BYKdb

Dataset for cluster cd of phylum proteobacteria

[Download (right click)] [Alignment] [Repertoires]

32 sequence(s)

>gnl|bykdb|A1ARV8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pelobacter propionicus] (length=282 residues).
MSRIEKAMERAAQVRNSAGVMRQPQETAARSGMVHTAPLPDMVVNKVMSDDPLLVSLNDPASPVAEEYRKLKAILVKMTS
VHPFKNVLMVTSAIPNEGKSLTSLNLAISLAQEYDHTVLLLDADLRRPSLHRYLNIERNVGLADCLTRGVDLGEAIIPTG
IGKLSVVTAGCAVSNPAELLSSARMKTFVEEIKHRYTDRYIIFDTPPLLPFAETRSLAHLVDGVVFVVKEQTATKDNVSD
AIEALKGADLLGIVYNDTTITQNVERYYSYRSYAAVSPGESA
>gnl|bykdb|A3K8W7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sagittula stellata E-37] (length=607 residues).
MNMMDSRKFRRKRKPLTTETPSPQEDASKDMAPVPPLETREERLARRAREEGEGQTRPDPDAARQARAREAARIAAAAAR
QKAEAESKAQADAQRRAEEQAHDEAEAEAQRQAEEQARAKAEAEAQRQAEEQAHAEAEAEAQRRAEEQARAEAEAEAQRQ
AEEQARAKAEAEAQRQAEEQARAKAEAEAQRQAEEQARAKAEAEAQRQAEEQARAKAEAEAQRQAEEQARAKAEAEAQRQ
AEEQARAKAEAEAQRQAEEQARAEAEAEAQRQAEEQARTDAETEGRRRKLAEARQAAKLRRAEEARRAAEADADDADDED
EDGTAEQADTPVARPAPAMPTLALTPEQRSPAADQTPLPQSTRLQTDTAWRDLPVARFELSQLNRHRVVTADRLDPAHAT
FDVLRTRLMHTLSERGWKRVAVTSPGKGCGKTFTVANLAISLSRQENTRTLVMDFDMRRPSLHRVLGVDSPGPIGDVLRG
KLAPEDHLIRLGENDFNAGHNIAFGLNTVTEAYASELLQDPRTRVTLDRIEEELRPDVVLFDLPPALSYDDVIAFQPLFD
GVLLVVGGGLTTEREVKEVERRLGTETPLLGMILNKAEGVDVERYAY
>gnl|bykdb|A3W0H7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Roseovarius sp. 217] (length=377 residues).
MKLKRHEEYMRRRAARRAEMEAEAEEDAAVLHPNLDWPDDEDSVLATVPELLNLPEPEPEPEPEPEPEPEPEPEPEPEPE
PEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPVVASDVAPEPTPAPPPLLWPALRRVVLDPKHLAMHRLIS
ATREDPAHVAFDVLRTKLLAALRANGWHRVAITSPSPDCGKSFVAANLAISLSRQSSVRTVLMDMDLRRPSLAHTLGQPD
PGRMAGFLSGDLPLERFLACPEDNPLHIGQTLAMGLNDRAEPYAAEILHAPETGEVLQDMYRRLAPDVVIFDMPPALYYD
DVLGFRPQFDGVLIVVGGGRTTARHLRDLKARFGTDTPLLGVVMNRAEGESIAKYGY
>gnl|bykdb|A5G424 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Geobacter uraniireducens] (length=275 residues).
MSRIEEALEKAARLRSSERSNVTVGKTVATAVHVPPLPSSPAAAKIENPFIVTVNDPHTPAAEEYRKLKSILVKLTKGEH
FQNTLMVTSSVGSEGKSLTALNLAVSLAQEYDHTVLLVDADLRKPSIHQYIGLDPKVGLAECLLDGVDVGEAIVNTGIGK
LSVLLHGKTIRNPAELFSSLRMKELVKELKHRYPDRYIIIDTPPVLPFAETRSISTLIDGIVFVVKEGAASLNDVSDAIA
ALKGTNLLGIVYNEASIDGFNDRYNYYYRYDAEKW
>gnl|bykdb|B5EA81 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Geobacter bemidjiensis] (length=294 residues).
