BYKdb

Dataset for cluster orphancd of phylum proteobacteria

[Download (right click)] [Alignment] [Repertoires]

717 sequence(s)

>gnl|bykdb|A0A010SNS0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas fluorescens HK44] (length=268 residues).
MEIIKPDTENSEQQPSSSLVTMPKAMTVTGQSAGLNALSYVQTKVVPLRPEHLESNRIVAYNKNSNMGGAFDLLRTQVLK
VMGENDWRTLAITSPTPDAGKTVLAINLAMSIAHHTTKTALLVDFDLRRPMVGACLGLPMEKSLNELLANEAELQEVLVN
PTLPRFVVLPTREPIPLSTEVLSSPTVSHLITDLRERYDSRIVIFDLPPLLSSDDVITVLPKFDCVLLVVANGMNSKKEI
EESLYHLGTANLIGTVLNKAEPPNRSYY
>gnl|bykdb|A0A024KA69 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Devosia sp. DBB001] (length=522 residues).
MALAVAAGLALASAALLVMPVSYSATALLYFDPSPRGVLEDGRPGAGDGARVDSAVDLIASEPVLASAARALGLAGERAP
DWLGSRVKVQRDGPTYLVSVRANAPSPIEAASYANAVANSFIHEEVAAKIDGVLADVAALRAQVTVAGEAVRAAQQALGL
RSGFEERQALASAQSHYRMLLDRLTRLEAEAFLQVPSARIAAVASPPVAPSSPKVGLTLALAGGVALIFGLLLAFARERV
TPGFVDAEEAGRRLGLEPILTIPRQKLQRGRDGELWLTPADQLAQAPLAEFPEAVRRLRISVDQALQRKSVAHRGAVVMV
SSATGGEGKTTLALALARSYGLAGHSVLLIDCDLRNPSIHRYLGLEPSRGLLEYLAEPAEPRQLKAMMAEDDVSGVRIAL
GGLGAQDATDELVAGSEFARLIAAAVQSFEFVIIDSPPLGSVVDGLHLARLADVVTFVMRYRSVPRNAAAQALAALAHTR
REQSELVGVLNLGPAPTGSKAYRAATYVPKLSPSLRQASHWH
>gnl|bykdb|A0A059IPK4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Defluviimonas sp. 20V17] (length=283 residues).
MERLEAAMAKARAARKATKDGEAPDHRPRQAPQPDSGRPIKDVRPEALWTALHEIPIGNALARKMRLSALMGSEFAAPYD
ILRTRVLRQMRAEGWKRLAVTSPNKACGKTTVSLNLALAMARQADLRVMLLDFDLRRPSLARLLGQQAGSHDLAALLAGT
RDFSEHAVRFGPNLAIGLNRRPVPHSAETLLGSSTASTLDDIESRFKPDVIIFDTAPMMGNDDNLAFLGQVDCALLVAAA
DSTSARQVDSSERDLSGLTNVLGTVMNKCRYLDEHDGYGGEYY
>gnl|bykdb|A0A059L434 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas mandelii PD30] (length=262 residues).
MEMFNPDTEKAEQQTSSKAMTPTVQSTGLNALSYVQTKVVPLRPDHLERHRIVAYNKNSNMGGAFDLLRTQVLKIMEENG
WRTLAITSPTPEAGKTVLAINLAMSIAHHTTKTALLVDFDLRRPKVGEYLGLPMDKSLNELLADEAELQEVLVNPTLPRF
VVLPTREPIPLSTEVLSSPAVSHLIADLRERYNSRIVIFDLPPLLSSDDVINVLPRFDCVLLVVANGLNSKKEIEESLHH
LGTANLIGTVLNKAEPENRSYY
>gnl|bykdb|A0A062ME93 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter baumannii 1288284] (length=400 residues).
LEKLKIELQQKQAELSAKYTNDHPLIRQIDAQIAEINKKIADLNNRLTQLPETQRLYLQLYRDVKVNTELYTSLLNSYQQ
LKIANAGEIGNVRIIDTAVEPVKPIKPNKLIILALSILAGGFIGVLIALLRNMMRSGVKDSTQIETELDLPVYATVPRSP
IQETRMSILKKKKSIPILAVKSSDDIAIESLRSIRTAIHFALTSAKNNIIMIAGPSPEVGKSFISTNLATIFAQGNKRVL
LIDADMRRGYMHKYFDIDVKPGLSELLSGQTDLQQVLHKTQVANLDVITRGKSPTNPSEMLSSPQFKELLEQLQTQYDHI
IIDTPPVLAVTDGIIISQYTGVNLIVARYIKSHMKELELTVNRFEQAGVKVNGFILNDIQRSSGGYGYNYAYAYKAQKED
>gnl|bykdb|A0A087LTV7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Devosia sp. 17-2-E-8] (length=543 residues).
MHEDAWDLRGLEGAIRRQWRVVALAVAAGLALASAALLVMPVSYSATALLYFDPSPRGVLEDGRPGAGDGARVDSAVDLI
ASEPVLASAARALGLAGEQAPDWLGSRVKVQREGPTYLVSVRANAPSPIEAASYANAVANSFIHEEVAAKIDGVLADVAA
LRARVTVAGEAVRAAQQALALRSGFEERQALASAQSHYRMLLDRLTRLEAEAFLQVPSARIAAAASPPVAPSSPKVGLTL
ALAGGLALIFGLLLAFARERVTPGFVDAEEAGRRLGLEPILTIPRQKLQRGRDGELWLTPADQLAQAPLAEFPEAVRRLR
ISVDQALQRKSVAHRGAVVMVSSATGGEGKTTLALALARSYGLAGHSVLLIDCDLRNPSIHRYLGLEPSRGLLEYLAEPA
EPRQLKAMMAEDDVSGVRIALGGLGAQDATDELVAGSEFARLIAAAVQSFEFVIIDSPPLGSVVDGLHLARLADVVTFVM
RYRSVPRNAAAQALAALARTRREQSELVGVLNLGPAPTGSKAYRAATYVPKLSPSLRQASHWH
>gnl|bykdb|A0A090R136 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Photobacterium aphoticum] (length=452 residues).
MHFLSDHLPNIKSQLTIAEDLLNAYRQENESIDLGLEAKSTLDMMVKIESQLNELTFKESEISQRFTKEHPAYIALLDKK
SVLISERKKINKQVQDLPKTQREVLRLTRDVEVNQQIYIQLLNKVQELNIMKASTVGNVRVLDEAQIYPNAVKPNKALLV
AISVMMGFLLSIIGVLLRAAFHRGIENPDEIEAIGLPVYASIPMSDWQVELEKKQNRKKTLTVQDTLLAISNPADLSIEA
LRSLRTSLHFAMMEAKNNIIMISGPSPGIGKSFVSANMAAVIAKSGQKVLVVDADMRKGRMEKQMAVNPTPGLSTYLSGQ
TNIESLIKQPGIEGLDFIGRGEVPPNPSELLMHPRFKQLMDWAVEQYDIVIVDTPPILAVTDAAIVGAHAGTSLLVGRFG
QNAVKEIEVTKQRFEQNGIEIKGFILNAVVRKASTYYGGNYGYYNYSYESNK
>gnl|bykdb|A0A091C4A8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Arenimonas composti TR7-09 = DSM 18010] (length=609 residues).
MTAPAPWKLLLGLAGETDDEELDAAHLAATESVRQTLRINSFLASLSIEPVRNSRLVRVHFDSPDAAFSQRVVNAVAEAY
IASNLERRFDASSYAKTFLEERLEQLRIQLEDSESRLVEFAQRERIVDAIDGSSLSTQSLSELNSTLAAAQDQRIRAEAR
WKHAESASGMGLSAVLGSEIVQALQERRADLQAQYQDKLSIFKPAFPEMQQLQAQIDELDRQIQTEVGNIKAAIRGEYES
ALAQEQMLRAQIDALKDEVLDLRNRSIEYNILRREVDTNRQQYDALLQRYKEIGVAGGVGTNNISIVDPAELPISKYKPR
LSMNLAIGLLLGLVVGLLLALLFEVIDDSVKHPEDVERLLGQAVLGVIPLLKSPMTPARAIADPRSAFAEAYRSLRTALQ
FATESGVPRSLLITSASPSEGKSTTAFMLAQNFAQLGKRVLIIDADLRNPSLHRAVGSDNSAGLSNYLSGAAKAMDVIKQ
TELSNFSFLSSGPLPPNPAELLAGPKMIALVKVASDKYDHVIIDGPPVMGLADAPTLANMTSGTLLVIEAGGTRVAHAKN
ALKRLQAARARVIGALLTKFDAKVSGYHYGGYNYYSYGAGESTKKLTAS
>gnl|bykdb|A0A095CTW3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhodovulum sp. NI22] (length=246 residues).
