAERLARQATLGAGGYSAEQITRPGSGHKVAPVLLRSLLLGLGIGALLGCGLMVLAETRDKSFRSPAEIRRRLGLAVV
GHIPRIRTVPALSLEPATYDPLLVAALRPKSSEAEAYRGLRTQLYFSTQGRGHQVIQVTSPTPGDGKSTLAANLALSVAQ
SGKRTILVDCDLRKPRVHKLFAGADATGTGLAEVIAGVRPLADGIVASGAPGLDLLPCGPRPANPAELLGSPQFQRVLAE
LRERYEFVIVDSPPLMAVADPAIVAPQADGVLVVFRMTKTARPAAERAREVLAGVGAHTIGVVVNASGDEGRGYGYGYGY
GYEYKYTSYKYSDSYNTDADEDGARLVPAPTR
>gnl|bykdb|A0A2Z3HEL7 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Gemmata obscuriglobus] (length=749 residues).
MARPIAGDPPASPPPAPFPTPGGVPAPVAPSPFSYTNQPSLPGPTVSSAPTPSGLWNAFRRRWVLSTFVGALVAAAVAVG
AWLAMPAGKHQVRALVQLQPQHAYITNKGQEDFEWYRRRQIYLLTKDRDLFNRVLADPAVSSLALVKTADDPVAMLEDAV
RVSVAAPEMLEVTLTGNHLDDMKVLLDRLIKRYLDDTNAFDNRSRTEEREHLRNRRSEVQNEIAQGERVIEFTARNLGVN
GTGDANGSTQLLHIKFGELDRMFTAANHELGDLQSQLSVYQDQLEERKRDPKKFAADTQLLKLAVARDKRVVAANELWQA
ANDLYTKELKNSNPENAYIQELKAAADKYKKALDDVQNQVTTEAETALRFSDLAERQKKVSDLADQIAIKEKVRNGLRTE
RDTAKKTIESTAGGGASIDALRKNLEPQRALLSRLDEQLLQLSTGEGRTRASARGEAEKIPNNNQNKKLAMSSVGGLGAF
LTVVLLISFLEWRTRRVDGVDQVVTELGMRVIGTVPVFPNRASLQAAVEAGGANWRFVLNESINSTRTMLLHTAKSQSMQ
VVMVTSATQGEGKTSISSQLATSMATAGMRTLIVDCDLRNPCVMKLFEVPLTPGVSEVLREEVDVSDAVQATAVPNLWVI
PAGQCSNATIAALAQGHPLETLFNRLRGQFDFVIVDSCPVLPVADALLIAQHVDGVVFSIMQDISQLPKVMTASEKLTQL
NIPLVGAVVNGIKQDVYSYGYNYVKQLPA
>gnl|bykdb|A0A350KD81 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium] (length=507 residues).
MAQQFLMGQTRGQAANGNTSEGQIASPGTSQVDRARTALETHLMPLLIQKNRLERDFQKNHPDLDAVNRSIETIINLYRR
QGLDISADNLESGEFQVAKTKDVDFVNVYLKSMEQQLKELENRELELTKIFDQETELAKKVGDFQVVDQSYNEEIAQLKS
QRDNIFKQLLVEKVSQGNSGYTLTQLAPVKDELVIKRQLKFLMAGAGAGLGLILAFSYFREMRDTTMKSVDEIRNQLHLP
ILGEVPSFAESDAVVDDSEFAPALWYYYRPASREAESFRSLRTSLLLKTDRSGAKVLQMTSAEPGDGKTTSISNLALAIA
QTGRKVLIIDADLRRPTIHKLFGLANSIGLGDVLNGEIDAQTAIRETRVTHLSILTAGMLPENPSEMLMSRGFSELVKQL
RNEYDYILIDTPPLVVVSDPSVIASIVDGVLLVVRIDKNRRGVIRKVQQIIQTNGIKVTGLLANGVQSGKFGDYDYGSGP
GYSDYYIVPPQVQTKQADAPAKTKLTH
>gnl|bykdb|A0A351FZ59 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium] (length=751 residues).
MNLSTSQPPPLNSSTESESAAQLSPMLVLEAARRWWAIATPVGLLAGLIVAAILYLQFEPLYEAKALLRITTPISFDGSK
NKADRSFLANQFAVLYSVVTLEPLLADKEIATIPDLVEADDPIAELKRNLSIKSAYRDSNQWYLTYRSTDPQVAAMLANR
IYESFIRTKGDFDVSLRSALLSRLEELRKDKEDDVDRLRQDFRNEAIRNLNWDPYAVAQTESDPGASALSYEKQLAKLAI
DQAIVQYQIERAQGIHQKVEENLNAQSESIEISDTDLATMVDQSADMLQHNEDLARAQAAIKLLRKELAEIEQIAAGDPA
NLPRYQSAQRQIALQQEQIEKLDAARQPLRESLMEVARKDRQGAWKTYQQEVISRQKEEVARLQEQTEQMAIEERVVTEK
YQAEIEEIQNAKGRTFDMVQLQTSLERAEEQALAFQDREDRLRLESKNLDSITLLKSASPPVKPAVIAPWKNMLMGGGIA
LLIPFGLAVLWELRVGRITDSKQIEKQSQLPVLAEIARFPSHADGQRHSRRVTRQLRLFEESVHHLRTSLVLSRPLEDIQ
VLAVTSSVSGEGKTTLAAQLAMSIARASGQPTLLIDGDMRAPDLYDVFEIPNQPGFADLLEDHNSLGGYVTKWDEHCHVL
PAGQLTSSPHRLLANGAFSGMLKEARATYKHIVIDTPPILAAGESMVMAKAADATILCAKRDVTRMEQLKKSRERLKGAG
AEIVGCVFNDVPPNRYSYRYGYYGYEDHGGV
>gnl|bykdb|A0A353BE27 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium] (length=818 residues).
MSDVVLDQRNVNGQPSPVPGGAPEAQSEGSNFDFVQILWRWKWLPILGSIVGACLGFLYFSRLPETFEAAARVQVISSIP
APVKNPYFSGGQEVNRIDESMIIRSQAVLRLAVSLGRLGEQPEFVGLASEDIVSALQDVGSPLVIEPADKDDQTTLIRIA
YVSEDAETAAKVVHAVVEGYEKYLADEYKTVGEEIAQLMEGAHADLTKRMRELSESASQFKEANPDIVFIGDDVNDPYHA
TWETLHKKLIDIRSRKSEIDALTTQVRKSLNKGHSPESLMRLLAMVSGGGTASANGAWDLEVFRQEQAQTRIRTDEMSRR
LEQEQLNPLRIQLEVFSNQLGEEHPSVATLRAQVQGLEKQLEKIREGERLYKEELEKNGDALARKTGAEIRSIEERLEER
LLALEEQSEVFRLEEEELANQAERERRSSRELQGMLDGYRILQTDRDAVSELLTAYTEKLQEIDLMPKMGQRTLKRLDMP
NTGLFYGPKVIKYLVGGAAVGFILLSGLAVLMDLADRSYKNPSEISTDLGVSVLGHIPVMNLSKVKKSVEAVDPAVCAIH
HSKGRVAEAYRSVRTGLYFSNKGKALKVIQVTSPVPGDGKSTLSSNISVTMAQSGRRVLLIDADLRRPRVAKIFGIDSEI
GVAAVVGGKVEVDDAICAGPVANLSILPGGKRPANPAEILSSERFRNMIDMLRDKFDVIVVDTPPLLAVSDPGAVAGIVD
GVLMTMRLRRNVKPLALRAKSILEGVGANLLGVVINGVSSEAGYGYNYDYNDYRYAYKYGSNYRSGYGYRYGYGNYRYGY
SEYSDTQDLSVKQPGNPQ
>gnl|bykdb|A0A353Z859 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium] (length=773 residues).
MSTDQMNGQGAMVPVRRNEVGMPGPAVGGAPANSGIVVDQNTVLAAMRRRWLIATALGLTGALVGAATTWLLIPVTYTTR
AELRVKAVNYTPGGGLKQGEELRGEVYRQTLGRMVQGPIVLKQVVRREEVAKLPTITDQEDPLIFFEKNMRVTNPATEFL
QMSLTGNNPADLAPILNAVVEVFLREVAQREAQERTKIVNSIDAAKADTRAKLGDFIKTKERLVKKLGGDNETAAEAAKA
RESFYADIRKQSVMAKIEKTKINAELSLRERQEKIEGKDLDEQLIDLHLDRRNEVLSAAYTVEKEREALSRREGKGPASS
VEEYARRLREAEAKLKEVREELRPKVIEELKERSQLEEVLSTQALQRRLQLLEITIDGLDKQLVYEDESRNNKLAWQMEL
DELNKSIEQFRTIYNRLQEEGERARMTMSNLMRVEKFRDAVTPTQPDMAKKIMATTAVGGGLFGLIFLGILFLDLRTRRI
NSLDDIVTGLRLPVIGSVPLIPSSRGGKNSEGGGGQRWQGALIESIDSARVMLLRRASLENAKVVMVSSAVTSEGKTTMA
CHMGTSLARAGYRTVVVDVDLRRPTVHRVFDVAGDPGVCEVLSGAAKPADVIQESTQPNLFVIPAGILASESLRNLAQDG
LGALMEHLRAEFDFVIVDSSPLLQVTDPLLAAQSVDGVIVSIRRDVSQMPKVSSAIEKLQMMGIPVWGAVAIGVDQSSYG
YGYGYGYGYGYGYGYGYGYGNSYGYGYGNRPRSSAPAVPSESPSDQSSQPPLN
>gnl|bykdb|A0A354GX32 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetales bacterium] (length=753 residues).