MSRIEEAMEKAARMRNGMEPPPPESVREPAGASALPPQTPQPVGSPALPPQPPQIPAVSPQYGRLAPQNPFLVNLHDPHS
PAAEEYRKLKSALVKMTTGDVFRNCLMVTSSIPSEGKSLTALNLALSLAQELDHTVLLVDADLRRPSVHRYLNVEQGVGL
SELLTGEAQVGETIIPTGIGKLSIIRAGRAIENPAELFTSQRGKALLTELKLRYPDRYIILDTPPVLPFAEARSLAHLVD
GVLFVVMERLVSQANLKDALESLKACPILGMVYNAAAVDDKDGRYSYYRSADNA
>gnl|bykdb|B9M2X6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Geobacter daltonii] (length=281 residues).
MSRIEEALEKAAKMRGTDGKAALGKVPGSPLAVAHGSVHAYQQPMPNERLKVKNPLVVSVTAPQTSVAEEYRKLKSLLVK
LTNGDRFRNTLMVTSAFASEGKSITAINLAVSLAQEFDHTVLLVDADLRKPSIHKYFGFEPKLGLTDCLTRGIDVGETLI
KTGIGKLSILPYGKKVENPGELFSSSKMKSLIAEIKSRYPDRYIIIDTPPVLLFAETRTISTIVDGIVFVVKEGAASVKE
VNDALTALDKSNLLGIVYNETVNENLNGHYHDYYQHKQYAW
>gnl|bykdb|C0QCJ2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobacterium autotrophicum] (length=285 residues).
MGKIFKALEKSKEIDMGDSAVVENDSREDDLQDDTAGEENSRGDESPETGAHVQEDPQTIELPQSLDKSLVTHLKPHSSE
AEQFRILKTTILFPKTGIPPRTIMVTSTAPGEGKSFVASNIAISIAKSIDEHVLLIDCDLRLPSLHTRFGFSDIPGLSEY
LRAGKSLGSILRKTAIDKLSLLPAGKPPANPSELISSEQMRRLLQEVKGRYEDRYIIIDSPPPYLTAEANALARQVDGII
IVVKAGKTKRSDVQDLIDTYGKEKILGVVKNFADARHGFKKYEYK
>gnl|bykdb|C6DZX5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Geobacter sp.] (length=294 residues).
MSRIEEAMEKAARMRQGMEPPPPGAAPQSAGNSALPPQTPQPVVSPALPPQPPQISPVSPQYGRLAPQNPFLVNLHDPHS
PAAEEYRKLKSALVKMTTGDVFRNCLMVTSSIPSEGKSLTALNLAISLAQELDHTVLLVDADLRRPSVHRYLNVEQGVGL
SELLTGEAQVSETIVPTGIGKLSIIRAGRAIENPAELFTSQRGKALLTELKLRYPDRYIILDTPPVLPFAEARSLAHLVD
GVLFVVMERLVSQANLKDALESLKACPILGMVYNAATVDHNDGRYSYYRSADNA
>gnl|bykdb|C7LPS3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfomicrobium baculatum] (length=266 residues).
MSRIEEALAKAAGMQSGLHSKGNRAGVSGIARAPMGESTSVGGVRLAEETMVVINAPLSPMAEEYRKLKEALVKMTKRER
FDNLIAVTSSTAGEGKSMTAVNLAASLAGEYDHTVLLVDADLRRPAVHKYLGLGSCKGLSDCMREGLDVGELLVKTGIGK
LSVLPAGTPTPNPVELFSSDAMRSLFREMKIRYGDRYIIVDTPPVLPFAETRSIASIVDGVILVVKEGMPSLEQIEEAID
ALDQKVLGIVYNGAHLQSRSSYYYAE
>gnl|bykdb|D0D9W0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Citreicella sp. SE45] (length=331 residues).