MVRPLQQNVVEAWDALQPLSADPKLLQRNRVYTSLGNAHATPYDMLRTKMFQLMNANGWRRVAITSPSPGSGKTTTTANL
ASSFGRQVDLRSVVMDMDMRRPSLARVFGHSGTYSVFDVLEETVPFAEQALRFGKNVALSMNTKTARDPSELFLRRRTAE
IIDEIENTYQPGIMLFDMPPVLSNDDTRAFLDNVDCALIVAEAEQSTIKQIDLCERELAEQTNVLGIVLNKCRFSDDSYG
YGYGLN
>gnl|bykdb|A0A0A0FHV8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli G3/10] (length=223 residues).
MDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRHGYSHNLFTVSN
AHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQMPPNPSELLMRDRMRQLLEWANDHYDLVIVDTPPMLAVSDAAVVGRS
VGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGYSYSEKE
>gnl|bykdb|A0A0A0G0N2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=223 residues).
MDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRRGYSHNLFTVSN
EHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDHYDLVIVDTPPMLAVSDAAVVGRS
VGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGYSYSEKE
>gnl|bykdb|A0A0A0HJJ4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Roseovarius mucosus DSM 17069] (length=322 residues).
MTLKRHEEYMRRRAARRAEMEAEADDEVPQVVDTPEPEAPAQDEIAQEETALAAPPESLELSEPEPEPEPEPEPEPEPEP
EPLLWPALRRVVLDPKHLAKHRLISATREDPAHVAFDVLRTKLLAALRTHGWHRVAITSPTPDCGKSFVAANLAISLSRQ
SSVRSVLMDMDLRRPSLAHTLGQPDPGRMAGFLSGDIPLQRFLTCPEENALNIGQTLAMGLNDRAEPYAAEILHAPETGE
VLQDLYRRLAPDVVIFDMPPALYYDDVLGFRPQFDGVLIVVGGGRTTAQHIRDVKARFGTDTPLLGVVMNRAEGESIAKY
GY
>gnl|bykdb|A0A0A6PQ76 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Candidatus Thiomargarita nelsonii] (length=257 residues).
EEVEKKLGLPLLTVLPKVKIDKTEDKIKARWMFLREPKSGYSESIRTARTGILLSKLDTQHKVLIVTSSIPNEGKTTFAI
NIAVALGDMEKTLLIDADLRLPSLAKSLGLSDDTPGLSELITGERDLDECIHDHLSDNRRNLDIMPSGMAPPNPLELLSS
PRFGELLYELSQEYEYIIIDSAPTIAVSDTLVLTKYASSVLYVVKANATSYKLILEGLKRLRQVKAPVHNIILNQLDSDN
PSKYYRYGYGYGYGKND
>gnl|bykdb|A0A0A6RK76 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Candidatus Thiomargarita nelsonii] (length=251 residues).
PKLKIGKTDDKMKVMWMFLKEPKSAFAESVRTARTGIMLSNLDIKHKVLIVTSSIPNEGKTTFAINQAFALGQMAKTLLI
DADMRRPSIAKSLGLNDDAPGLSDLVTGERGLDECIDDHLSKDGRNVDIIPSGVVPPNPLDLLSSSRFGELLEQLSQDYE
YIVIDSAPTIAVSDALVLAKYASGVLYVIKANATPYQLVREGLKRLRQVKAPVHHIVLNQLDIHKPSKYYGYGYGYGKNY
YGYYKSYYGEK
>gnl|bykdb|A0A0A7PGL6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingopyxis fribergensis] (length=266 residues).
MADADLPLSRDQKLLTLSGLASFTPPLTAIKKHRIVGFDNRDARARPFNLLRTSFAKKLKEEGHRLIGLTSATPAAGKSF
LSMNLASSLARVTEEPVFLVDLDIRRASLADEIGLVAERGIESYLEGDIADLSDVGHRIEGTKLGVFPTVRRTRNTAELL
AGERFAQMVDTLRNRSEASIVLFDLPPAFANDDAMISLSALDGFVLVVDSGKTTRRHVQDVMSMLYPTPCIGSILNRYRG
GLGDSYGYGYGGPNYGKYYDRPDPDA
>gnl|bykdb|A0A0A8J8L3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella pneumoniae] (length=484 residues).
DNPILISNILDNISQNYLSQNVARQAAQDAKSLEFLNQQLPKVRAELDQAEDKLNVYRKQKDSVDLSMEAKTVLDQIVNV
DNQLNELTFREAEVSQLYTKEHPTYKALMEKQQTLQTEKIKLNKKVSAMPSTQQEVLRLSRDVESGRAVYLQLLNRQQEL
NIAKSSAIGNVRIIDTAITEHKPVKPKKIIVIGLGFVLGFLLSIGLVFLRIFLRRGIESPEQLEEMGINVYASVPVSEWL
AKQSSKNKLRKNESDKLLAIENPADLALEAIRSLRTSLHFAMMEAKNNILMISGASPSVGKTFISTNLAATIALTGKKVL
FIDADLRKGYVHKMFGHQNNKGLSDILSGQQDMKNVISKLSGGEFDYISRGQVPPNPAELLMHPRFEQLLNWASKNYDLV
ILDTPPILAVTDAAIIGQYAGTTLLVARFENNTAKEVAVSIKRFEQSGVQIKGCILNGIVKKASSYYGYGYNHYGYSYDE
KNKK
>gnl|bykdb|A0A0A8WSG4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Geobacter sp. OR-1] (length=283 residues).
MSRIEKALEKASQLRQRMPDVQPEPVEFPPSTSNVQASSEYPLQTVVTEISNPLLVSITDSSSPISEEYRKLKSLLVATA
KERDFANVIMVTSAIAGEGKSITALNLALSLAQEMDHTVLLIDADLRKPSINNYLGINGDIGLAEVLEDRSDLPSALKHT
GVGKLVVLPAGRVTLNPVELFTSQRMVKLIQEIKHRYPDRFVVIDTPPILPFAETRTISRLVDGVIFVVKERLASQSSIA
EAIEALEGAKKIGIVYNEAEISVADDRYGHYYNRYYQKQNDQK
>gnl|bykdb|A0A0B3RZC9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mameliella alba] (length=470 residues).
MNMMDSPKFRRKRTSATGSARPVSEPPDPVRPLDETAREAARKRDAAAEQARSEAEARRIAEAADKAKAREKAQEKLRRR
AELEELARAEALRRVMAARARREAEARKAAERAEAEAALQAEKEAEERRIQAERADEERAAEARRKAAEEKAEAERLAEE
EKRAEQVRLAEARAAEDAARRAEEERLARERAEATETVPPLALTGMVPVTEQPASAPASARAPQEPDPVDSAWARLAEMT
VDKGHLDRNRIITASRDDPAHAAFDVLRTRLLQALHENGWRRVAITSPGKECGKTFTAANLAISLSRQENCRTLLLDLDM
RRPSLHRILGVSDPGSLGDMLRGMTAPGDHLLRMGRNPVNAGRNIAFGLNGRPEAYASELLQDPRAESCLQRIEDEFDPD
VVLIDLPPALSYDDVIAARPLFDGVLLVIGGGMTTEKEIAEVERRLGDGTPILGMILNKAEGTELDRYSY
>gnl|bykdb|A0A0B8P2H5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio ishigakensis] (length=545 residues).
MARSENGEFLLFVSQLVGKQGQEYGLGKRSKLDAIQWLNGSLSVSERGKQSGILSFGFEGENKAQIIDLLNDIANNYFLQ
NVDRNAAEAENSLEFLQEKLPEIKAELTANEDALNKYRQDNESVDLGLEAQSTLKVMVELEAQLNELTFKESELAQRFTK
QHPAYVAVLEKRKTLEAQKRRLEGQIKQLPKTQREVLRLTRDVEVNQQIYLQLLNKSQELAIVKASTVGNVRILDGAESY
SAPVKPKKPLIAVLATLLGGMLSVAFVLLRAAFHRGIENPDQIEELGIPVYATIPKSAQQEKIDRQLAKNRSRKKLVSAE
EMLLSSVNPADLSVEAFRSLRTSLHFAMMEAKNNIIMITGPSPAIGKSFVSANFASIIASAGQKVLLIDADMRKGHLGRG
VKLDHDNGLSDYLVNDNEINEVINSGQVENLDFIAKGKTPPNPSELLMHKRFTELCEWASENYDIVIIDTPPVLAVTDAA
IVGRQAGTTLMITRFAKTAPKEIEVSIDRLEQAGIETKGVILNAVEKTASSYYTYGYYNYSYKSE
>gnl|bykdb|A0A0B8PTA8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio sp. JCM 19236] (length=347 residues).