MMPHDPNAMKTKTASPAGPITPAAASTEQAAPAPPGLSAPPGATAVWYAIRRRWLTILVLGLGLGSLGAAAAWYIMPAKY
TATATLRLNPQSPRGVNETSEDYTNLRSYLAGWVKSDPVLDATLKKQEVGDLSEIKAQGEGRVAWMKSAALVDDKTGLQV
LRLSLSGDQPDEMAKVVNEWAATCDSLYTASEEAKIKERIKQVLKNYQDGTTHLRNKKNELQARRDLLGLKDPLTLGKEL
DSTQDLLKTPQSQRLLLELDLAKSESELSILNERIKAPEKLTVSETAVEEALNKEMKDDNLTKAQLEGLVKDQADLAELQ
RRLIPADRENGPGVGQLRDRISLIQNLVTQKKEVQRPGMERQLRAKALDDLVNEAAKTKGHIEGDKNQLLTLGKKISELE
SQVANLRAGGQTAGKSNGDVDGLQAEVNALDAEVKKSGEELASLDSSLPVTPRLTVTEAAAPPMSPASDKRIKAAGGAFL
GLFGLVFLGVVATEFRTRRVYKSEDVSQGLGLPLMGTVPALSAKVRATAPVAGDQSMGPMIESMDGIRTRLLHAGRSETL
RVVMVASAVSGEGKTTLASHLAASLARGGRRTLLVDGDLRNPAAHKLFGMAAGPGFSELLRGEVEPGQVVQNTPLENLSL
LAAGACDHQALQALAQEGILRNVFDELKEQYDFLIVDVSPILPVADALLIGEHADAVLLSVLRNVSRLPAVHAAQQRLAS
LGIRVLGAVVIGEGMEAYGQVRYPTKAPQAPAQ
>gnl|bykdb|A0A354PCV3 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium] (length=375 residues).
RINQTLSRNQLETKLTVLRKQYEEEVARLEQFGGMTAELQFAQAELEVANDVLKKLRDRVAAIRTERRQDGAVRLLASAT
PPRTPVAEFPLKKMAMAGGAAMAVPFFFALLWELRVRRVTDSSMSGGLSLVGEVARMPAGTRGTKDRRIFQESVDTLRSN
LFLSTRWKGTRSIAVVSSISSEGKSSIASQLSVSIAKATGKTVLLVDADLRRPDQHRLFGVEMGPGLSGVLAGTTPLLDA
VNTSLGHLIHLLPAGELTASPHRLMSPQRLQAFMKDALNSYTYVVVDTAPVLSAGETLAIAATVESTLLCLMRDVSRLDS
IRQTTRRLEAAGAKIVGTVFSGVTSRQYAYRYGDYHYTVNDEDFGDVGIRASQDL
>gnl|bykdb|A0A354PHB4 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium] (length=375 residues).
RINQTLSRNQLETKLTVLRKQYEEEVARLEQFGGMTAELQFAQEELEVANDVLKKLRDRVAAIRTERRQDGAVRLLTSAT
PPKTPVAELPLKKMGLVGGAAMAVPFFLGLLWELRVRRVTDSSMCGGLSLVGEVARMPAGTRSTKERRIFQESVDALRSN
LFLSSSWKDTRSIAVVSSISSEGKSSVASQLALSIAKATGETVLLVDADLRRPDQHRLFGVQMGPGLVAVLAGKTPLLDA
VNTSLGHLIHLLPAGELTASPHRLMSPQRLQAFMKNALNTYTYVVVDTAPVLAAGETLAIAATAESTLLCLMRDVSRLES
IRQTTRRLEAAGAKIVGTVFSGVTSRQYSYRYGDYHYTVNDEDFIDVGVRDSHDL
>gnl|bykdb|A0A355GJI7 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium] (length=462 residues).
MLIQKNRLERDFQKNHPDLDAVNRSIETIINLYRRQGLDISADNLESGEFQVAETKDVDFVNVYLKSMEQQLKELENREL
ELTKLFTQESELAKKVGNFQVIDQSYNEEIAQLKSQRDNIFKQLLVERVSQGNSGYMLTQLAPVKDELVIKRQLKFLMAG
AAGGLGLILAFSYFREMRDTTMKSVDEIRNQLHLPILGEVPCFADSDAAVDESEFAPALWYYYRPASREAEAFRSLRTSL
LLKTDRSGAKVLQMTSAEPGDGKTTSISNLALAIAQTGRKVLIVDADLRRPTIHKLFGLANSVGLGDVLTGEIDAQTAIR
ETRVSHLSILTAGMLPENPSEMLMSRAFSELVNQLRKEYDYVLIDTPPLVVVSDPSVIASIVDGVLLVVRIDKNRRGVIR
KVQQIIQTNGIKVAGILANSVKSGKPGDYDYGSGPGYSDYYIVPPQAQAKQADVPAKTKITH
>gnl|bykdb|A0A356AE44 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium] (length=545 residues).
NIHHQRVDAIATERVKVELLYEEISSRLSTLKAAIERGESHEALMLLVKTFLQKDQTSNSQTVVSGATERQQLDTQLIPL
LLEEQTALKRYGSGHPDVINVRKRIDLVKSYYRQMGIDLPTMTTKVNPVTGEPELVTGNDPIATYVVALEQQQAELKNRI
GELQKLFDRSADQAKDFAQYEEREQTLSDELKRIKSLHDIVANRVEVLSLASDEGYQLTQISPSRAEPDIKHVIKIVGGC
LVMTLMSTYAFLFLREMRDTSLKSLADLRAIVDTPILGTLPSIANPAKNLQAARETGLAPMLYYYHDPGSPEAEACRSVR
ATFFVRAADVDAHIIQFTSSEPGDGKTTTISNLGISIAQAGKRVLLIDADLRKPMVHQLFGMREEIGLSECLSGEIEMAN
AIQDSRIENLHILSAGAIPAKPAELLSSSKLHYLLGQAKREYDFVLVDSPPVLAVSDPCITAQSVDTVMLIVRLHKNRRP
SVKRALEIFEAHEIPLLGVIANGLQDGSGDYQYRGGYGGGYDKTPYQQNNDIPEFLAPTKTIIPS
>gnl|bykdb|A0A356ESF4 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium] (length=365 residues).
MTELENKERDLKRLQTWNEQLLNKLTDLNIRRDGQEVRIEVVQEPQVASAPAIPDRRRVALLALAAGLALGLLAVHVLDT
LDDRFRGIDDLQNQLRTTVLAVLPKLRVANGAGIDSLQVHVAPDTRESEGFRTLRTALALRDREARRLVVCSAEPGDGKT
TVLANLGVSFAQAQRKTLLIDADLRRPGLTSMLDLRGAEGLSNLLGGNGKVGAAAAAVIRPSGIAGLDMLPSGPRFANPA
ELLAQPRLAELLAWADKVYDQVLIDSPPVLAASDAAVIGRLVDGVVLVVRPEKNCRRNVLRAAETFATLNVPLLGIAVNQ
VKAESRAGYYGYAPGHAYDYADSRGSNDDPGEQKDHFEAARRSAA
>gnl|bykdb|A0A356ETW1 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium] (length=571 residues).
MLPSGDGKEILDPATKRALYFADELSKIERKRIDLQPTLARVQTAVRNGEDLRRHWITVADVVGQEMMMRSFGLSPADIQ
TQASLEQTLLADQALLESMRGRVGMSHPSMIAQQEKVRLAREYLQRNQERAAESISRLQNEQLGPLLVEMVRQQLREAVE
QEQSLRVQFQAAQADASRRTGQIARLTMLQREVKRLYDLSDALVSQIASLDLRQDGHDVRAKVTAPPVANHRPVSPRLAF
VALVAIVSGLGIGFAAVYVLDVLDDRFRDIDDMQQQLGVPVLSLIRRLDVPETSGLEAIQLHVAPASTESEAFRTLRTAL
ALADRELNRIVVTSAEPGDGKTTIIANLATCYAQSNKKTLLIDADLRRPGLTNLMQMRQQEGLSTVLRSNAHVADLCVAL
IQPTGIERLDVLPSGPRPANPAELLAGPRFLELIDWASTVYDQILIDSPPTLATSDSAVIGRLVDGTILVVQPEKNHRRA
VIRAVEGLLSLRIPLLGLVVNHAKGEERGGYYGYGYGYGYEYNGGYGNDEDDYADDVESEVTTATPRDAHFHDTDPDEGG
RPGRIVPRRAA
>gnl|bykdb|A0A358MY60 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Rhodopirellula sp] (length=747 residues).
MDKVKSIIDQQAVPALPRSGAGQPMPQPAADSVNFDPRVLVSTWRHCWFWATPLGVALGCAAAFTVYASFVPMFKASHML
EANQDYIVFENVLAESSNLEATEKQIILSDIVLDDVVSKADIQAVGFSDPVQSVNTIRDGLGIETAGTQTLLRITYADPD
PNIAALVCNEVAASFLEQRERLDNRRVIDLESWLTPSIDLWKAEVQGHERRISELSKSTLGFDPNNPVESLEYDLSTLSN
LRKEVQDMRVQESWLETAVTRQLDTNATPFNLNEELLVPEPTNADIKRFVENSQEVTRQRGIVAEQETILRSLEKNGLKN
LRQEYYNEVSRKVTEAEKKLASAREAAEAQAVKAISDDLRQAAERARTIASKKAVIKTKQDAVNAKEELAKLKARRALLE
VEYDNERARLQQKGGNAVELLFAKEDREIASQLLGMMQQRLAAIKIERRRGSGLHTVDAAKPPTRPVVPLPFKNMILAGL
LGLAAPFSLGLLLELRAKRVSDAETLTAGNLAPFGEVAKLPSKVGQGKRQRVFEESIDTLRANLMLSKQTKDARTVTVAS
SMSGEGKSSVSSQLAISLAKACGETVLLVDADLRSPDQHDIFGLEMGPGLAGVMAGDANLADAVDDTLGELVHVLPAGRM
TLSPHRLLSSEGMRTLLDEALQNYKYVIVDTAPVLSAGETLAVAAQTDATLVCVMRDVSRSDAVLRSSKRLEAAGANVVG
TVFSGVPSRQYAYRYGDYRYLTPKIDT
>gnl|bykdb|A0A368KP63 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Blastopirellula cremea] (length=803 residues).