MTERRRFRRRNRPLDDLPDEDIAPVEPLGTRAEGLARRETKTSAAQATRRAEAERVAEPARPEARRGQTAPRPAAPAVAT
RTAQSPTLPQQRGWDDLAEFSVDARHLERNRIVTAARQDPAHAAFDILRTKLLQGLADHGWKRVAITSPTKDCGKTFTAA
NLAISLSRHQNCRTLLLDCDLRRPSLHKIMGFRDPGFMGDMLRGLLPPERHLVRMGENAIHAGHNIACGFNGAVEPYASE
LLQTPRTAETLRQVETMLQPDVVLFDLPPALYFDDVMAFRPLFDGVLLVIGGGLTTDKEVREVERLLGKNTPLLGMVLNK
AEGTSLDKYTY
>gnl|bykdb|E7T801 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Shigella flexneri CDC 796-83] (length=513 residues).
MQETFTVSERSKESGMLELTMTGDDPQLITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVY
RQQRDSVDLNLEAKAVLEQIVNVDNQLNELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVL
RLSRDVEAGRAVYLQLLNRQQELSISKSSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGV
EAPEQLEEHGISVYATIPMSEWLDKRTRLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNI
LMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVIT
RGQVPPNPSELLMRDRMRQLLEWANDHYDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGV
NIKGAILNGVIKRASTAYSYGYNYYGYSYSEKE
>gnl|bykdb|E8WSZ5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Geobacter sp.] (length=290 residues).
MSRIEMAMEKAARLRENGGQTPAQDQAQARPDTATAAAAPRAREAERVPPVVPAGQALSPQNPFLVTILDPHSQAAEEYR
KLKSMLVKLTDGENFKNAVMVTSSVPNEGKSLTALNLAVSLAQGLDHTVLLIDADLRRPSLHDYLEIEPGAGLSDILKGE
ADIGETIVQTGIGKLAVIRSGSQVENPVELFSSQKMRALVDELKRRYPDRYLIFDTPPVLPFAESRALANIVDGTIFVVR
ERLATQAEIKEAYDHLKGSGVLGVVYNAADAAAGDESLSYYKHYQKTPAA
>gnl|bykdb|E9TE88 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli MS 117-3] (length=200 residues).
MMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLLIDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTS
IAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVLIDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSL
SRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|F0G6H5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia sp. TJI49] (length=308 residues).
MAVVAALLLGVLAAGAYLMLRQRFVGTVSDPGEIEWTTGLPVIATVPRGESPRLAGADARNRPHASAASRGGLADPAIES
LRNFRTTLQLSLPDAPNRIVLISGPTTGVGKSYIASNLAALAAAASQRVLLIDADLRKGALHDHFRYSRAPGLSDVVMGT
HRLDEALKRDVRPGLDFLSMGSIVADPGEVLLQPALAELIERLSSQYRMIVIDGSPLLPVTDGLALGRLAGIVFLVARSG
VTTLTEIDESVRRLQDVQVDVRGVILNDFARGPGHGYGYGNAETHQAASGYAGMMAHRPAGAGGKGDR
>gnl|bykdb|F0JCB8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfovibrio desulfuricans ND132] (length=292 residues).
MSRIEDALKKASEKRDENRRREPETVPSVEPVAAPVMEAASPVDASLDFSPLQSDCLDRARQQRMLVAMNEPISLAAEEF
RKLKQSLVRKTKREGFQNTILVTSGTVGEGKSVTAVNLAISLAQEFDHTVLLVDADIRSPSCHELLCMENGYGLSDCLVD
GSPIGKGLVKTGIGKLSFLSAGSPVPNVGELLASKRMAESLAEMKNRYADRYIIIDSPPVLPFAESRNLSRLADGVVLVI
KEGQASQADLRDTIEALQGSNILGAVYTQASRMHRSLNADAYMKYKYYHYAS
>gnl|bykdb|F3CAY9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas savastanoi pv. glycinea str. race 4] (length=645 residues).
ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
LIAGKPGQFSLYDNEHNLLLGGTINRIVEGNGVKIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYL
SIEDQDAQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLSIETKGVLDQ
VVSLDSMLSELKLRRVELERLYTREHPTYRSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNK
SQEQDILRAGSIGNVRVIDNADTNVEKPVKPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGMPVYASLP
HSRQQERLEKRDQDSKDSRLLSIAAPGELAIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGR
RVLLIDADMRKGYLHRLFGLQPKHGLSDTLAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNKMLAELSPLY
DLILIDTPPILAVTDATLVGRQAGTCLLVARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNY
HPAPR
>gnl|bykdb|F4SM97 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli H736] (length=509 residues).
MQESFSVTDQGKDTGILTLTLRGEDPKHLEQVLDSISDNYLAQNIARQAAQDAKSLEFLNAQLPKIRSDLDLAEDKLNQY
RRQKDSVDLSLEAKSVLDQIVNVDNQLNELTFRESEISQLYTKEHPTYKALMEKRKTLQDEKSKLNQRVTAMPKTQQEIL
RLSRDVNSGQAVYMQLLNRQQELNIAKSSAIGNVRIIDNAVSQPKPVKPKKILVLAVGFVLGLIVSLSLVFSRIFLRRGI
ESPEQLEEIGINVYASIPVAENSVKKASQIKRFKQKAEKEYTTFLFIENPADLAIESIRGLRTSLHFAMMEARNNILMIS
GASPNAGKTFVSSNLAAIIAQTGKKVLFIDTDMRKGYTHKLFNKNNENGLSDVLSGKIAFEKAIKQIDTCGFDYISRGSV
PPNPAELLMHRRLNELLIWANSQYDIVILDTPPILAVTDAAIIGQYVGTTLLVVRFEQNTVKEIEVSFKRFEQSGVTVKG
CILNGVIKKASSYYGYGYNHYGYNYGEDK
>gnl|bykdb|G5LQM6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Salmonella enterica subsp. enterica serovar Alachua str. R6-377] (length=511 residues).
MINNLQNNLTVTETGKDTGVLSLTFTGEDRDKIRDILNSITRNYLQQDIARKSEEAGKSLAFLAKQLPEVRSRLDVAENK
LNAFRQDKDSVDLPLEAKAVLDSMVNIDAQLNELTFKEAEISKLFTKAHPAYRTLLEKRKALEDEKAKLNGRVTAMPKTQ
QEIVRLTRDVESGQQVYMQLLNKQQELKITEASTVGDVRIVDPAITQPGVLKPKKALIILGSIILGLMLSIVGVLLRSLF
NRGIESPQALEEHGISVYASIPLSEWQKARDSVKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVL
MLTGVSPSIGKTFVCANLAAVISQTHKRVLLIDCDMRKGYTHELLGTNNVDGLSDILAGKGEIASCAKPTAIANFDLIPR
GQVPPNPSELLMSERFGELIAWASSRYDLVLIDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFDQNGIQ
VKGVILNSIFRRATGYQDYGYYEYEYQSDSK
>gnl|bykdb|G5Q4J0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Salmonella enterica subsp. enterica serovar Montevideo str. S5-403] (length=519 residues).
MSKFSTLGMINNLQNNLTVTETGKDTGVLSLTFTGEDRDQIREILNSITRNYLQQDIARKSEEAGKSLAFLAKQLPEVRS
RLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQLNELTFKEAEISKLFTKAHPAYRTLLEKRKALEDEKAKLNGR
VTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITEASTVGDVRIVDPAITQPGVLKPKKALIILGSIILGLMLSIV
GVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARDSVKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAM
MQAQNNVLMLTGVSPSIGKTFVCANLAAVISQTHKRVLLIDCDMRKGYTHELLGTNNVDGLSDILAGKGEIASCAKPTAI
ANFDLIPRGQVPPNPSELLMSERFGELIAWASSRYDLVLIDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLS
RFDQNGIQVKGVILNSIFRRATGYQDYGYYEYEYQSDSK
>gnl|bykdb|G5SDT8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Salmonella enterica subsp. enterica serovar Wandsworth str. A4-580] (length=511 residues).