MTRDVEVNQQIYLQLLNKSQELAIVKASTVGNVRILDGAESYSAPVKPKKPLIAVLATLLGGMLSVAFVLLRAAFHRGIE
NPEQIEELGIPVYATIPKSAQQEKIDRQLAKSRSRKKLVHAEEMLLASVNPADLSVEAFRSLRTSLHFAMMEAKNNVIMI
TGPSPAIGKSFVSANFASIIASAGQKVLLIDADMRKGHLGKGVKLEHSHGLSDYLVNDKEIEGVINTGQIENLDIIVKGK
TPPNPSELLMHKRFTELCEWASENYDIVIIDTPPVLAVTDAAIVGRQAGTTLMITRFAKTAPKEIEVSIDRLEQAGVETK
GVILNAVEKTASSYYTYGYYNYSYKSE
>gnl|bykdb|A0A0B8QF75 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio ishigakensis] (length=341 residues).
MNQQIYLQLLNKSQELAIVKASTVGNVRILDGAESYSAPVKPKKPLIAVLATLLGGMLSVAFVLLRAAFHRGIENPDQIE
ELGIPVYATIPKSAQQEKIDRQLAKNRSRKKLVHAEEMLLASVNPADLSVEAFRSLRTSLHFAMMEAKNNIIMITGPSPA
IGKSFVSANFASIIASAGQKVLLIDADMRKGHLGRGVKLEHDNGLSDYLVNDKEINEVIHSGQIENLEFIAKGKTPPNPS
ELLMHKRFTELCEWASENYDIVIIDTPPVLAVTDAAIVGRQAGTTLMITRFAKTAPKEIEVSIDRLEQAGIETKGVILNA
VEKTASSYYTYGYYNYSYKSE
>gnl|bykdb|A0A0C1TRU6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Geobacter soli] (length=310 residues).
MSRIEQALEKAAMLRGTTTESGPVAVPRQTDDVPPRERAGLPPFPAEPLDGIRHDNPLLATLNDPHSYVSEEYRKLKSAI
VAGTSVGEFRNTVMITSTLGGEGKSITALNLAITLAQEYDNTVLLIDADLRKPMTAEYLGIPGERGLSEYLSVGAHLPEL
LVRTGIGRLSILPAGKPAANPVELLSSQRMKDLLDEIRHRYPDRYVIIDAPPALPFAEVRSLSSLVDSIVFVVREGQSSL
ANIDEAIGALNRKKIIGIVFNEASAVGLSSKYGYGYRYGGYGQSSEPAEARSKAEKTGKLARIMGKGGSK
>gnl|bykdb|A0A0C2I782 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas batumici] (length=268 residues).
MEIIKPDTEDSEQQPSTSLVTVPKAMTETGQSAGLNALSYVQTKVVPLRPDHLERNRIVAYNKNSNMGGAFDLLRTQVLK
VMEENGWRTLAITSPTPEAGKTVLAINLAMSIAHHTTKTALLVDFDLRRPMVGACLGLPMEKSLNELLDHEAELQEVLVN
PTLPRFVVLPTREPIPLSTEVLSSPTVSYLIADLRERYDSRIVIFDLPPLLSSDDVITVLPKFDCVLLVVANGMNSKKEI
EESLYHLGTANLIGTVLNKADPPNRSYY
>gnl|bykdb|A0A0C5VQ86 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Gynuella sunshinyii YC6258] (length=245 residues).
MAHSDKTASSIKNIEYTQTKILPVSADKLRANRIVAHDPTDPNASLFQVLRTKVLQEMRLNNWNTLAITAPTPGAGKSMI
SVNLAISIAMEVNQTVLLVDMDFRKPSIHKYFSVKPKYGLQDCLQSGVPIEDVLFNPGFNRLVVLPGRQGIMSSSELISS
PESTQLIRELKEKYDQRLVIFDLPPLFVSDDVMVFLPNVDCSLLVVESGRNNKDEVQKSVELLKSKPLLGTVLNKEAVSQ
KIYFY
>gnl|bykdb|A0A0D5N3E9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Geobacter sulfurreducens] (length=309 residues).
MSRIEQALEKAAMLRGTTDRGPAVAPRQMEDVQPLERAELPPLPAEPLEGIRHDNPLLATLNDPHSYVSEEYRKLKSAIV
AGTSVGEFRNTIMITSTFGGEGKSITALNLAITLAQEYDNTVLLIDADLRKPMTAEYLGIPGERGLSEYLRVGAHLPELL
VRTGIGRLSILPAGKPAANPVELLSSQRMKDLLDEIRYRYPDRYVIIDAPPALPFAEVRSLSNLVDSIVFVVREGQSSLA
NIDEAIGALNRKKILGIVFNEASAVGISSKYGYGYGYGGYGQSAESAGARSKAEKTGKLSRILGKRGSK
>gnl|bykdb|A0A0F0T3Y9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Enterobacter cloacae subsp. cloacae] (length=187 residues).
MISGTSPGVGKSFVSSNLAVLMAQAGSRVLLIDCDLRRGYLHSIFSQAEGHAGLADYLSANVAVSQVIEETEYQGVDFIG
RGRMVNNPAELFMTEKFQTLVDACSAQYDVILLDTPPILSVTDAAIIGRFASTSLMVVRFEQNSVQEVEAGLRRFNQNGI
AIQGVIFNGVEKRASATYSYGDYSYQE
>gnl|bykdb|A0A0F2NF69 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobulbaceae bacterium BRH_c16a] (length=249 residues).
MESFNEQHRLAKSLSGKWDERLFKAANDDGYLPEVFKTLRSRILHPLDGGKIPKTIMVTSAIPREGKSFVTANLGISLAH
GLDQHSLLVDCDLRKPVLAKMFGLDNSVGLVDYLRDDVMLSKLIANTAVKTLSVLTSGKSPANPAELLGSARMPALVEEL
SDRYEDRLIIFDSPPLLVAAESSVLAGQVDAIILVVRQGTSGKAQIQKLIDIIGDERILGIVFNDQNLSSFQQKLGMGCG
SYYGGYYHQ
>gnl|bykdb|A0A0F2R2U0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfatitalea sp. BRH_c12] (length=276 residues).
MGKIFDALEKSNTQAAKSVPLPHVRTDIVNGKGADRIVPISNSNKLTSEHKLDVNLITYHAPQSVEAELFKVLRTNLLFP
PKGQPPRKILVTSPLPSDGKSFISSNLAISIALGIEEYVLLVDCDVRRPTIHSYFGFGKVTGLSEHLSMGIDLSKTLLKS
PIPKLTILPAGHPPGNPTELLTSKRMKTLLEEVANRYDDRYILIDSPPPSMAAETNAMINIVDGVILVVKAGVTPKNAVN
ETIEQIGKEKLLGVVLNYADQSVKKYYGYGRSYYHG
>gnl|bykdb|A0A0F4SWA7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas fluorescens] (length=262 residues).
MEISNPDTENAEQQTSSKAMTPTAQSTGLNALSYVQTKVVPLRPDHLERNRIVAYNKNSNMGGAFDLLRTQVLKIMEENG
WRTLAITSPTPEAGKTVLAINLAMSIAHHTTKTALLVDFDLRRPKVGEYLGLPMDKSLNELLADEAELQEVLVNPTLPRF
VVLPTREPIPLSTEVLSSPAVSHLIADLRERYNSRIVIFDLPPLLSSDDVINVLPRFDCVLLVVANGLNSKKEIEESLHH
LGTANLIGTVLNKAEPENRSYY
>gnl|bykdb|A0A0F4UWN2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas fluorescens] (length=262 residues).
MEMFNPDTEKAEQQTSSKAMTPTAQSTGLNALSYVQTKVVPLRPDHLERHRIVAYNKNSNMGGAFDLLRTQVLKIMEENG
WRTLAITSPTPEAGKTVLAINLAMSIAHHTTKTALLVDFDLRRPKVGEYLGLPMDKSLNELLADEAELQEVLVNPTLPRF
VVLPTREPIPLSTEVLSSPAVSHLIADLRERYNSRIVIFDLPPLLSSDDVINVLPRFDCVLLVVANGLNSKKEIEESLHH
LGTANLIGTVLNKAEPENRSYY
>gnl|bykdb|A0A0G9MZA5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Erythrobacter luteus] (length=598 residues).