MSNGNLVIPSDNNRQAASVNVPGRVVDVRSSDEDSNRMGQVVHSLRRQWLASVVLGVLLAVPIGVGVWLLQAPKYSSSAY
LRISANDQPLAFKTVEQAARNDFRTFKNTQVQLMITPFVLSKALGKDGIINLPVIAENENPLEWLQKELQVRFPGDAEIL
QVSMSSADPTTAMKIVNAVVGAYQEEVIESERMARVRRLDNLERVYNETEAKARSKRSDLRTLAETLGTSDSDTLSLAQQ
GSVQHYGLVRNELAQVRFDLMRAQGELDFLTSSNSSSQAADKAQAEPSKEVEKTVSGENAALPVGSDQALVADAATVEGE
QSEEIEPQLSEVEMNEAISSDPISVKLQAELDRFEEPQYTLTPAAYQRYRETNSAAIKSLESRLKERREHLELLVKERIA
QDLAAQAKGEIARKGSSILAVPEVDNTLPDLRVRVGVLKQQEETLAAEVAVLEKEVRTYGRSSVEVEMMRSEIEGLDSIV
QQLSAEIERTKIELRGTPRITLLSKAEPGTVTDKKRPIMITAAAALAGLVLPGGLLVLRDFQKKRLSDLPTTRDELGLEI
LGTIPRLPRGITRKPKALAVNLGPFEDRVRDSSDSVAATILRRAATQKCQVLLISSAMPQEGKSSLTCHLAISLANAGRR
VVIVDFDLRRPSMHRILGLPIGPGVSDLLAGQAELADVVKATDIPNVSFLPAGVEEQSISRGATSGVLDAILGDLRKRYD
FVIVDAGPVLGSPSTRLLAQPQYVDGVILSVFKDVSQVTQVEDAKRVLTSFGAPILGTVLSGYSTGMYYSYTARTKSTVE
VAK
>gnl|bykdb|A0A3A0DR44 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium] (length=745 residues).
MSSPHVSESALIAQTAGPPALLRPPPIQFGGPPKPAPQTGAGITIGFVYRSFQHWWRVAIPAGLVCALLAGAAVWLTWTP
KYRAYAIIEIPDRGGVLLPTSPDTSPRFAQTQLRSIASSVVLTPALADPEIAKIPEIKRQVAPLEFLEETLKVSGEGGSE
LYRIEYVGENAKDAATIVNGVIRVYLGKLVADEKTRREEMLVQLENVKLKREAEIRSIREKIVEIEKTVVGKVPAKGDTG
AAGSVLSPVFALQQRLVEIEADREVLNAQIAAYGQPVASKPPKIPDDVLDVEVKMHPEVREQSRVISAMRLQLEDIEKKS
RQGKQSSSYKDYAALIVRAEKELATLQDEVRAQLELRNSVVSTADRGQEAVQWRQRLTALDAEHALLKRRYDEYMKSLSE
SGGDAVRLQFKYADLERESSVFNLIAQRKLQVETETHNPAKVIVRSDAQIPPAPIEAWPYKPLILFCGAAFVLPFFVVVG
WEKLSRRIADADQLSSESTLSIIGEIAQLPTRPVLSGGAASRRKIRRDLGLFQESVDGLRTCLLLSEATSSHRVFAVTSA
VSGEGKTSLVSQLAISLARATGKRVLIVDADLRSPNLHEIFEIHLEPGLAGVLRKECEITDAIVEEVAEGVHLLPAGRVA
TSPHNYLGNGAIPKLVAQLREVYDFVVIDTPPILCASESLVIAKAADGTLLCALRDVSRSRQVRLASDRLNMAGVNLMGA
VLSGTSARRYASTYGNYAYLEDSLS
>gnl|bykdb|A0A3B8ZJM2 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium] (length=751 residues).
MDPKKGVDVSPAEKSERTITDQLKISYIAGDPDTAMAVVNAIVLGYQKFLDEEYKFVDDEVIKLFNEVKKKLDQDLVAHK
NGYDKFLVDIKQQGVLFNVTEPVNHFFEAAMRNQQQLTAKRLEANQIKSILDTVETAMKSGDFRAQELLLLINDSSDLVK
STIFDQLFEDQDLAGKAMLESEKLEQSELLLLQGELDHLLEKYGEKHPNIRRIRSTIASVEKKIAHAKEAESRLEQAAAE
LNQKRNRSKNKMLNSEVASNDQPIDPPSDTTPGDASATAVTDSPNEVEKAIASTDSDSSVSPEDEAPDVEEQVNLYLQIS
LNSLTQRYKSLKLEEEEIQRWIDEDTAKSQIVQGFLLTHESIKNQAEKLDKIQEVLSDKLKGVELFQNSSNRKILQELIP
SMPGAYYGPFSSTYTAAGALAGILLMSFVALLMDMADRSYRSPDEIVSDLGKPVLGHIPAMDLPNIKKVVDTVDPSLITI
HHSRGRIAEAFRSVRTGLFFSSRGSELKVVQITSPVPGDGKSTLSSNLAVAMAQSGRRVLLIDADFRRPRLQKLFGFDAD
VGVAQLVAGQCELDDATYTTCVANLSIMPGGKRPNNPAELLSSSRFAELIEIVREKYDIVIIDTPPLLAVSDPSVVASVV
DGVVICMRLRRNVKPLATRAFRVLESVDAQVLGVVVNGVSTEAAYGGYGYNYSYNDYRYSYRSSYGYGYGKYGKYGYGKY
GKYTSYSTGYIEDRQAEAAEVSTKNDADTQS
>gnl|bykdb|A0A3C1QS25 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium] (length=879 residues).
MRRHACPTLLLDPYVWVHRACLVGTTGTSCECRARISPTRLKLAPPNRCPGRGPRYTEGSDISTGIHHGSTPGDGPLFPR
FGWSTFVAQMPVEGRPAWAEMGPPMGTEPESQRFDFLAMAWRRKWLIAFGLMVGLGLGFLAYKQQTPIYTSVAKVMITPK
NPATVIIPGFEGMPSGPGVKQDHEHDAVLTSTTFIRDSVVSNPELDQQVPSIAGLSPEMKLFQIQEGLEVDLEKDSENLY
LVSFSSPNQEDCDRVLWGVLNGYQEYLNRKYKATGQELKGILDDLKRNYDAKAEELQAKIQEQVEAHGEKLAFWNAEGII
NLEQQRMQELDAHIRQLELQKTEYQSQLDRIAQLEEEGKTQAVIVFILEQHEKIKEDKEKNSEETDILELRLNLERLLFK
FGEDHPEVKIVRNEIRAWEELMISRGISLPGTGDNRADFVALYKISLTEQVRSIDYELVAFRAQFEEHRARAMELNQVDL
SLKNLLDQKKYQESVITSVVDRLQQVDVTGDKEGFNYEILEPPTFAEQTEPSLLKVFAVAGFLGLLGGVGIAYLVDLADK
TFRSPDDIAQSLALPILGHIPFIPKSKQKQTEGITFDGTAISVHQPKSKISEAYRAVRTALFFSNRQRDIKVIQVTSPSP
GDGKSTLALNLAVSIAQSGQKVLLVDADLRRPRQHKVIGENAEHGFAAVLRGDLAVAEAAIETQVPGLYFIPCGERPSNP
AELLTSPKLPEFIEIARQQYDYVIIDSPPLLAVTDPSVIAPRVDAVVLTFRLRKNIKLTSDRARDILASVGAEILGVVVN
GIGGQAGYGDYKYSKYGRNYAYNYRYGSYGNYGQPYGYGYGYGYGYDYEEADKYYDEPVAPGGKRRKRSAAIGNDGPKS
>gnl|bykdb|A0A3D3R1Z6 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Gimesia maris] (length=790 residues).
MNTDFQPLDQQSDFGIDGMEENAEVNSSGPGVDIVRLLLRNKYLLVLGLATGLLLGQAAYMKLGPIFSANTKIQVSQKNP
VPIKDGEIQTFGELTAHIDVIKSPRIVGEAVKEAKLNQLSTLAGEKDPTQDIIDSLKVKRISGNDRAFLNILTLTYENPN
AKDARVVTQAIVDAYKRYLHEVREENTEDIIQQLKQAEKQIATELKLKKSEYQKFRENAPLYWESTPGSEAAVAGSTNVH
QERVKAIDNERRLNLLKLTELKSKIDSLKAAIASGESKETLELLAQQFLMGQTRGQAANGNTSEGQIASPGTSQVDRART
ALETHLMPLLIQKNRLERDFQKNHPDLDAVNRSIETIINLYRRQGLDISADNLESGEFQVAKTKDVDFVNVYLKSMEQQL
KELENRELELTKIFDQETELAKKVGDFQVVDQSYNEEIAQLKSQRDNIFKQLLVEKVSQGNSGYTLTQLAPVKDELVIKR
QLKFLMAGAGAGLGLILAFSYFREMRDTTMKSVDEIRNQLHLPILGEVPSFAESDAVVDDSEFAPALWYYYRPASREAES
FRSLRTSLLLKTDRSGAKVLQMTSAEPGDGKTTSISNLALAIAQTGRKVLIVDADLRRPTIHKLFGLANSIGLGDVLNGE
IDAQTAIRETRVTHLSILTAGMLPENPSEMLMSRGFSELVKQLRNEYDYILIDTPPLVVVSDPSVIASIVDGVLLVVRID
KNRRGVIRKVQQIIQTNGIKVTGLLANGVQSGKFGDYDYGSGPGYSDYYIVPPQVQTKQADAPAKTKLTH
>gnl|bykdb|A0A3D4PLL5 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium] (length=239 residues).