MINNLQNNLTVTETGKDTGVLSLTFTGEDRDQIREILNSITRNYLQQDIARKSEEAGKSLAFLAKQLPEVRSRLDVAENK
LNAFRQDKDSVDLPLEAKAVLDSMVNIDAQLNELTFKEAEISKLFTKAHPAYRTLLEKRKALEDEKAKLNGRVTAMPKTQ
QEIVRLTRDVESGQQVYMQLLNKQQELKITEASTVGDVRIVDPAITQPGVLKPKKALIILGSIILGLMLSIVGVLLRSLF
NRGIESPQALEEHGISVYASIPLSEWQKARDSVKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVL
MLTGVSPSIGKTFVCANLAAVISQTHKRVLLIDCDMRKGYTHELLGTNNVDGLSDILAGKGEIASCAKPTAIANFDLIPR
GQVPPNPSELLMSERFGELIAWASSRYDLVLIDTPPILAVTDAAIVGRHAGTTLMVARYAVNTLKEVETSLSRFDQNGIQ
VKGVILNSIFRRATGYQDYGYYEYEYQSDSK
>gnl|bykdb|G7EJX6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudoalteromonas sp. BSi20652] (length=596 residues).
MLLSPEEQAAQQMLSLVAVFNAKLSIEPVRSTQLVKISFESSDPKLAALVANTVGEVYIESQMRAKMGITQQASNWLNTR
LSQLRIQLDTSEQKLQAYREAQKLVDIEGIAGLVTQELEQMSQQLVVARNEKNNLQSINRVISEYGNNNLELLGSMPEIT
SHKVVQDVKREVILVERKVSELSEVYGPKHPKIISAKAELATVKTNLNKQIKGLITGIEKELNRITRTVSALEADLAKIR
AEYQNITRKETQYNQLKREVETNRSIFNTFLSRSKETEVTSDFTSAAARFTDRAYAPNKPSKPNKKLIVVLAFVASFGFA
IVMSFVFDALNDTAKTKNDVEGKLAQRMLGLLPHVKLPKNSVFPIHAYLDENYRRFAESVRTFRTSLLLTQLERDLKVIA
VTSSSPGEGKTTTSANLAMSLAQMGKVLIIDGDLRKPSIAKRFDIPVFHPGLSNLIVGTEELTECVHIDEQSGVAIMPSG
QIPGNPLELLSNIRFSELLELLKAKYDHIIIDTPPTQAVSDALVIAQSADSVIYVVKSDVTRIKPIKAGIERLFESKAHV
AGIVLNQVDMSKSNDEHSYGYYDYHDYSQKPEQPTA
>gnl|bykdb|G7QCG1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfovibrio sp. FW1012B] (length=273 residues).
MSRIEEALGKAAERQAGMPRPEARLFFRQEATLPPPSQAIDPARLSEEKLVVLKSPASPEAEEFRKLKEALVKAIRDPDN
FNNIILVTSAHHGEGKSLLVVNLAISLAQEFDHTVLVVDADLRAPTCHRYLEVAPERGLSDCLLDGLDVGQALINTGIGK
LVLLPAGKAVKNPMELLSSNSMRRLMTEIKQRYRDRIILVDTPPVLLFAETRSLADVADGAVLVVREGKTSLEDVQESLT
LLNNKVLGLVYNATDYVKPCSSYYSSYYAACND
>gnl|bykdb|G8AU96 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Azospirillum brasilense Sp245] (length=403 residues).
MNLRRGVGELKLRIRDEVGKIQKGLDADLEVARIREATLLKSIADLQEQQKGIEATGIQLRDLERAADAHRTLYRSLAER
YEQTMALKNTGALDAHLSAPALPPIRPAFPQLRMSLGVGLVGSTALAVALVLLLERLSSGLRTPTQVERATGVPCLGMVP
SLPRNEATWNLPLHPDSRRAREIGAFREAIQTVRTMACMPRKRGTPPKVLLVTSSIPKEGKSVLAANLARSLAGLGLNTL
LIDADFRRPSIAKLLGYQPHGSVADLLDGRVGIDDLIHQETTNLGVLGNAVGTPDAHDRISSQAMSDLIQWARHNYDVVV
IDSAPVMLFSDALALSFLADSVIYVVRWQHTPLDTVTAGFNKLKSVDSAVGGVVLSRVVASKHVKYGHKDDAYYYALHAP
ARH
>gnl|bykdb|H8YYB9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Thiorhodovibrio sp. 970] (length=279 residues).