MPENADIEPALAGTLLNNVSITPIINSTLVDISFSSPDPQVSARIANAWADAYIAENLDRRFGATRDARSSLEEQLQQYR
QRLEEAERAVIAYATAQGLVSIDVPREDGDSAGTASQTLVATELAAFNSALQQATTQRIAAEAALAARSGANAGSTEASA
TADALRARRAELQVELAELRSRFSPSYPPVQALQVQIDELERAIREEQAGAQSGSQSRLRANYNEALAAEQRLQAQVNRL
QANYTDQRQDSVEYNILQREVDTNREIYAGLLQRYREIGVVGVGESNVLVVDPAQVPGGPYTPSLIRNLLIALVAGLVVV
ILGLYAYDFLNQTLRDPRQVRDRLGLNLLANIPRIDEGDIVEELQHSYSELYEAYFSLTSSVAFAAGGSMPRSLMITSSQ
PGEGKSLTAVAIAYLLARQGKKVLLVDVDLRKSGVGKYLSIDTAQGMSQYHMGKDDWRSMVLPSTPLEDFHVIPAGRKPL
SAAELLSSGRFQRMLDEAEAEYDHVVIDAPPVLGLVDAPMIAPSLDGVVLVIEANGGKWRHLESAVSRLRASNAELLGAA
VTKLDERNAMYGYGYGYGYGYGYGHDRKKEGEEEGLPA
>gnl|bykdb|A0A0H4KZM1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Marinovum algicola DG 898] (length=356 residues).
MEKRWTRKKRASREAGGPAPKPALTGPIHLAPERETPLEPEELTPPETPTTADVRSEAERTSEAAPSPEAKPRAPAKDAR
PAVAPPEPAPAPAVEAPEPDQPTEPAPPPRRNRGEPGAWAALPSFHVNARKLERNRIITATREDPVHSAFDVLRTKLLRA
LRENGWTRVAITSPTEGCGKTFLAANLAISLSRQSNCRSVLLDLDMRHPTLDKVLNIPDAPDLPAFLRGNLPLGDLLRRP
AANDFKIGDQVAFGVNARREPYAAELLQDPDTAAVLSGMEAALAPDVVLFDMPPALVNDDVLAARPLFDGIILVVGGGIT
KPQQVRDVERRLGTETPLLGVVLNRSEGEAAQIYSY
>gnl|bykdb|A0A0H6F257 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio cholerae] (length=289 residues).
MIVLLAFVVSFGFACVVAFIADAMTDTFADIKQVEKQLALSLLGVVPVVRKQRGKLDAKAYFDEKLRELTEAVRTIRTSY
LLAHVNQDQHVVMLTSCLPGEGKTTSSLNLALSLAQMEKTLLIDCDLRKPAIAHRFGISGSQPGVTNLLNGTQSLEDCVY
HDEQSGLDILTAGVYASNPLELLSSSKFSELLADLRTRYQRIVIDTPPCLAVSDSFMLAQYVDSVILVIDANHTRTPVVR
EVVGKLTQQGSRIDGVILNRLNAKKASRYSGYYHYQAYYGEETKSGAAK
>gnl|bykdb|A0A0H6GCF1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio cholerae] (length=217 residues).
MRTIRTSYLLAHVNQDQHVVMLTSCLPGEGKTTSSLNLALSLAQMEKTLLIDCDLRKPAIAHRFGISGSQPGVTNLLNGT
QSLEDCVYHDEQSGLDILTAGVYASNPLELLSSSKFSELLADLRTRYQRIVIDTPPCLAVSDSFMLAQYVDSVILVIDAN
HTRTPVVREVVGKLTQQGSRIDGVILNRLNAKKASRYSGYYHYQAYYGEETKSGAAK
>gnl|bykdb|A0A0H6V1F7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio cholerae] (length=403 residues).
MKSASAQLEAVRKNLRAELRQLLNGINNELQAAKQSERSLQTEFNQRKSEFQTLTVKNAKYSELKREVQTNRELFDLFLA
RQKETSASGDFNTTIARFTDQASAPLTPSKPNKKLIVLLAFVVSFGFACVVAFIADAMTDTFADIKQVEKQLALSLLGVV
PVVRKQRGKLDAKAYFDEKLRELTEAVRTIRTSYLLAHVNQDQHVVMLTSCLPGEGKTTSSLNLALSLAQMEKTLLIDCD
LRKPAIAHRFGISGSQPGVTNLLNGTQSLEDCVYHDEQSGLDILTAGVYASNPLELLSSSKFSELLADLRTRYQRIVIDT
PPCLAVSDSFMLAQYVDSVILVIDANHTRTPVVREVVGKLTQQGSRIDGVILNRLNAKKASRYSGYYHYQAYYGEETKSG
AAK
>gnl|bykdb|A0A0H6WI56 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio cholerae] (length=242 residues).
MVRKQRGKLDAKAYFDEKLRELTEAVRTIRTSYLLAHVNQDQHVVMLTSCLPGEGKTTSSLNLALSLAQMEKTLLIDCDL
RKPAIAHRFGISGSQPGVTNLLNGTQSLEDCVYHDEQSGLDILTAGVYASNPLELLSSSKFSELLADLRTRYQRIVIDTP
PCLAVSDSFMLAQYVDSVILVIDANHTRTPVVRDVVGKLTQQGSRIDGVILNRLNAKKASRYSGYYHYQAYYGEETKSGA
AK
>gnl|bykdb|A0A0H7B811 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio cholerae] (length=247 residues).
MGVVPVVRKQRGKLDAKAYFDEKLRELTEAVRTIRTSYLLAHVNQDQHVVMLTSCLPGEGKTTSSLNLALSLAQMEKTLL
IDCDLRKPAIAHRFGISGSQPGVTNLLNGTQSLEDCVYHDEQSGLDILTAGVYASNPLELLSSSKFSELLADLRTRYQRI
VIDTPPCLAVSDSFMLAQYVDSVILVIDANHTRTPVVREVVGKLTQQGSRIDGVILNRLNAKKASRYSGYYHYQAYYGEE
TKSGAAK
>gnl|bykdb|A0A0I1Z5N6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Shigella sonnei] (length=201 residues).
MMETENNILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFG
KGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDHYDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSM
QRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGYSYSEKE
>gnl|bykdb|A0A0J5Q9T7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Puniceibacterium sp. IMCC21224] (length=406 residues).
MAERRKFHRRHGPTQDATGTQPAEDLAPISPLETRAERQARRTAERIRANAAQSIVEEQTQRRADAQAKAQAPRAAAAAQ
AVLRAEETQASERLKREATERAEAERVTRDEAVRVKAERLKQLASERRAHMVAEASRKRVEVAPPDPGAPQSGTLIRPHD
PAPVPVDTWARMREFPINEQLLERNRIVTAHRDDPAHASFDVLRTRLLQALAQNGWKRVAITSPTKDCGKTFTAANLAIS
LSRQENCRTLLLDMDLRNPSMHKIFGVKSPGSIGALLRAETNAAAHLQRPARNTIHAGRSIAFAFNDTAEPYASELLQDP
QSTQALHDLETQLAPDVVLFDLPPALYYDDVIAFRPQYDGVLLVVGGGMTTQDEIKEVERRLGKDTPLLGVVLNKAEGAN
PRKYSY
>gnl|bykdb|A0A0J7XGZ1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Novosphingobium barchaimii LL02] (length=689 residues).
MLPRTYTATSALLLEPREAQPVKVNDRGFVAPADDNLIDTAVQIIRSPTLTLDVVRSLRLDRVPEFGGDSKSPSAKLTPP
LATGTDGHGSTGDREQIATINPAERQAAGRLLTHSYVRRVGVTYLVEITASSEDPDLAARIANALARRYIGLDSAKKQAR
NAQSAHYVESQAAALRKHAVADDATLQQYMIRNNLMSAEGATMAEQEVSELNRQIADAQAQLAEQRGKLGAAQAQIARGG
GGADIGSALASDTIRQLRQQEAQASARLAQLDARYGALHPDVVQARDELADVRAQLGAELGRIVSGLRADVQIAESRLAS
LLDSRAQAKGSLVQNGSAQVGRLELERRAEASRAIYSAYLTRAKETAQAGELPNADASIATLARPPGGPSSPNYLVGALA
GFVAALLVAGLATGMAEYVEDTVATRADIEGGLGAVYAGAIPTLASATRSKAKDMTPQDYVTIRSMSLFTESLRNLATYL
GIGHSGSERGAAVVTITSPLPREGKSTISMCLARTLAMGKHKVVLVDADVRHHSTSNALAPEREREGLFRVLDGSLPLEE
ALIVDERTDLQILTTLGQSGPNDVITEEAVGALLAVLRAHFDIVIIDSAPVLGVAETRIVSRLSDTTLVVARWRATPLKA
VRTALDLLSHNGSKVGGVALSLVNIKEHASAGLTDAFGYYKKFKGYYAD
>gnl|bykdb|A0A0K1QRZ4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas fluorescens NCIMB 11764] (length=262 residues).
MEIIKPDTENTEPKNSSKAMTPTAHSSGLNALSYVQTKVVPLRPDHLERNRIVAYNKNSNMGGAFDLLRTQVLKVMEENG
WRTLAITSPTPEAGKTVLAINLAMSIAHHTTKTALLVDFDLRRPTVGACLGLSMEKSLNEYLADEAELQEVLVNPTLPRF
VVLPTRKPIPLSTEVLSSPKVSHLISDLRERYNSRVVIFDLPPILSSDDVITVLPKFDCVLLVVANGMNSRKEIEESLHH
LGTANLIGTVLNKAEPQNRSYY
>gnl|bykdb|A0A0K9JYB4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Candidatus Burkholderia humilis] (length=332 residues).