ENHQRISITSTQPSDGKTTVISNTAVAFAQAGKKTLVIDGDMRRPGLTAVFALKGQAGLSTILRDTASIEESALKHITKT
RLENLDVISAGPRPSNPVELLTSERFEELIGWAEGVYDQILIDAPPSLAVTDPAIIGRLVDGIILTVRPDRNKRRMIIRA
AESVTSLGGNLLGVVVNGLSDSRGEYGYGYGYGYGEGYGEGHDDPTHDDEEEAIPMTQSNSHRPRKRFSRDESSDRYAA
>gnl|bykdb|A0A3E0PW54 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium] (length=810 residues).
MVGFRPPGESGTAFALTVSRPPVAPSARHSHERTDMPAPQHNVDFAPLGYRQPDEGKSIDILKFTMSIRNMLIAGLAVGL
LVGVGVYMCLGPAYQADTRIEVSQKSAIPMDERSINFSGERTEHVHLIKSDAIVSRAVRDHGLGELPAFQKSKDPVMDII
DSLTVKRSAGSDQSFVNLIDISYLHPDKNAAGAVVRGLVAAYEDYLEAKQDSNSQELRESLARRQTELAEEIERLQSEYH
AFRADSPYYLPTPPTVAVNGSVIPGKNPYQARVEKIGTDLSRNRVLQSEIASRIATLEELQASGESREALEFFVIHWMSQ
GKSSSGDGESGGGGGSLLTEPPVRAELDKRFLDLQLMRDRLTVQLGKDHPNVIKLHQQLATLTDFYRQKGHTPPRSHGPG
ADTTDDAGPIDLVAAYIRIQQQELMHRQDLEQRLTADLASAESEAKAAGLFEVEDQKRKDEIARHKKQWQDVIVELESFG
VRKEQEGYRVNQIAQVRVEKSIKRIIKIVGAMGCLGVAVVFGLSYLKEWTDMTLRTADELKALVPVSVLGEVPEYSPSAA
AARSASALDPRLCYYHRPGSREAEAYRSVRMAVLRNQPESGGQAVQMTSAEPGDGKSVSAANLSLAIAKSGKRVLLIDAD
MRRPTVHELFRIKQDIGLSEVLLGEIEWMNALRETPVEGLSVMTAGACPENPAELLTASDLDGLLRAAREEYDVVIVDTP
PVLAVSDPSIVAPHADGVVLIVRMEKNKRAAIRRTLETLGGLDVELLGVVANGVSPAADDYRANQYNSYYNPNQRPDHAA
ESRQPVAADA
>gnl|bykdb|A0A3L7NJY1 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium] (length=558 residues).
DLVDTGDKTNSLSVVSETIKLLAAEYSEARRATEESRTRAASLNRAIANGEDILQFAMEALDSAGRQLIEQSMGLGSSDA
LHVQRINEELLDLRSRLRDANLKYGVNHPRIVAINDEILVKESYLQQLPMLQQQRMQDMARNELGPRLLQYINQQLQKNE
ENELAIFARLESEQVKAQNLTQILTRLADVDREIERLYTQQSDYQNHADGISLNKDTFIRTKIASKPTVPTRPVSPRLAI
VGILSLMVGTAGGLLIIWVLDILDDRFRTPEELKLQLSTQILSMIPRLEQLPGAGFEAVLSHLKPHSKDVEAFRALRTSI
EFSPEETRRLVCTSTEPGDGKTTVSSNLAVAFAQSGRRTLLIDADMRRPGLSTLLGLRDDFGLSRLLRSTDNLETSISQN
LRVTVVEGLDVISCGPRPVNPAELLAGDRFANLLAWAETRYEQIIVDAPPVLAVSDPAIVGRLVDAVVLVVRPDKDRRRM
VIRAAETLQSLGCSLLGIVVNHLTATDSGGYGYGYGYGYGYGYGHDDPADRDGVQTLPLHSSETDVRHVSDDKTKNAA
>gnl|bykdb|A0A3L7P0L2 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium] (length=782 residues).
MNKRSSLPVAEPDVDFAPLGYHKSQEGRSIDIVRFAISMWKYLIAGLVLGCGMGGLAYLYMGPVYVAGTKITVSKKATVG
ETEARLYGGRSEHISAIKSDEVVRIAYEKYGLKEIFGNDKDPLKSIWENLVVVRESGQETSFDNILNISFTSADKVEAKK
VVSAVIDAYADWLEAKRGSGSQLLYKTLLDQKKMMDEERTRLEDEYEKWRGESPFYISSSPVVSAQGVPTSMPSPYQANL
QDLVTRRNLNRDQLRKTKIKIDQLKEMMANPEERETLQAWIMNSISSSSSGGPGAEGGSSGGGLLSSPAGKMELDQQLLM
ARLLERRLLLVLGPNHGDVRNVRRQIDTILDFYHRQGLTPPNLGTSDASTRNAQGAAGADLAQTYLTILKSRLEELEDEQ
VRLVEDYKEAEKTAKEASSYEVIDQRYKDDIARKKKELDAILTQITHFDLNKDQEGYTLSRTNDVRVDRSMKRVMKIVGA
CGILGLLSVFCLAYFREWYDTTLKTVEETRTVIGAAVMGAIPHFRGGAVSDRLAVQNGLSPALVYFHRPGSREAEAYRSS
RTTLYHSTKDSQDKIIQITSAEPGDGKSTTAANLAIAIAQSGKKVLLIDADLRRPTMHTLFALPQDIGLTDVLLSEVDWF
NAVRTTRLENLSVLTAGLCPPNPAELLSSSRLPDMLNAAKKSYDVIIIDTPPILAVSDPAIVSPHIDGLIMVVRMGKNKR
AAAERAREMIDAHGIRLYGVIVNDIDYSVEDGQTYNEYEKYYDAAAPSLSAQPQTELVGGRK
>gnl|bykdb|A0A3L7P7S7 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium] (length=833 residues).
MSQEGGRLPEDAMNIFRMLQQRMGLIAVLAVLGLVAGGLFTLRMLPAYAASVDVMVVKKKGAMASDFRTAMLDDYVAIQV
TIIKSDRVLREAAQLLQQGEIAGGVAQATDTAGAPKTDAPTGTVSATVNRFQGKEIQDLIDYLRAGVGIIKAKEAGSTTA
SNNVLKVSFQSGSSTECVQALKAVIKGYKNYLDKEYNLADDQFMTRLERSSTVARREAQQLREDLRLIEEQLQKNTTSGV
VNRQKLLQEKSNGLMNRLDRVRARQEELTDQMRLAGTLSQTDLLPGVGDSPASEVNLTRNQEIRILERKVKQLARTGLGK
DHPDVKNLNDEIKDIREYIDQMAKGIVPKGPDGKASSLLGLGEDEIFSNKAQGLLKHYSERIEEHETELAKVKDESQSLQ
EELDKHKALENRKLEMSRRLEQLTRDSETIEFNKQQYAMTKDHGGYDAQELGRIPELGGEVPSRKSLIVVAGGIFGVAIG
GGLAWLMERADRTFRSPDDIRKRLGIPVLGHLPLFPPMDEEEKALCKVDPTLICFHNPKSQEAEFFRGLRTALYFSTQGH
GHQVLQATSPVAGDGKSTTAANLAISIAQSGKKIVLLDADFRKPRVHKIFKLDQPEVGLASVVSGDATLQEAIHTCAVPG
LHLMPCGPRPANPSELLTSPKFVEVIDELRKMYDIVLIDTPPILAVSDPSIVAPRVDGVLLVMRITRNGRPAAEQAAEVL
GTLGAKVLGVIVNGYDPRESDKYGYGYGYGYKYSYGYKYSYGYKYGYNYSDYSSYTDEEGDGEGDDGKGGYDDRPRAPSL
GSRVLPNVQPRVRTKRLTGGSPPQNVPGDGEPE
>gnl|bykdb|A0A3L7PH51 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium] (length=299 residues).
MALGLGLIYVLDALDDRFRSPDELQWQLGLPMLAMIRKMEPMEGTGMELIVTHMQPNSVESESFRSLRNFITFSNEATQR
LVVTSTEPGDGKTTTLANLAVAFAQAGKKTLLIDADLRRPGMTQLLDLKGPRGLAQVLNDKKLDIDIAERCLENVFHLGV
EGLDFMPSGPRPANPSELLSSERFSDIIAWAEQIYDQILIDAPPVLAVTDPSIIGRIVDGAIVIVRPDKNRRKMVTRAID
SFRASGVKVIGLVANHVEVSSNSDYGYGYGYGYGYGYGHDTPPETGTDHEDEQPYRRAA
>gnl|bykdb|A0A3L7Q373 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium] (length=792 residues).