MERIKQALERARAERAAAQLADVPVLSTQKVIAQEQETKPAGPGVQVSYTETRSLSLDPEQLRAKRVLLNEVRSPIVDAY
NVLRTRILQRLRANAWNAVAITSPRPGCGKTLTSINLAISLAREVNQTVLLVDLDLRRPSVIRYFTDADLPGVSDYLLEQ
RELAEILVNPGIERLVLLPGHSSFTNSSEMLSTPRMVRLVTELKTRYPDRIVLFDMPPLLAGDDVLAFSPYIDAIMLVVE
AGGTTRDDLRRAWNLLGGKRILGVVLNKADGDSSGDGYY
>gnl|bykdb|I1AYC5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Citreicella sp. 357] (length=381 residues).
MTDDRKFRRRNPLSAEIAAGEQAAKLARAEDARRMAAAEEQSRIAAAQEAERQHKLTAERQAEAGRRAAAERQGEVERQG
EVERLAEVERRAKAEQQAEAKRRAEAEQLAEATRRAEAEHQAQAERQAGADRQAKDDASPDMVWSRLPVFSVNARHLDRN
RIVTAGRQDPAHAAFDVLRTRLLQALSENGWRRVAITSPTKDCGKTFTAANLAISLSRHQNCRALLIDCDLRRPTLHKVM
GADNPGSMGDVLRGRLSAEEHFQRMGDNDIHAGPNVAFGFNGVVEPYASELLQSPETAQTLETIERRLAPDVILFDLPPA
LFSDDVIAFRPLFDGVLLVVGGGLTTDKEIREVERRLGENTPLLGTVLNRAEGTQLSKYSY
>gnl|bykdb|I2Q341 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfovibrio sp. U5L] (length=273 residues).
MSRIEEALGKAAERQAGMPRPEARLFFRQDAPLPQPSQAIDPARLSEEKLVVLKSPASPEAEEFRKLKEALVKAIRDPDG
FNNVILVTSAHHGEGKSLLVVNLAISLAQEFDHTVLVVDADLRAPTCHRYLEVAPERGLSDCLLEGLDVGPALINTGIGK
LVLLPAGKAVKNPMELLSSNSMRRLMTEIKQRYRDRIILVDTPPVLLFAETRSLADVADGAVLVVREGKTSLEDVQESLT
LLNNKVLGLVYNATDYVKPCSSYYSSYYAACND
>gnl|bykdb|I5B296 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobacter postgatei 2ac9] (length=284 residues).
MGKIFKALEKAGNKVTAEKESELRDDTALVCDNPDSQVYKQSDEVTQSGSRRTDSALVTASDPHSPVSEQFRLLKNNILF
PEKGTPPKTIMVTSASPHEGKSFVAANLAVSIAQSIDEYVLLMDCDLRSPTIHTSFGYSGKEQGLSDYLAKNIPLSSVLK
KSSVNKLTILPAGQIPPNPSELLSSDQMRRLLHEVKLRYNDRYIIIDTSPPYITSETNAIARFVDGIILVIRHGKTRIKE
VLDILDIYGREKVLGVVTNFSKKTIGYGYGYHKSGYGYGYHQQR
>gnl|bykdb|Q0FMP0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pelagibaca bermudensis] (length=380 residues).