MIAAGTGLGFFIGTFFIFLRRHAMIGVTDPMFVERRLSVPVLGEVLFSRSQQMLDHEISMSPVSRAPLWFAGKKDERSEP
KALPYHQLQGHDDLTMPHVGGEDARVLASRYPHDPAVEALRAVQTELYLDLVNAPNNIVMPTGPIPSAGKSFVAANLAVL
LAEIGLRVLLIDGDMRRRHIASFFKQSNPGGLSEVLKGEMELGDAIRYVGVPGLSFMSCGGYPENPSELLMMPHFRDMMA
RMSDQFDLVLLDTPPFLVVTDTAIVASDAGSTVLVLRSGIQTESEIEDTVKKIQRAGGRLVGSVFNAIPRRRSNCRSYGY
AAAYTSTFKSVN
>gnl|bykdb|A0A0L0M4Q4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Candidatus Paraburkholderia schumannianae] (length=376 residues).
MTTQLYTSVLTNTQQLEVAAASTPPGMAVVDWAVAPEKQSWPRNWIVLLGSVFGGLFISTVSIYLIALHRRELRSPEEID
HFSQLPRLAVIARSTAQLRQDVRALTHNAAPARLLAMTSPTDPSIEALRSSVRTMLSGVPIANHPGFHGLHPMNPMALSH
AVGNPVSVMNPGAVVEAGNADDGKARVILFTGPTQGVGKSFVSSNFAYLLAEMRASVLLIDADMRQGRLRHLADDHEHPG
LAEVLAGTARVEDAIVPLGDGLSMMDAGAEFPENPAELLTRPAFRETLAMLRDIYDYIVIDSPPVLPVSDALSIAMQDCD
LVLLVSRADRTGARQLEETLRRLENVGAKMGGHVFNGFAPGRYGAREEYGIRTSMR
>gnl|bykdb|A0A0L1KFN4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Erythrobacter citreus LAMA 915] (length=675 residues).
MTPQYTAVSTIEISREADQVTNIEGVERETSVADQEFYQTQYGLLRARSLAERVAAELGLVDRPEFFEMFRFDGADDPAF
EIVNGRYPAEGRAQRQREAAKILLDQVSIEPTRLSRLVDINFTSPDALFSAQVANAWAENFIEINLERKVQSTSYGRTAL
QRQLAEYKDRLDESQRQLVTYASNQEIINLPSQSVGDGSTTQERSIVVDNLAALNAALNEATADRIAAEARFRQAGGSGS
SAEALSNYAINNLRQKRAELESEYRELMVRFEPGYPQAQSLQSRIDELSRAIEREEARVSASVQAEYQQALAREEALQQR
VSALKGDYLDLRRRSIQYNIFQQEVDTNRALYDGLLQRFKEIGVAAGVGVNNVAIVDTAAVPELPSSPRLLLNLAISILA
GFGLGAALAFALEQLDEAIADPSEVEHRLGLPLLGSVPKVDDGGTPRDALLDRKSELVDAYIAVQTNLAFTTERGVPRSF
SVTSTRPAEGKSTTSLALATMLARSGKRVILIDGDMRSPSVHHLGNVGHDHGVSNFLAGDDNYEPSIFHMDDLNLDAMSA
GPIPPNAAELLTGTRMRQLIDRLHENYDHVVVDSPPVMGLADAPLIAGHVDGVIYAVESHGIRSSQVKTALSRLAAVRTR
ICGAVLTKFEARKAHYGYGYEYGYGYGRDVETETA
>gnl|bykdb|A0A0L6CVX1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Roseovarius tolerans] (length=232 residues).
MPLDTRHLIRNRLISATREDPAHVAFDVLRTKLVATLRARGWHRVAITSATPDCGKSFVAANLAISLSRQSGLRTVLMDM
DLRRPSLAKMLGISEPGSMSRFLTGELSAERHFLRPDKNAMHIGPHLALGLNDRAEAYAAELLQAPGTAAVLADLCARLA
PDVVIFDMPPALYYDDVLGFRPQFDGVLLVVGGGRSTAKEVRDLKARFGDEVPLLGVVMNRAEGENITKYGY
>gnl|bykdb|A0A0M3GBT1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhizobium phaseoli Ch24-10] (length=648 residues).
MEDKSSSSDLLDAKSETERLLSRSIAERVVRELQLNLRPEFNPALREVTFFESIRTNLRGLFDPRKPAEPVRDGIDAVIP
EFYRALGVWHEDKSDVVQVSFTTNDPQLAAAVPNRVISIYLDERKGSVRSRLDAAEKWIVQRISEQKARADTAREAARSY
QESMDVISKEDAQDERLKSLIELTGREGKIEETRVEVKAVISTLEAADSASVAVQNIALPDDITSKQRDLHAQEDDLARL
LELYDGNAEAVVDLRGKIEKSRADLSFATKQYLQTMRAKLAALDHEAAAVQSILDVAHEKRARDALVQTELTRLQRISDK
EQTALEKLEDQRRDLADKAKLPGAELEVLSPASVPLAAQGRGRLFYLVSALLAAISAAVTAAFVMEMWDRSIRSFDQIAG
MARTIPAGLIPRLARRENPKTIFGQVRVPMFDEAIRTVILTLKQSNGGKLPNSIVVTSAHSGEGKSLIARSLAIELAAAA
IPVLLVDGDLRRGELESYFKSGLRQGLNEFLNGHADIRDVVDHHPSGIDFIPSGKFSLQRRVRSNGLAEIIEMAGAAGRI
VIFDSAPVLASTDTVLLTALAEKTLAVVRWGKTSRRAVEFGLQQMKSPRNSEIIVAINRVNPEKHALYNFSDSELFSRSL
MKYYNFKE
>gnl|bykdb|A0A0M4D373 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfuromonas soudanensis] (length=277 residues).
MSRIEKALEKASLLRENQALEKASLRREYQERPPVPLEAGPRAPGHVALKVAPLPVNSPFLMSAGNCQAGIAEEYKKLKS
LVVKLTRAEAFRNTLAVTSTLPGEGKTVTAINLALTLAQEYDHTVLLVDADLRKPMVHKYLGIEPEVGLAHCLRDGVPIE
QALVKTGLGKLVVLPAGDAISDPVERFASQRMKEIITEIKSRYGDRYIIFDLPPVLPFAEAQILGAEVDGVIFVIRQRQV
KATEVQEALESLKPVNMLGVVFNCVTTPSKLGRYRYY
>gnl|bykdb|A0A0M6YG59 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Jannaschia donghaensis] (length=287 residues).
MDRIQAAIARARTERDALLAGHRPEPSAVAPQPDAIVTPTPGAADAWSALPIFKPDAAHLEKNRIVTRDSGAKSAPFDVL
RTRALQQMSAEGWTRLAVTSPGPGCGKSTVTMNLAFSLARQPDIRTLVIDLDLRRPMLANLLGLTDRHEITAVIRGKADA
ATQIARVTDNLAFATTRTPVHDPAELLQGRRIGDMLRSLEERFAPDVILFDLPPIMVSDDAIAFLPNTDCALMIAAAEQS
TLGQVDICEKELAAQTSVLGVVLNKCPYPGDGQRYGYGYGYGADADG
>gnl|bykdb|A0A0M9E0E3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Candidatus Magnetomorum sp. HK-1] (length=292 residues).
LGTALAFTFEILDNTLKNPEDIREYLKIPYLGPVPTFDLEKEGVDKPELITHYSPKSTASESYRGIRTSLLFSSADKVPK
IILVTSAGPSEGKTLTSTNLAITMAQAGSRVIIVDCDMRKPKVHKMFNLSRDMGMSSVLVSEDLETILNDVTLPSGIPNL
EVIPCGPIPPNPSEIIGSQKMSLIMDELGKRYDRIIVDSPPITAVTDSTVLAKFVDGVMLVVHAGVTPKQVVKTGLEQIQ
GVEANVLGAVLNDVDTGKESYYYYQYYYYYYGEDGDKKKKNQRKKRSSKRYG
>gnl|bykdb|A0A0N0FS39 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. maculicola] (length=442 residues).
MPAVRKQLEDAETALNNFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTYRSLMSQMNQLEQQK
QGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPVKPMKTLIVLIATLI
GALVAMTIVFVRQAFYRGIESAEVIESLGMPVYASLPHSRQQERLEKRDQDSKDSRLLSIAAPGELAIESLRSLRTSLHF
AMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDTLAARLRCTEVIHQT
RVRHLDFMSCGFAAPNPSELLMHDNFNKMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLVARFGMTTAQEIEAC
KRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNYHPAPR
>gnl|bykdb|A0A0N0M5F7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Novosphingobium sp. ST904] (length=362 residues).