MWWRLPETSDVTQRSQLPVVAPSIDFAPLGFQKSNDGRSIDIVRFAMSIWKSLAIGLMAGCGLGVLAYLYSGPTYVAETQ
IMVSKKASISDQEARRYGDRGEHVRVIATDIIARIAYEKYGLNQISNFAGAYDPLKAVWEDLQVKRVAGQESSFDNILSI
AYQSKDPKLAKQVVESIVAAYGDWLEAQKDNNARDLYETKLTQKNALDEERKALEKEYSQWRADVPFYINTTPAVTAQGT
PLAQQSIYQAKLSDVITRQSANEALLRSTRSKIGILKEMMANPEERESIQTYIMSSLAASSSPGGEGGSGAGLVSTPTGK
AELDQQLLVNRMLERRLLLVLGENHADVRNVRRQTETILDFYYRQGLTPPNLGTPGQTAAPGTVAINEGLSQQYLKVLES
RVEELQADQIALKSAYDDAEKTARMASTYEVTDQQYKDDIARMKKDLDLALKQLSDLDQNKAQEGYKMSRTNDVRVDRSL
KQTIKIVGAFGVMGLLAVFGMAYFREWYDTTLKSIEEVRSIVKAPLMGAIPRFRLSGALKRGTTSNGLSPSLVYYHRPGS
REAEAFRSIRTTLFHSTKESQDKLIQITSAEPGDGKSTTAANLAIAIAQSGKRVLLIDADLRRPTMHTLFGLSQDIGLAD
VLQNEIQWVNAVRSTRLENLSVLTAGRCPSNPAELLSSLRLGETLRAIRGDYDIVIIDTPPILAVSDPAIIAPLVDGLLL
VVRMGKNKRATAQRSRELIDSHGIPLYGVVANDIDYTADGGQEFSMYDRYYNEQTPELPSPLSRELLVGSQK
>gnl|bykdb|A0A3L7SU85 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium] (length=261 residues).
AGDGKSTTSANLAISIAQSGKKIVLLDADFRKPRVHKIFRLEQPEVGLASVVNGDATLQEAIHTCEVPGLHLIPCGPRPA
NPSELLTSPRFSEVIEELRKLYDIVMVDTPPILAVSDPSIVAPRVDGVLMVMRVTRNGRPAAEQAAEILGTLGAKVLGVV
INGYDPREAGKYGYGYGYGYKYSYGYKYGYKYNYGYNYTDYESYTDDEDEENEAANAEGKVQRGPSMASRVLPNLVPRIQ
TKRLPSKPASETKPPETPEST
>gnl|bykdb|A0A3L7UX05 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium] (length=791 residues).
MIGPKIPMNNHQNEAMNQSLSPQLPVHQQGYGQGAALWNAHQHDSHEPENQSKGMNLATVWRSIRRYWWQAGLLWVISSG
VLMFLAFTSVKPTFLSFALLRVEPPRASILGPSMNTLGIDQIKRTHMQLIKAPDVLSDAVSEYPEIVQLPELKNSASPEY
VMDKKINVIDRVNSELIEVQMVGTSPQNATDIVNAVVRSYLKQAGRWANETTTAQIGKLTRELERRNKEVEDLRNNIKLL
GSELGAADPELIKDRSRLTLEDYTRMSRDLSQLEFERITAESRVERLRGELAQPPVIAQRQNLQDAVYQAFYADRDVADL
ADALDDAKARLDKLNKVSRGQDVSHREMNDRITDLKSKIKVLWERRRSALEKQLAQEGAGQSTSTLDRELRDAENQYQDL
IVREQAIRKNMQESKLTLENDESKELQLAFRRTDLARAESTLDSVQRALEQLQFESQGQTQISLIQTARPIGLPSNDKRW
RFMAMAPLGMFLAVASLCVLVEVRSGRVSNPDDLTNRSRLEVLGVVPPLPNPRSARKLMGGIDETRLRRQLVEYIQSIDH
LRVAISASLGSTHEHQSILITSAFGGEGKTTLSAQLAGRCANAGLSTVVVDGDLRNPTLTRTLEATDMPGLTNLLKGQSN
IDKCLVRIGEGGGFHLLPAGTIHGDPSRILESAKLGKIMAHLRENFQVVIVDSAPVLPVPDALLFGRWVQGIVIAVRYDT
SRFPMIERAYKRLSTLKVPVLGAVVNGVRNASATYGGYGYGYGYGYGGSFGDGADEDVVTDAVDIDVEIVD
>gnl|bykdb|A0A3M1R9K7 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium] (length=312 residues).
VEIVQEAQQPRVADQDRQIQLTVLAGLGGFACPVALILWWDTRGKRINTPAEVVRTTGLDLLGTVPLVPAKAAKQLHSEG
KRYHHWRAIFTESVRGIAARLIRQAKEDETRVVLVTSAFGGEGKTTVASQLAISLAEMGQKTILIDFDLRRPSLDGVFGI
ENDRGVSEILRGEAKWQQVCRDSGIENLDIIPAGQWSYRGMAVLANGVVGGLFRSLREQYDFVIVDGSPVLPVADTRFVS
MHVDGVVMSVLRDVSRMPKVHAAYRTLAAFDAKILGAIVTGNPGEAYYHDPRYTHYIDAADEPEPVSADETG
>gnl|bykdb|A0A3M1RAJ8 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium] (length=266 residues).
STHQLTYDLGIHVVGSLPLVHKRRLLPNPVYNGSVPDDIRAVLHESVDNIRTTLIHRAKKDGLKVVMVTSGVAREGKSTV
ASQLAASLARAGRKTVLIDGDLRRPRMHRVLKQDLAPGLSEYLRGEAALEEIVRETDRDNLWLIPAGRCDTEALQALARS
DPERLFEVLRREFDFVVVDTSPLLTAADSLAVGRFMDGVLLSVIRDNSRLPLLLEAYQRLEEVELPLLGVVVNGGPAGRY
RSYYRAYTIDVESREPKTAPRQPVGK
>gnl|bykdb|A0A3M1SE88 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium] (length=285 residues).
RFRSIEEMQLQLRTPVMAVIRRMKPREFLGPKSLQVVAEPDSPESEGFRTLRTALALSESDADTIVVSSTEPGDGKSTVA
ANLAAAFAQAGKKTLLIDGDLRRPGLTAMLGYRGESGLSRALQSNEDIEEAAVKTIRSTGIENLDLLPAGPRALHPAELL
SGSRLAELLAWVENVYDQVVIDSPPVLAAGDTAILGRLADGVLLVVQPEKNRRRVILRAAEYLTVLKIRLVGLVVNRTAK
ERVPGYDAYDTAYDYHGRDESDDPVSADGVPFDDDDEDIVPRRVA
>gnl|bykdb|A0A3M1TFJ0 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium] (length=712 residues).
MDSRESQLGRLEDEDELHEDLWVYLQTLRRQLPLVLVVAGACTLLATLRTLRLPAVYAATASLRLVREPPDPIQAKYAYR
WDGIPQEYLNSEIRDMTSLSLARAVIESNSVIARQLAEDIGSEDPNALAMAFLAGVDVHPEETTYVVDVTYTSSHEERCA
LYANALAEAYTRQRKSLWGQKTRQTEASVAVVVSRLGATLAASRKKLEEFLSSNQTPLFERQEELLIQQIDANNRALEAV
RRDRIALDASLETIRRVLEQGRPLDMAPPVAQSPVVSMLRRNLAEAELELAGLEQRYGENWPQVRAARARRDQLKLLLRQ
EIDTILGQLESQRQQRLSEEEGLSQRAQQLREQSRQLARRARLYESLKKEVEANERFYEEFIQQQKDISAYSRVNVAEVR
IVDPALAAVRVGPNHVRNVLVGALLGLFAGVLAALGLDRFSDRVRSLAEAQRLGPPVLGAVPELSDVSGRELDRYALSNP
SSAYAEAFRRARVQLNATGAFPSEGCGVLVCVSGVPREGKTLCSVNLAVAEAQAGRRTLLVDGDMRNPRVHKVFAADPAP
GLRNALEEGEGLEFLQSTDVENLYLLPAGQGEENAANLLGSGEAFARLIGGLRQRFDRIVIDTPPVAAFSDGVLMAVAAD
AVVLVVSARTSRRSASQLAVVELSRVGREPVGVILNQRPGSDYGYYYGDLYYGYGYGYGPSQPPARAGGSGA
>gnl|bykdb|A0A3M1VG27 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetes bacterium] (length=810 residues).
MNDDVPFRFADGVAGAPAVSTDRITTVQRPGDVATPGAPSPPIELMRRQQFDPLEIGLRYRVWIGLAILAGLLLGGLAYW
KFGPTYDAKAQILVSRKASIHLKSDDLRTYGERSEHVALIMSPMIVRKAVALRRLDRLPSLATKKDPVAAIITELKAKRV
AGTDQSFLNIIELTYSNRYAQDAVAVLDAIVAAYSQYLQESQKEHTNELLTLIHTATVDLRKQLEAKQQEYLRFRAEAPF
LWRRPTVADESSQDVISVHIDEVQKIQQALSGVTVEQTVVRSKIRALEEAIASGRSPRELTALVKLFLYSEGHKNAAEAF
AAPADAPDVVRTQLVPLYLEEQRLLSEFGEDHPDVIAVRQRMEALRRLARRTAADDSLDRLDTGDSSLVDVYLAGLREQD
AELTHRRQQLEKLYEEKLRVAKQFAHILEQDQAYRDQIQSIKSTLDVVISRMQEIELIKDNRGYALRTVAEPKAEVSIKR
PLKFLGAGLFGSLVAVTAMIYLREVRSRSLRSLEELRNALAVPVLGGIPEFTATEHGPPTARKCAQWYRLYPRSGEAEAF
RVVRTRLLVSLHDEHHRVLQITSPEPNDGKTTVACNLALAVAQSGKRVLLLDADLRRPSIHKALGLRQDIGVTDILRGEI
DWQTAVQHTVENNLDVLPAGLPVDNPAELLSSHAFRHLLQTLRVEYDLVVVDSAPVLAVTDPCVVASLTDVVLFVVRLNK
SRHSSTRRALELMHAHGARILGVVGNCLPDDGEDSELYTAFYAPYCAAGADADTAGEAADPSALAEASEAGRPSEEEAAD
RSSTPIASGA
>gnl|bykdb|A0A3N5UQY5 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctomycetaceae bacterium] (length=313 residues).