MTMVERRKFRRRNRNPIDDGPEEPPIEPLESRDRRLERRRAEDKAALAEETAHAAEEAARRSAEEQARQRAAEEARLQEQ
REAEAREEARRQTTAKREEIRKRLRVHDGDKVTAPATASAPVEAETAPAQAPRSPARKPTPLWHRLQEFTVNPRHLERHR
IITAERQDPAHAAFDVLRTRLLQALAERGWTRVAITSPTKDCGKTFTAANLAISLSRQQNCRTMLIDCDLRRPSLHKVLG
VKNPGSMGDVLRGLVPPEDHLIRMGENEIHAGRNIAFGFNGTVEPYASELLQSPQSRTALRHIEDEFAPDVMLFDLPPAL
YYDDVMAFRGQFDGVILVIGGGITTEKEIRETQRRLGDDVPLLGTVLNKAEGSKIRQYTY
>gnl|bykdb|Q314L3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfovibrio alaskensis] (length=295 residues).
MSRIEQALARARKDKEHNAEDTPPRPAGGGGAPSGVPHTPAEDSGGPAGPLPAPRVAAARQVRLSPKLVTATAMQSGLSE
EYRKLKERLVKLTKRSGFQNMLMVTSALSREGKSLTSANLAISLAQEFDHTVLLIDADLRGPTCHELLGVARTPGLTDCL
LDGTDVGEALVPTGLGRLSFLPAGRAVPNPGELFASTMMQDLLLQMKHRYTDRYLIIDTPPVLPFSETRSLSRVVDGVVM
VVRENVATMEDLRESLEALEGATMLGVVYNNARSGGGRRGRYGYGYGYGGYGSGA
>gnl|bykdb|Q39U17 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Geobacter metallireducens] (length=283 residues).
MSRIESILEKAAKMRQDKTPGESRVLVEQREVPRAVIEPEVFQPDTRIAVDNPYLVTISEPRSPVTEEYRKLKSIILKLT
NSGQFKNTIMVTSAVSGEGKTITSINLAVALAQEFDHTVLLVDADLRRPGTSSYLGIRAEVGLSDCLYGKVDVKDALVKT
GIGKLVVLPAGSRVENPVELLSSGRMQSFIAEIKNRYPDRYIIIDTPPLLSFAETYSLANMVDGVVFVVKEGGATMSNVK
DALGHLKKEKVYGVVYNNVGINRFDENYRYRNYYAYYKDNGAQ
>gnl|bykdb|Q74BQ8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Geobacter sulfurreducens] (length=309 residues).
MSRIEQALEKAAMLRGTTDRGQAVAPRQMEDLQPLERAELPPLPAEPLEGIRHDNPLLATLNDPHSYVSEEYRKLKSAIV
AGTSVGEFRNTIMITSTLGGEGKSITALNLAITLAQEYDNTVLLIDADLRKPMTAQYLGIPGERGLSEYLSVGAHLPELL
VRTGIGRLSILPAGKPAANPVELLSSQRMKDLLDEIRHRYPDRYVIIDAPPALPFAEVRSLSNLVDSIVFVVREGQSSLA
NIDEAISALNRKKILGIVFNEASAVGISSKYGYGYGYGGYGPSAEPAEARSTAEKTGKLSRILGKRGSK
>gnl|bykdb|S9QRP1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Salipiger mucosus DSM 16094] (length=432 residues).
MAERRKFQRRKRRLSEDVAPETPIAEPRPEDRIDPAEPRRPEQDLRADVEPAHRERAQATMRRIADARRASEARLKAQQA
HEAEKARAAEAAKAAEEDAARAAEAAREAEAERKADAARTAAAEQAAEVARQKNAAREAEAAQEAARAAEQADQEAAVAH
DPEPDADGAAPAAPTQAEAPVAKNSARGTTTADPWDALRSISVDERQLDRNRVITAGRHDPAHTAFDVLRTRLLQALAEH
GWTRVAITSPTKDCGKTFTAANLAISLSRQENCRTLLLDCDLRRPSLHRVLGVEPPGAMGDMLRGVVPPEQHMLRMGPNT
IHAGHNIAFGFNTESEPYASELLQDPRTAATLDDLQTRFAPDVMLFDLPPALFYDDVIAFRPLFDGVLMVVGGGITTERE
VREVERRLGDSTPLLGTVLNRAEDTQIRKYSY
© 1998-2019