MQGEVERLRNATLSEQDRSIRYTILRREVRTNRELYDGLLQRFKEVSAAAGVSANNISIVDLASTPVRPVAPNLPVNLGL
SLLAAFVAAIGVIYLRENLDDMLRTVDDAERKLGVTGLGMVPRLDAGVTFRDEVEKRNSSLSEAIHTIRSAIELAGGNGP
PRTVFITSCGKGEGKTSTAYALARDFAQIGRRVLLVDADMRRPSMHKLLSFENNAGLADLLNREKAIENVVRRTAIADLH
FISAGAAEPNPAELLASGTLPWLIGQLEEMYDIVIIDGPPMLGLADAPSIAVHVEATLFVIDAGQTRRKTIRSALRRLRL
SRATLRGVILNRVDVRTLGYGYESYYRYDEEARRPRSWLGRR
>gnl|bykdb|A0A0N0XAV4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. cilantro] (length=373 residues).
MNQLEEQKKALLKKIEALPMTQQELLRLTRDMQVTSQTYSLMLNKSQEQDILRAGSIGNVRVIDHANANTEKPVKPMKKL
IVLMATLIGALVAVMIIFVRQAFYRGVESAEVIEGLGMPVYASLPYSRQQDRLEKNSKSAPTRPGTRLLSAAAPDDLAIE
SLRSLRTSLHFAMLEARNNILMISSPTPGAGKSFVSSNLAVIIAQTGKRVLLIDADMRRGYLHRIFGLQPKHGLSDTLAA
RRRCADVITPTRIRHLDLISCGFAAPNPSELLMHDNFHKMLAELAPSYDLILVDTPPILAVTDASLVGRQAGTCLMVARF
GMTTVKEIEACKRRLGQNGILIKGAIFNAVVRKAATSAYDSAAYGYDYKSAPR
>gnl|bykdb|A0A0N8QB74 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. atrofaciens] (length=773 residues).
MAGPARHHRPLPAARVSLRTDLRAALALHRRLAPSFSVRSNRINDRHEPSFPEFPSGLPDRSGNSPADAVRSQDPDPVDR
RRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHAGSQCQATLGVAELIKSRALLGKVVDDLQLNRLQTPDLFPVIGP
YLYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGERLTLTAGKPGQFSLYDSEHNLLLGGAINRVVEGHG
IKIQVATLQARPGTDFTVSRQRTLSTALIYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERSSAE
AAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLKRVELERLYTREHPTYRSL
MSQMNQLEQQRQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGNIGNVRVIDNADTNVERPVKPM
KTLIVLIATLLGALVAMTMVFVRQAFYRGVESAEIIENLGMPVYASLPYSRQQEHLDKRDHAGQESKLLSIAAPAELAIE
SLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGKRVLLIDADMRKGYLHRLFGLQPKHGLSDTLAA
RLRCTEVINTTRVRHLDFISCGFAAPNPSELLMHDNFHKMLTELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLVARF
GMTTVQEIEASKRRLGQNGILIKGAIFNAVVRKATTSDYDCAAYGYNYHPAPR
>gnl|bykdb|A0A0N8R9B3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. coryli] (length=696 residues).
MDRRRVFSDRPGLCHSCHAGVSGHRHDSDRASENRHRGHAGSQCQATLGVAELIKSRALLGKVVDDLQLNRLQTPDLFPV
IGPYLYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGERLTLTAGKPGQFSLYDSEHTLLLGGAINRVVE
GHGIKIQVATLQARPGTDFTVSRQRTLSTALIYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLKRVELERLYTREHPTY
RSLMSQMNQLEQQRLGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGNIGNVRVIDNADTNVERPV
KPMKTLIVLIATLLGALVAMTMVFVRQAFYRGVESAEIIENLGMPVYASLPYSRQQEHLDKRDHAGKESKLLSIAAPAEL
AIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGKRVLLIDADMRKGYLHRLLGLQPKHGLSDT
LAARLRCTEVINTTRVRHLDFISCGFAAPNPSELLMHDNFHKMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTVQEIEASKRRLGQNGILIKGAIFNAVVRKATTSDYDCAAYGYNYHPAPR
>gnl|bykdb|A0A0N8SQG2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas savastanoi pv. retacarpa] (length=696 residues).
MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVAELIKSRALLGKVVDDLKLNTLQTPDFFPV
IGPYLYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVE
GNGVKIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDGVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTY
RSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRMTRDMQVISQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPV
KPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGMPVYASLPHSRQQERLEKRDQDSKDSRLLSIAAPGEL
AIESLRSLRTSLHFAMLAARNNVLMISSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDT
LAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNRMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNYHPAPR
>gnl|bykdb|A0A0N9W1V6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas fluorescens] (length=249 residues).
MTMPKAMTVTGQSAGLNALSYVQTKVVPLRPDHLERNRIVAYNKNSNMGGAFDLLRTQVLKVMEENGWRTLAITSPTPEA
GKTVLAINLAMSIAHHTTKTALLVDFDLRRPMVGACLGLPMEKSLNELLDNEAELQEVLVNPTLPRFVVLPTREPIPLST
EVLSSPTVSDLITDLRERYDSRIVIFDLPPLLSSDDAITVLPKFDCVLLVVANGMNSKKEIEESLYHLGTANLIGTVLNK
AERPSRSYY
>gnl|bykdb|A0A0P1EFX8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Ruegeria atlantica] (length=279 residues).
MEKLQKAIEKARSQRRKRAPAQLAVAADKAIQEEVPSNRTTDPWLDLTPLDISKTDVRQNRLVSYDGGAAAGPYDMLRTR
ILQQALVNGWKRVAMVSPHSACGKSTTTANLAFSFGRQTDLRTVVLDFDLRRAGLSLMLKQDCQCTMGDILQGKALLSDH
GYRVGKNVALGLSSGAVTDAAEILQSQKASDVIAAIEAEFEPDLVLFDMPPLLAADDNFGFLKNADCALLMTEAERTTID
QIDVAERQLAELTNVMGVIMNKCHYTDGIYGYGYGYGYS
>gnl|bykdb|A0A0P1FRV5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Thalassobius autumnalis] (length=364 residues).
MVEQSKRFRRGMRQRPAKAPEEAPVDPPVEASVEVPAEVTDAAPVQRRGLLSGSGRSAEEIAREDRALRSAFPFLDLDDV
EADASELAEEVAPVAVPEPLILNPESEVTPEPETEQPSEQPPGDDGWNDLGPMPVQRQQMMRNLIITASRKNPVHAAFDV
LRARLVQALSDNGWRRVAITSPTRDCGKTFVSVNLAVALSRYENCRTVLMDMDMRNPSVAKTLGLRDVGSMGAYLRGEIE
TRDQFFKFDQNDMSLGDNLAIAMNDRVEPFASELMQQPATRDRLTRMEAELHPDVVLFDLPPALANDDVITFKSNFDGVL
IVIDGTRTSGAEVREVMRRLGEDVPLLGVVLNKAEDATGDEYGY
>gnl|bykdb|A0A0P1FWI8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Thalassobius gelatinovorus] (length=322 residues).
MVEQNKRYRRKTRQQPPKSPGFLGPKNLSEADIEAEEKALREAFLWFDPDEVTQQDYDTSEPLSEAATAEQPEPEPEPEM
APTFWPLLSRISVNPVQMDRNLIITARRQNPSHAAFDVLRARLFQALSEHGWKRVAITSPTRDCGKTFVSINLAIALSRY
ENCRTVLLDLDMRNPSIAKTLGEQDVGSMSDYLRGKVPLTDHFHRFGENELNIGDNLAIAMNDRVEPYSSELLQEPETRA
CLEEMEQALQPNVILFDLPPALAHDDVIAFRDNFDGVLVVIDGTVTTGAQVQEVMRRLGDDCPLLGVVLNKAEDATGNEY
GY
>gnl|bykdb|A0A0P1GDI0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Tropicibacter naphthalenivorans] (length=610 residues).
MTERRKFRRKNRSADAVEDEMPPIAPLESREERLARRRAEQEAEQARLAAEEAARVEAERLEQARLEEQARQEALARKAE
ADARAKAEAEARAAAEERARIEAEAEQRRERARRAREALARQAAEKQRLAEEQAKAEAEEKARLAAEAEAQAEAARLAKL
AEERAAEAKRKQAELAAQRKAEAEAAERAEKQRKQAEADRRAQEKAKEAQRQAERAAAQRQAEEAARHKAKAAAEQQARM
QAEAAQRAEEARRAAHQADIDLARESERVRREKAERLAAKQVAQAEADRLAAEQAAQAEADRLAAEQAAQAKAEQAKADR
ARKTETERRAQEARARAALRHDLTPEPEADPESAEAEPETAPETLPAPFDDPWAQLQTFTVDPAHLSQNRIITAQRDDPA
HAAFDVLRTRLLQALHDNGWKRVAITSPGKDCGKTFTAANLAISLSRQENCRTLLMDCDMRRPSLHKIMGIDTPGAMGEL
LRGNIDPADHLVRMGSNQIHAGKNIAFGFNDLAEPYASELLQDPRTAQTLDRIEELYQPDVMLFDLPPALFYDDVIAARP
LIDGVLLVIGGGLTTEKEVKEVERRLGEQTPLLGMVLNKAEGTEIDRYRY
>gnl|bykdb|A0A0P1H2H0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Thalassobius mediterraneus] (length=387 residues).