MALLCGLVLGGGIAAARDWIDQTIRSTEEISTIFRLPVLGGGPAMSRRKSVPVRGRKVLLEPSSREAEAFRIVRTAVFFG
APNGKAKTTLITSPGMEDGKSTLVSNLAIAMARAGQKTLILDADLRKPIQHRIFDINHQEQCLCSVLEGKVKLSQAIQPT
QVPGLSLLTCGYGIGNPAEVLNSPQFAKLLAYLGRAYDRIIVDAPPVTAVTDAQILGALCDFTILVLRADRSTREITQRA
IEALRGVGGRLLGIVVNQVHRDGGRYGYYGGHYRLGRSNHKHGPDAKAHDTCIGMTLQPLEAGLSRSPVLRPS
>gnl|bykdb|A6BZU4 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Gimesia maris DSM 8797] (length=790 residues).
MNTDFQPLDQQSDFAIDGMEENAEVNSSGPGVDIVRLLLRNKYLLVLGLATGLLLGQAAYMKLGPIFSANTKIQVSQKNP
VPIKDGEIQTFGELTAHIDVIKSPRIVGEAVKEAKLNQLSTLAGEKDPTQDIIDSLKVKRISGNDRAFLNILTLTYENPN
AKDARLVTQAVVDAYKRYLHEVREENTEDIIQQLKQAEKQIATELKLKKSEYQKFRENAPLYWESTPGSEAAVAGSTNVH
QERVKAIDNERRLNLLKLTELKSKIDSLKAAIASGESKETLELLAQQFLMGQTRGQAANGNTSEGQIASPGTSQVDRART
ALETHLMPLLIQKNRLERDFQKNHPDLDAVNRSIETIINLYRRQGLDISADNLESGEFQVAKTKDVDFVNVYLKSMEQQL
KELENRELELTKIFDQETELAKKVGDFQVVDQSYNEEIAQLKSQRDNIFKQLLVEKVSQGNSGYTLTQLAPVKDELVIKR
QLKFLMAGAGAGLGLILAFSYFREMRDTTMKSVDEIRNQLHLPILGEVPSFAESDAVVDDSEFAPALWYYYRPASREAES
FRSLRTSLLLKTDRSGAKVLQMTSAEPGDGKTTSISNLALAIAQTGRKVLIIDADLRRPTIHKLFGLANSIGLGDVLNGE
IDAQTAIRETRVTHLSILTAGMLPENPSEMLMSRGFSELVKQLRNEYDYILIDTPPLVVVSDPSVIASIVDGVLLVVRID
KNRRGVIRKVQQIIQTNGIKVTGLLANGVQSGKFGDYDYGSGPGYSDYYIVPPQVQTKQADAPAKTKLTH
>gnl|bykdb|D5SX64 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Planctopirus limnophila] (length=778 residues).
MRQTPQDSELASSFETEGEGGLSIDWMNLVFRYRWWLCAGVVLGLGLGIAAYIKLGPEYMAIGQVMVSRRNAVPLKEQSA
IGDWGERSEHIALIMSPMIASEAVRLGQLDKLKTFAGESDPTQMVLDDLKVKRVAGQDRSYLNVLDVTFQSASADDARHV
VKAVIDAYASYLNESRSEKTTEVFKTAQEAHDTLQKSLREKEEAYLKFRESAPLQWRAPIGAIAADGTSGATNVHQERVI
AVEEQRRLNLLRRTEINSRMQALQKAQDQGESTSTMEMLIRRFIANDGSGAELQQQQQEISAFENRLLPLILEEEKLLRD
FGPDHPEVKAVRKSIDTTLDFYRKHGLRMPDDMTPGPDGKPLIKERANLVQNYMETLRQQLKELDIREQQLNVLFELESN
KAKEYARFQAEDQAMTAELNRLRSLWGQLVDRMSQLTIDKESSGYTLRQTGPIKDEWVLKRLLKIVGAGMVAGMGLIISL
IALKEFLSNQVRTVREVRQLLPEAYLGAVTSFDPEQSRLDPVQNVHPSLRYLRSPASIEAENYRTIRTSLLVTAEALNAQ
VIQVGSPEPGDGKTTLVSNLALALASSGKRVLLIDADLRRPMATRLFGLRPDPGLVDVLQGEIALENAIVETVVEGLTIL
PSGRPPHNPAELLEGGPLRQLIAKARTLADIVLIDAPPVLAVSDACIIGQHVDGYLLTVRLGKNRRPMLRRSRDLLLAHH
IPILGVVANGVEPSDREEMGYYADYNRNEAFFPQDQSSPEKSSTHRDLTISASPVRQP
>gnl|bykdb|F2ARR3 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Rhodopirellula baltica WH47] (length=859 residues).
MELPSNASSDSRSQGASTRGKEAFASYPSPNPGAMGLAAQGSYPAMNTGWQPTHQAANETADIAAAIWRYRWAVLIPTIL
GLVAGFLAFVKTPETYQSATRLMFESDRPAVMDTMTGDVLGGVPSIDILRSQLFSDIVLAKTFADENMRPFRDRFENNPN
LFAGLANGALEFETDLQGVRGASSIVANMTFEHTDPELCEAAIRAFSSSFQQFFADRHKSSRSELMSLISVATDQLQPKL
TELEERYREFRTNAPLVWDQNGAAINPHRERQLYLTERRSELFEHLRQKSIELTAIQSIADEAEDPIVGLSIIGQLIGKT
FEVPGKAVFNQNVREGDEELAQIKLDQQLVPLMIERHKFAAEFGEQHPTVKALDAELTMMKSELKRLVKEQSERLVELME
QNKVEGVDPAKRAMEAVSVILTASNAEVQLLRQQISEIDAQVNAEKSEAVKLAKFEQDNTALLREIDRNRELINQLEEQM
ARVELTEEEGGLRLTELRAPTRAYRVGPNMLLMLGIGLGVGLLLGCGLALLLEKNANTFRDPEEIVTAVGAPILTHVPFF
KGRVRHKKGDKSNPFEHLDPHLAVVHAPSSVASESIRSCRTSVLFEMAGISGGKIIQVTSPLPGDGKSTIAGNLACSIAQ
SGKRTLIIDCDLRRPQVTDNFAMADQLGLVDVLNGKCEHIDAAHDTPLSTLKMMPSGPIPANPAEALTLPEMSELLDVLR
EEYDYIILDTPPLLVVTDPSITASMTDGVVMALKVRRKSRPNAKEAASILANVGAKLLGVVINASDEGSNNDGYKGYGYY
RYGRHTNRYYRKTADNGAKAGQRRSPVVVSGRGPAARSARPIAVPPATAPSIEREGSDV
>gnl|bykdb|K5D8H6 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Rhodopirellula baltica SH28] (length=858 residues).
MELPSNASSDSRSQGASTRGKEAFASYPSPNPGAMGLAAQGSYPAMNTGWQPTHQATNETADIAAAIWRYRWAVLIPTIL
GLVAGFLVFVKTPETYQSATRLMFESDRPAVMDTMTGDVVGGVPSIDILRSQLFSDTVLNKTFNDENMRPFRDRFENNAN
LFAGLANGALEFETDLQGVRGASSIVANMTFEHTDPELCEAAIRAFSASFQQFFADRHKSSRSELMSLISVATDQLQPKL
TELEERYREFRTNAPLVWDQNGAAINPHRERQLYLTERRSELFEHLRQKSIELTAIQSIADEAEDPIVGLSIIGQLIGKT
FEVPGKAVFNQNVREGDEELAQIKLDQQLVPLMIERHKFAAEFGEQHPTVKALDAELTMMKSELKRLVKEQSERLVELME
QNKVEGVDPAKRAMEAVSVILTASNAEVQLLRQQISEIDAQVNAEKSEAVKLAKFEQDNTALLREIDRNRELINQLEEQM
ARVELTEEEGGLRLTELRAPTRAYRVGPNMLLMLGIGLGAGLLLGCGLALLLEKNANTFRDPEEIVTAVGAPILTHVPFF
KGRVRHKKGDKSNPFEHLDPHLAVVHAPSSVASESIRSCRTSVLFEMAGIPGGKIIQVTSPLPGDGKSTIAGNLACSIAQ
SGKRTLIIDCDLRRPQVTDNFAMADQLGLVDVLNGKCEHVDAAHDTPLSTLKMMPSGPIPANPAEALTLPEMSELLDVLR
EEYDYIILDTPPLLVVTDPSITASMTDGVVMALKVRRKSRPNAKEAASILANVGAKLLGVVINASDEGSNNDGYKGYGYY
RYGRHTNRYYRKTADNGAKAGQRRSPVVVSGRGSAARSARPIAVPPTTPSVEQERSDV
>gnl|bykdb|L0DK20 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Singulisphaera acidiphila] (length=741 residues).
MMSNSNFGPQPNSANLPAVVPPHRAEVFSVSSPPAGPVAGLDPVAMLKALRRRWPLALGAGLLGGAVLAFATYFLVPPAK
YTARSMLHVSSTQPRILLKVGENETDFVAYQRTQLALLKSRLVLGTALKDPEVAKLEVITKAVDPIEWLEKELQVDFASG
SEILRISINGEKPHEPMLLVNAVTQAYIDEIVDVETKQRRQRYDLLKETWNRYQENLKEKRKELKRLTELAGSDDKKTIA
NIHQHELDRLGRAEDELARVQSELRGLRVEHEVLQEDVARNSSMITPAMIVDAINRDHSIEVLKEREAAAQKAIDRIYHI
ARNKSDPSLKKHRDELEAARTAMVAQRRKLYPIVEQQLQEIGRDDDDSNKALIPHRISILSKLEAVLASDVKRLSERSLS
ITQNSVDLFSVQEEIANADEIARTIGKEVEALTVELQAPARIRLLEKAELPRTKDEARQLKMAGVAGCGAFALALIGVSF
WEFQSRRIDSAADVIKSLGMNLFGTLPAIPKRSRGMKLREAESVRWRSMLVESVDAARTTLLHFSRTESVRVVMVASALS
GEGKTSLSSHLATSLARAGRRTLLIDGDLRRPSAHELFDQPCVPGFSEVLRNEVNIADAIQPTAASGLSLLTAGLSDNET
IQALACRDLRVMFDQLKEHYDFIVVDSSPVLPVADALLIGQHVDAVLFSIMRDVSRIPKVHEAYERLAKLGIRMLGAIVT
GEQSDHYGSKYGYSARAQESV
>gnl|bykdb|L7CND7 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Rhodopirellula baltica SWK14] (length=815 residues).
MNEGWRSGGSAEPADAGDLMGAIWRYRWAAFVPAILGAVIGFLVFVKTPETFQSGTLLMFESDRAAVIDTMTGDLIGGVP
SIEILRSQLFSDKVTEYAFENENMVVFQESLGGRPSGLAGLAFESLKFETDIEDARSASSLVATLTFDHSDPELCEAAVK
AYSAAVQQLFSEKHKSSRGELLRLIEDATKVLQPKLSELEENYREFRTNASLVWDENGKAINPHRERQLYLTARRSELFE
TLRSESVELSAIESIAREADDPLVRLSIIGQLLGKTFKIPDSAQISQNMREGDAQLAQIELDQQLVPLMIERNKFAAEFG
EQHPTVKALDAELTMMKSELKRLVKEQSDRIVELMEQNKVEGVDPAKRAEEAVNVILTASRAEVQLLQQQISEIDSQIAS
ERIEATKLAQDEQENASMLRQIDRNRELINQLDEQMARVELTEEEGGLQVSELRAPSRAYRTGPNLVKMLGIGTFLGLAL
GCGLALLLEKNANTFRDPEEIIAAVGAPILTHVPFFKGRVKRKKGEASNPFELLDPHLAVVHAPSSVASESIRSCRTSVL
FEMAGIPGGKIIQVTSPLPGDGKSTIAGNLACSIAQSGKRTLIIDCDLRRPQVTDNFAMADQLGLVDVLNGKCEHVDAAH
DTPLSTLKMMPSGPIPANPAEALTLPEMSELLDVLREEYDYIILDTPPLLVVTDPSITASMTDGVVMALKVRRKSKPNAK
EAASILANVGAKLLGVVINASDEGANNDGYKGYGYYRYGRHTNRYYRKTADNGAKAGQRRSPVVVSGRGSAARSARPIAV
PPAVTSPTEQERSDV
>gnl|bykdb|M2AKU0 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Rhodopirellula europaea 6C] (length=858 residues).
MELPSNASSDSRSQGASTRGKEAFASYPSPNPGAMGLAAQGSYPAMNTGWQPTHQATNETADIAAAIWRYRWAVLIPTIL
GLVAGFLVFVKTPETYQSATRLMFESDRPAVMDTMTGDVVGGVPSIDILRSQLFSDTVLNKTFNDENMRPFRDRFENNAN
LFAGLANGALEFETDLQGVRGASSIVANMTFEHTDPELCEAAIRAFSASFQQFFADRHKSSRSELMSLISVATDQLQPKL
TELEERYREFRTNAPLVWDQNGAAINPHRERQLYLTERRSELFEHLRQKSIELTAIQSIADEAEDPIVGLSIIGQLIGKT
FEVPGKAVFNQNVREGDEELAQIKLDQQLVPLMIERHKFAAEFGEQHPTVKALDAELTMMKSELKRLVKEQSERLVELME
QNKVEGVDPAKRAMEAVSVILTASNAEVQLLRQQISEIDAQVNAEKSEAVKLAKFEQDNTALLREIDRNRELINQLEEQM
ARVELTEEEGGLRLTELRAPTRAYRVGPNMLLMLGIGLGAGLLLGCGLALLLEKNANTFRDPEEIVTAVGAPILTHVPFF
KGRVRHKKGDKSNPFEHLDPHLAVVHAPSSVASESIRSCRTSVLFEMAGIPGGKIIQVTSPLPGDGKSTIAGNLACSIAQ
SGKRTLIIDCDLRRPQVTDNFAMADQLGLVDVLNGKCEHVDAAHDTPLSTLKMMPSGPIPANPAEALTLPEMSELLDVLR
EEYDYIILDTPPLLVVTDPSITASMTDGVVMALKVRRKSRPNAKEAASILSNVGAKLLGVVINASDEGSNNDGYKGYGYY
RYGRHTNRYYRKTADNGAKAGQRRSPVVVSGRGSAARSARPIAVPPTTASVEQERSDV
>gnl|bykdb|M5RD30 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Rhodopirellula maiorica SM1] (length=227 residues).
MMTSPHPGDGKSTTISNLAISLAQTGKRVLLIDADMRRPVIAGLFGLEGEPGLTNVLFDSTQFDKCIQSTPIETLSVMAH
GSRTSEPAELLESFRLSGLLRSCEQRFDIVLVDAPPLLAVADPAIIAPQVDGVLMTVRVLKNNRRSVERAGNVLEEIGVT
PTAIIVNGSDAESKAYGYSNHYRSEEYSYTPYYHDTYAASDPQPNSIRLQNAVGSQPVQPTKLMSRS
>gnl|bykdb|M5RUI3 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Rhodopirellula maiorica SM1] (length=775 residues).
MQSNANRVNGNDRPIGRLSGPSAGANSQFDPWILWVTFRRNWLWAVPVGMVLASLAAFGVFKSFVPVYRASHLLEANSQW
VVFKDVIPVIEDIAATEKPLFFNSIILDPVLADPALRKAPSLADPEYAEVSLRENLKVTSGGNRRHLVVSYEDSDGVAAA
TVCNAVVDSYLRQRDAFDQARMVKVERGLEPEIQRWQQEVEQRHHRVQKLSETLVGFAPGQKIAALENESNMTLMAELRS
RISDLRVKIAIADASRVSAAGEAEFVPPVEAAVIPSAVVERHVPSEQEILNAINQDAKVSEALSRVAHYKAILLELEDSD
IVRIRREYYEEMQGKRDEWTANLETLKAGARERVVAMLNERADAEYERQKIAAKARIESLKEGFEAQRKSKIEAARVEWQ
RELQKRYADEKKEYEALATQLDVLQKQYDDERSRLEQFGGASADLQLAIDEKQIAMDVLGKLKIRAAAIRTEKQQGGSVQ
TLAAATPPRIPLESVPTKKLIAVSGGAFCIPFLLGLLWELRVQRVTDSAAVDRSQSLAPVVGEIAQLPSGARNGRGRRIF
EESVDALRANLFLSLDTKHTRSIAVVSSMSGEGKSSVASQLALSIAKATDQTVLLVDADLRYPDQHEIFGLEMGPGLSGV
LSQTATLEEAVDTSLGSLLHVLPAGRLDRSPHRLISESSMRDFVDRALEKYSFVVIDTAPVLSASESLAVASSVDSTLLC
VMRDVSRMDNVNRSMRRLDASGATIAGTVFSGVTAGQYAYRYGSYHYAIAGETDA
>gnl|bykdb|M5S2L2 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Rhodopirellula maiorica SM1] (length=204 residues).
MADIQGGKVIQVTSPLPGDGKTTLAGNLACSIAQSGKRVLVIDCDLRRPQITDNFAMQSKMGLSNVLNGDCDPSEACQQT
PLSTLQVMPSGPIPANPAEALTLPEMGELIELLRDEFDYLILDTPPLLVVTDPSITASMVDGVLLALRVRRKSKPNAKES
VNILRSVGANIFGIVINNSDESGASDGYKGYGYYRYSRYTNRYY
>gnl|bykdb|M5SF00 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Rhodopirellula europaea SH398] (length=825 residues).
MGQAAMGSYPAMNEGWGSSGSSQTAESADLMGAIWRYRWAALVPTILGAVIGFLVFVKTPETFQSGTLLMFESDRPAVID
TMTGDLIGGVPSIDILRSQLLSDKVTRNAFENESMEVFRESLGGHPSALLGLANKALKFETDIQDARSASSLVASLSFEH
SDPELCEAAVKAYSAALQQLFAEKHKSSRGELLRLIRDATDNLQPKLSELEEDYRAFRTKASLVWNENGEAINPHRERQL
YLTERRSELFETLRSQSVELSAVESIAREADDPLVRLSIIGQLMGKTFEMPESNQISQNMRDGDAELAQIELDQQLVPLM
IERNKFAAEFGEQHPTVKALDAELSMMKRELKRLVKEQSERIVELMEQNKVEGVDPRKRAEEAVNVILTASRAEVQLLKQ
QISEIDSQIASERIEAMKLAQDEQENASMLRQIDRNRELINQLDEQMARVELTEEEGGIQVSELRAPSRAYRTGPNLVKM
LGIGTFLGLALGCGLALLLEKNANTFRDPEEIIAAVGAPILTHVPFFKGRVKRKKGEASNPFELLDPHLAVVHAPSSVAS
ESIRSCRTSVLFELAGVEGGKVLQVTSPLPGDGKSTIAGNLACSIAQSGKRTLIIDCDLRRPQVTDNFAMADQLGLVDVL
NGKCEHVDAAHDTPLSTLKMMPSGPIPANPAEALTLPEMSELLDVLREEYDYIILDTPPLLVVTDPSITASMTDGVVMAL
KVRRKSKPNAKEAASILANVGAKLLGVVINASDEGANNDGYKGYGYYRYGRHTNRYYRKTADNGAKAGQRRSPVVVSGRG
SAARSARPIAVPPTTPSVEQERSDV
>gnl|bykdb|M5T666 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Rhodopirellula sp. SWK7] (length=716 residues).
MLEANEDFVVFKGVMPVVKDLARTENSLFFNPIVLDPVLADPSLRNVPTLVDPATAEANLRKNLSVSSGGTESRLVVSYT
DTDREAAAVVCNAVVDSYLRQRDSFDDTRVNNLERWLEPEIQRWEQEVEERQQRVHMLSEKALGFAPGRNVDRAESESSM
SRLADLRSQVGELEIELALFDATKDLPVALPPSETAQLPDAPVVPTLAETEVQKAAIREADIQEAIEGDVKVREASRVVG
RYQAILLDLEVKDMVRVSRDYYNQMKENLADAQSKLDQERQVARDRALKELQRLVEEDFRQRKEVAERAFAWQQEQLKKQ
QQEMKRLQDKSAEERKVAQKAYAAAQAKERDNQRKVLVAKLDILKAQHDEERERMEQFGGTTAELQFANDELVVASDVLT
KLRGRVAAIRTERRQDGAVRTLASATPPKSPVEAMPYKKLGMASAVAFMVPFLFGLLWELKVQRLTDAETHDKTGQLAPV
LGEVARLPAGAGAVKGRRVFEESIDTLRANLFLSVDTRETRSIAIVSSMSGEGKSSVASQLALSIAKATGETVLLVDADL
RCPDQHEIFGLEMGPGFTSVLSKESQLVDAVDSSLGNLIHLLPAGRLNASPHRLISPANVTAFVDAALESYEYVVFDTAP
VLAAGETLAIASAVDSTLICVMRDVSRKESVLRTTRRLEASGASVAGTVFSGVSARQYGYRYGDYQYALGGEPQAT
>gnl|bykdb|M5T8W8 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Rhodopirellula sp. SWK7] (length=813 residues).
MSTPDGPSVDSADMVASIWRYRWAVIIPAILGAAGGFIAFLKTPETFKSATRLMFESDRPAVLDTMTGDVLGGVPSIDIL
RSQLFSDTVTKNAFEDESFEVFRSKFGDNPAGFAGASGEALQFNADVQDTRSASSLVATLAFESTDSELCVGAVKAYSAA
LQKLFAEKHKSSRTELLRLITMATDQLQPKMVELEKRYRDFRTDAPLVWNEEGKAVNPHRERQLYLTERRSELFEQARQK
SIELAAIQSIAEEGKDPLVSLSIIGQLVGKTFKIPETLQTRQDLREGDAQLKQLELDQQLVPLIIERNKFAAEFGEQHPT
VKQLDVELKMMKSELKRLVTEQAERIVELMEQNRVEGVDPAARAQEAVDVILFASNAEVELLQQQIAELDQQIANEKSEA
VQLAKYEQENNAILREIDRNRELIDQLEEQMARVELTEEEGGVRVSELSAPSSAYRVGPSMAKMLGIGTFLGIALGCGLA
LLLEKNANTFRDPDEIAEAIGVPILTHIPFFKGRVRKSKPDHPNPFEKLDPYLAVVHQPASVPAEAIRSCRTSIFFDLSN
VPGGKIIQVTSPLPGDGKSTIAGNLACSIAQSGKKTLLIDCDLRRPQITDNFDSAEQLGLIDVLNGHCEHIEAIHQTPLA
TLKIMPSGPIPANPAEALTLTEMGELLELLRDEFDYIIVDTPPLLVVTDPSIMASLVDAVVMTLKIRRKSKPNLKEAATI
LRTVGARLIGVVVNNSDESGSSDGYKGYGYYRYGRHTSRYYRKTKDNGTKGGQPRTPIVVSGRAVGLRASAAAAKPTSVA
TSSTKNGTATDDV
>gnl|bykdb|M5U569 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Rhodopirellula sallentina SM41] (length=838 residues).
MSILSEFQSDRSGSYQTLGSPATGVGMPEGPSGDSGPDMLAAIWRYRWAVIIPAILGAAGGFIAFLKTPETFKSATRLMF
ESDRPAVLDTMTGDVLGGVPSIDILRSQLFSDTVTKNAFEDDSFDAFRAKFNDDPRAFAGMSSKALQFSPDVQGTRSASS
LVATLAFESSDRELCLGAVKAYSSALQRLFAEKHKSSRTELLRLITLATDQLQPKMTELEQRYRDFRTSAPLVWNEEGKA
VNPHRERQLYLTERRSELFEQARQKSIELASIKSIAKEGKDPTVSLSIIGQLVGTTFDIPEVMQTRQDLREGDAELKQLE
LDQQLVPLIIERNKYAAEFGDSHPTVKQLDVELKMMKSELKRLITEQAERIVELMEANKVEGVDPAARAREAVDVILYAS
EAEVELLRQQIKELDSQIATEKSEAVKLARYEQENNAILREIERNRELINQLEEQMARVELTEEEGGVQVTELSAPSNAY
RVGPNMAKMLSFGTFIGLAAGCGLALLLEKNANTFRDPDEIAEAVGAPILTHVPFFKGRVRKAKPDNPNPFEKLDPYLAV
VHQPASVPAESIRSCRTSIFFELSGIPGGKILQVTSPLPGDGKSTIAGNLACSIAQSGKKTLLIDCDLRRPQITDNFASA
EQLGLIDVLNGHCEHIEAIHDTPLATLKLMPSGPIPANPAEALTLSEMGELLELLRDEFDYIIVDTPPLLVVTDPSILAS
MVDVVVMTLKIRRKSKPNLKEAANILRNVGARLVGVVVNNSDESSSSDGYKGYGYYRYGRHTSRYYRKTKDNGPKGGQPR
TPIVVSGRAVGLRASAAAAKPTSVAATTPINGKPEDDV
>gnl|bykdb|M5U6N6 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Rhodopirellula sallentina SM41] (length=728 residues).
MLGFVPRYQATHLLEANEDFVVFKGVMPVVKDLARNEKSLFFNPIVLDPVLADPQLRSAPSLSDAETAEAQLRENLSVSS
GGTEARLVVGYTDTDREAAAMVCNAVVESYLRQRDSFDDTRINNLERWLEPEIQRWEQEVESRQQRVHMLSEKALGFAPG
QNLDRAESESNLSRLSDLRAQIGELKIELALFDATEDFPALPLENTSSSPQAIPSVPAVADIKVQKRIVNESDIKSAVED
DVKVREAKRVVDRYSAIVLDLEVKDMVRVSRDYYNQMRKNMEEAERKLAQERTLARDRATKELQRIVEEEYERQKEVVAR
TFAWQKEQLAKQQEELKKQQANSAEEQKAAQQAYIAAQERERERQRKALLAKLNILQAQHDEERERLEQYGGTTAELQFA
NDELTVASDVLTKLRGRVAAIRTERRQDGAVRTLASATPPKSPVEKMPYKKLLMASAIAFAVPFFLGLLWEYKIQRLTDA
ETHDKNHDLAPVLGEIARLPAGHGAAKGRRVFEESIDTLRANLFLSMDTRNTRSIAVVSSMSGEGKSSVASQLALSIAKA
TGETVLLVDADLRCPDQHEIFGLDMGRGLTSLLAKQTELKDVVDTSLGNLIHLLPAGRLSASPHRLINPANIDNFVSSAL
EQYQYVVFDTAPVLAAGETLAITAVVDSTLICVMRDVSRKESVVRTTRRLEASGASVAGTVFSGVSARQYAYRYGDYHYA
IGGEPVAT
>gnl|bykdb|Q7UVS9 [Bacteria] Bacterial tyrosine kinase [Planctomycetes][Rhodopirellula baltica] (length=856 residues).
MTPNSNSTEPSAGKRGPNSFASYPSQNAGTMGQAAMGSYPAMNEGWGSSGSAQTAESADLMGAIWRYRWAALVPTILGAV
IGFLVFVKTPESFQSGTLLMFESDRPAVIDTMTGDLIGGVPSIDILRSQLLSDKVTRNAFENESMEVFRESLGGHPSALL
GLANNALKFETNIQDARSASSLVASLSFEHSDPELCEAAVKAYSAALQQLFAEKHKSSRGELLRLIRDATDNLQPKLSEL
EKDYRAFRTKASLVWNENGEAINPHRERQLYLTERRSELFETLRSQSVELSAVESIAKEADDPLVRLSIIGQLMGKTFEM
PESNEISQNMRDGDAQLAQIELDQQLVPLMIERNKFAAEFGEQHPTVKALDAELTMMKSELKRLVKEQSERIVELMEQNK
VEGVDPRKRAEEAVNVILTASRAEVQLLKQQISEIDSQIAGERIEAMKLAQDEQENASMLRQIDRNRELINQLDEQMARV
ELTEEEGGVQVSELRAPSRAYRIGPNLMKMLGIGTFLGLALGCGLAVLLEKNANTFRDPEEIIAAVGAPILTHVPFFKGR
VKRKKGEASNPFELLDPHLAVVHAPSSVASESIRSCRTSVLFELAGVEGGKVLQVTSPLPGDGKSTIAGNLACSIAQSGK
RTLIIDCDLRRPQVTDNFAMADQLGLVDVLNGKCEHVDAAHDTPLSTLKMMPSGPIPANPAEALTLPEMSELLDVLREEY
DYIILDTPPLLVVTDPSITASMTDGVVMALKVRRKSKPNAKEAASILANVGAKLLGVVINSSDEGSNNDGYKGYGYYRYG
RHTNRYYRKTADNGAKAGQRRSPVVVSGRGQAARSARPIAVPPATAPSIEQERSDV
© 1998-2019