MVEQSKKVLRQKRQARRAARAARAAEGTQANVMADVEAPAPVKDDAPQATGFLGLSGRSADDIAQEDRALRAAFPQWDGD
EMQDAASDTTEMDAPHSHNDEALPDEPAAEPLLLTPAVAAVPFDHIPSPDSVTTAPEEQDYPTEPEMDEWPLLGTMPVQR
QHLGRNLVITASRRNPVHAAFDVLRARLVQALSENGWKRVGITSPTRDCGKTFVAVNLAVALSRYENCRTLLMDMDMRNP
SVSKILSLRDVGSMGDYLRGQIATRDQFFKFDRNDLKIGENLAVAMNEQPEPFASELLQQPETRDRLNQMEEELHPDVVL
FDLPPALANDDVIAFKGRFDGVLIVIDGTRSSAAEVREVMRRLGDDVPLLGVVLNKAEDASGDEYRY
>gnl|bykdb|A0A0P7Y1D0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Oceanicaulis sp. HLUCCA04] (length=639 residues).
MSELDLAADPEFNSRLREPSGLGAVAGAVAGFLSALLPSQVADSQSGEAEQELEAVTSAVLDRLSARRSGMTFMLTIAFT
SENAAKAARIANAFADQYLLSQLEAKFDATERANTWLNERLETLREEVRTDEQAVEMYRAENGLLDTGGSTLTEQQISDL
NAQLAIQRAELSAAESSLRNVQTQLERGASLDTIGEVLRSETIRALRAQQTDTSRRRSDLTSRYGPRHPEILAVEREAAD
LEEQVNREIQRIVAGLETEVNVARQRVGSLQSTLSGVRDELVTNNRALVQLRELEREAEASRTLFESFLNRFRQTSEQND
LATADARIVARAPVPVTPSSPNWMLNLALGFILAGMAGAGVIVLLEVFDNGVRSEADVERELGAGHIASVPMLARARFGR
KQGGGEGHPYDYVRENPLSGIAESFRVIRSAILLSNLDKVHKVVAITSALPGEGKTTTTYSLGRISAMSGSKTIILDCDL
RRRLLTKAAAPDAQKGLMEVLAGEATLDEVLMDDAEPGLHILPVVESQFTPRDVFSSDAFKSLLAVLRQRYDLVLIDTAP
VLAVTDTRVIAARADAVVVSVKWKTTPREAAASAIDILRDVNANVLGVALSQVDMNAQARYGYEGSSYYYKNYRSYYSG
>gnl|bykdb|A0A0P7ZZE4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhodobacteraceae bacterium HLUCCA09] (length=310 residues).
MERLKAALDKARETRAATAASAPATAARANPAAKPAPRGNGHASADAGAARRPQAAGSEPAPSTGSSGAVEAAWAEIQTS
EIDPRRLVKRRLISFGRQAEATAFDVLRTKMLQVTGANGWKRVAITSPLPGSGKTTTSINLAVALARQVDLRIILIDLDM
RRPAVARSLGISGKTGVAPVLEGRESFGRQARRLGDNLAIAMNFAPLRDPSDLFLRARTSEVLDEIEATYRPDLILFDMP
PLLVNDDASAFLRNVDCALMVAEAGATTISQVDVCEKELAEQTNVLGVVLNKCRFFSDGYYRYYQAYGDD
>gnl|bykdb|A0A0P9IWP8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas amygdali pv. aesculi] (length=696 residues).
MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVAELIKSRALLGKVVDDLKLNTLQTPDFFPV
IGPYLYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVE
GNGVKIQVAALRAHPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQEAQRANRILDEVSHIYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTY
RSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPV
KPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGMPVYASLPHSRQQERLEKRDQDSKDSRLLSIAAPGEL
AIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDT
LAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNKMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNYHPALR
>gnl|bykdb|A0A0P9J470 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. aceris] (length=696 residues).
MDRRRVFSDRPGLCHSCHAGVSGHRHDSDRAPENRHRGHAGGQCQATLGVAELIKSRALLGKVVDDLQLNRLQTPDLFPV
IGPYLYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDSEHTLLLGGAINRVVE
GHGIKIQVATLQARPGTDFTVSRQRTLSTALIYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLKRVELERLYTREHPTY
RSLMSQINQLEQQRQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGNIGNVRVIDNADTNVERPV
KPMKTLIVLIATLLGALVAMTMVFVRQAFYRGVESAEIIENLGMPVYASLPHSRQQEHLDKRDHAGKESKLLSIAAPAEL
AIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGKRVLLIDADMRKGYLHRLFGLQPKHGLSDT
LAARLRCTEVINTTRVRHLDFISCGFAAPNPSELLMHDNFHKMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTVQEIEASKRRLGQNGILIKGAIFNAVVRKATTSDYDCAAYGYNYHPAPR
>gnl|bykdb|A0A0P9JXN0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas caricapapayae] (length=746 residues).
MHRRLASSFSVRSNRINDRHEPSIPGFPTGLADRSGNCSADAVRPQDPDRVDRRPVFSGGSGVCHSRHAGVSGHRHDSDR
AQKNRHRRHSGGQRQTTLGVAELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAEPLFGLTHYAWG
GEKIDVFQLEVPEHLLGEKLTLTAGRPGQFSLYDNEHNLLLGGTTNRVVEGNGIRIQVATLLARPGTNFSLSRQRTLSTA
LVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESEAALN
TFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTYRSLMSQMNQLEQQKQGLLKKIDALPMTQQE
LLRLTRDMQVISQTYTLMLNKSQEQDILRAGNIGNVRVIDNADTNVEKPVKPMKTLIVSLATLIGALVAMIIVFIRQAFY
RGIESAETIESLGMPVYASLPHSRQQERLEKRTPDSKESRLLSIAAPSELAIESLRSLRTSLHFAMLEARNNVLMISSPT
PGAGKSFVSSNLATIVAQTGKRVLLIDADMRKGYLHRVLGLQPKHGLSDTLAARLRCTDVINQTRVRHLDFISCGFAAPN
PSELLMHDNFHKMLAELSPLYDLILIDTPPVLAVTDATLVGRQAGTCLLVARFGMTTVQEIEACKRRLGQNGILIKGAIF
NAVVRKATTSDYDCAAYGYNYHPAPR
>gnl|bykdb|A0A0P9KZ49 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas amygdali pv. ciccaronei] (length=696 residues).
MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVAELIKSRALLGKVVDDLKLNTLQTPDFFPV
IGPYLYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVE
GNGVKIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTY
RSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPV
KPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGMPVYASLPHSRQQERLEKRDQDSKDSRLLSIAAPGEL
AIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDT
LAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNRMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNYHPAPR
>gnl|bykdb|A0A0P9LE74 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. coriandricola] (length=390 residues).
VRGADTEHPTYRSLMSQMNQLEEQKKALLKKIEALPMTQQELLRLTRDMQVTSQTYSLMLNKSQEQDILRAGSIGNVRVI
DHANANTEKPVKPMKKLIVLMATLIGALVAVMIIFVRQAFYRGVESAEVIEGLGMPVYASLPYSRQQDRLEKNSKSAPTR
PGTRLLSAAAPDDLAIESLRSLRTSLHFAMLEARNNILMISSPTPGAGKSFVSSNLAVIIAQTGKRVLLIDADMRRGYLH
RIFGLQPKHGLSDTLAARRRCADVITPTRIRHLDLISCGFAAPNPSELLMHDNFHKMLAELAPSYDLILVDTPPILAVTD
ASLVGRQAGTCLMVARFGMTTVKEIEACKRRLGQNGILIKGAIFNAVVRKAATSAYDSAAYGYDYKSAPR
>gnl|bykdb|A0A0P9MPC7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas amygdali] (length=696 residues).
MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVAELIKSRALLGKVVDDLKLNTLQTPDFFPV
IGPYLYRTFKPVRDGELSKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVE
GNGVKIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTY
RSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPV
KPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGMPVYASLPHSRQQQRLEKRDQDSKDSRLLSIAAPGEL
AIESLRSLRTSLHFAMLEARNNVLMISSPTPSAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDT
LAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNKMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDHAAYGYNYHPAPR
>gnl|bykdb|A0A0P9NNS0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. cunninghamiae] (length=696 residues).
MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVAELIKSRALLGKVVDDLKLNTLQTPDFFPV
IGPYLYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVE
GNGVKIQVAALRARPGTDFSVSRQHTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTY
RSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRASSIGNVRVIDNADTNVEKPV
KPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGMPVYASLPHSRQQERLEKRDQDSKDSRLLSIAAPGEL
AIESLRSLRTSLHFAMLEARNNVLMISSPSPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDT
LAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNRMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNYHPAPR
>gnl|bykdb|A0A0P9PS59 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. daphniphylli] (length=696 residues).
MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVAELIKSRALLGKVVDDLKLNTLQTPDFFPV
IGPYLYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVE
GNGIKIQVATLRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTY
RSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPV
KPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGMPVYASLPHSRQQERLEKRDQDSKDSRLLSIAAPGEL
AIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDT
LAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNKMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNYHPAPR
>gnl|bykdb|A0A0P9PWZ3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. broussonetiae] (length=696 residues).
MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVAELIKSRALLGKVVDDLKLNTLQTPDFFPV
IGPYLYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLIAGKPGQFSLYDNEHNLLLGGTINRIVE
GNGVKIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANQILDEVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTY
RSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPV
KPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGMPVYASLPHSRQQERLEKRDQDSKDSRLLSIAAPGEL
AIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGRRILLIDADMRKGYLHRLFGLPPKHGLSDT
LAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNKMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNYHPAPR
>gnl|bykdb|A0A0P9Q329 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. castaneae] (length=696 residues).
MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVAELIKSRALLGKVVDDLKLNTLQTPDFFPV
IGPYLYRTFKPVRDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVE
GNGIKIQVATLRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTY
RSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPV
KPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGMPVYASLPHSRQQERLEKRDQDSKDSRLLSIAAPGEL
AIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDT
LAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNKMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNYHPAPR
>gnl|bykdb|A0A0P9QCJ2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas ficuserectae] (length=696 residues).
MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVAELIKSRALLGKVVDDLKLNTLQTPDFFPV
IGPYLYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVE
GNGVKIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEEAETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTY
RSLMSQLNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPV
KPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGMPVYASLPHSRQQERLEKRDQDSKDSRLLSIAAPGEL
AIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDT
LAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNKMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNYHPAPR
>gnl|bykdb|A0A0P9QD19 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. cerasicola] (length=385 residues).
MYTREHPTYRSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGSIGNVRVIDN
ADTNVEKPVKPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGMPVYASLPHSRQQERLEKRDQDSKDSRL
LSIAAPGELAIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGL
QPKHGLSDTLAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNKMLAELSPLYELILIDTPPILAVTDATLVG
RQAGTCLLVARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNYHPAPR
>gnl|bykdb|A0A0P9QIY7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas coronafaciens pv. garcae] (length=828 residues).
MCAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWPVARPARSRCSRPLSAPPFSLRTDLCAALAV
HRRLASSFSVRRDTINDRHEPCSFGSLPGFTGRSGNRSADVVRSQSLDSLDRRAVLPYRAGLRDSGDALLPGQCHDPDRA
QKNRHRGHARGQRQADVSVPELIKSRALLGKVVDDLKLNVLQTPDFFPVIGPYLHRTFTPGSQRTLAEPLFGLNRYAWGG
EKIDVFQLDVPESLLGENLTLTAGQPGQFSLYDDERRLLLRGATNRVVEGSGVTIQVAALQARPGTDFTVSRQRTFSTAL
SYQNRLKITEAGRDSGIIYLSIEDPDAQKANRILEEVSHLYVRQNVERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNN
FQTSAKSVDLSIETKGVLDQVVSLDATLSELKLKRVELERLYTREHPTYRGLMSQINQLEQQRQALLKKIEALPMTQQEL
LRLTRDMQVTSQTYTLMLNKSQEQDILRAGSIGNVRIIDNADSNIERPVRPMKKLIVLIASLFGVLVAVTIIFIRQAFYR
GVESAEVIESLGMPVYASLAFSRHQDRLEKPGKNSRATLEPKLLSIAAPDELAVESLRSLRTSLHFAMLEARNNVLMISS
PTPGAGKSFVSANLAAIIAQTGKRVLLIDADMRKGYLHRIFGLQPRHGLSDTLAARLPCSEVINPTRIHHLDLISCGFAA
PNPSELLMHDNFHKMLAELSPRYDLILIDTPPILAVTDATLVGRQAGTCLLVARFGMTTIKEIEACKRRLGQNGVLIKGA
IFNAVVRNAMTSDYDCAAYGYNYHPAPR
>gnl|bykdb|A0A0P9R9W0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. helianthi] (length=746 residues).
MHRRLASSFSVRSNRINDRHEPSIPGFPTGLADRSGNCSADAVRPQDPDRVDRRPVFSGGSGLCHSRHAGVSGHRHDSDR
AQKNRHRRHSGGQRQTTLSVAELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPLRDGELAEPLFGLTHYAWG
GEKIDVFQLEVPEYLLGEKLTLTAGRPGQFSLYDNEHNLLLGGTTNRVVEGNGIRIQVATLLARPGTNFSLSRQRTLSTA
LVYQNRLKIAEAGRDSGIIYLSIEDQNAQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESEAALN
TFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTYRSLMSQMNQLEQQKQGLLKKIDALPMTQQE
LLRLTRDMQVISQTYTLMLNKSQEQDILRAGNIGNVRVIDNADTNVEKPVKPMKTLIVSLATLIGALVAMIIVFIRQAFY
RGIESAETIESLGMPVYASLPHSRQQERLEKRTPDSKESRLLSIAAPSELAIESLRSLRTSLHFAMLEARNNVLMISSPT
PSAGKSFVSSNLATIIAQTGKRVLLIDADMRKGYLHRVLGLQPKHGLSDTLAARLRCTDVINQTRVRHLDFISCGFAAPN
PSELLMHDNFHKMLAELSPLYDLILIDTPPVLAVTDATLVGRQAGTCLLVARFGMTTVQEIEACKRRLGQNGILIKGAIF
NAVVRKATTSDYDCAAYGYNYHPAPR
>gnl|bykdb|A0A0P9RRZ3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas congelans] (length=696 residues).
MDSQPVFSDRPGLCHSGHAGLSGHRHDSDRAEKNRHRGYPRGQRQATLGVAELIKSRALLGKVVDDLKLSTLQTPDFFPV
IGPYLYRTFKPARDGELAQPLFGLTHYAWGGEKIELFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGAVNRVVE
GKGIKIQVATLQARPGTDFTVSRQRTLSTALLYQNRLKIIEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLSIETKGVLDQVVSLESMLSELKLKRVELERLYTREHPTY
RSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGNIGNVRVIDNADTNVERPV
KPMKTLIVLIATLFGALVAMTIVFVRQAFYRGVESAEVIENLGMPVYASLPHSRQQEHLDKRDPAGKDSKLLSIAAPAEL
AIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGKRVLLIDADMRKGYLHRLFGLQPKHGLSDA
LAARLRCTEVINATRVRHLDFISCGFAAPNPSELLMHDNFNKMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTVQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDCAAYGYNYHPAPR
>gnl|bykdb|A0A0P9S1F1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas amygdali pv. photiniae] (length=696 residues).
MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHSRGQRQAIVSVAELIKSRALLGKVVDDLKLNTLQTPDFFPV
IGPYLYRTFKPVRDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVE
GNGIKIQVATLRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTY
RSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPV
KPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGMPVYASLPHSRQQERLEKRDQDSKDSRLLSIAAPGEL
AIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDT
LAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNRMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNYHPAPR
>gnl|bykdb|A0A0P9SCD7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas amygdali pv. hibisci] (length=696 residues).
MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVAELIKSRALLGKVVDDLKLNTLQTPDFFPV
IGPYLYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLIAGKPGQFSLYDNEHNLLLGGTINRIVE
GNGVKIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTY
RSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPV
KPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGMPVYASLPHSRQQERLEKRDQDSKDSRLLSIAAPGEL
AIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDT
LAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNKMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNYHPAPR
>gnl|bykdb|A0A0P9SPP5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas amygdali pv. eriobotryae] (length=650 residues).
MVSVAELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLL
GKKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVEGNGIKIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDS
GIIYLSIEDQDAQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLSIETK
GVLDQVVSLDSMLSELKLRRVELERLYTREHPTYRSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYT
LMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPVKPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGMPV
YASLPHSRQQERLEKRDQDSKDSRLLSIAAPGELAIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLAPII
AQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDTLAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNKMLAE
LSPLYDLILIDTPPILAVTDATLVGRQAGTCLLAARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAA
YGYNYHPAPR
>gnl|bykdb|A0A0P9T4G3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas savastanoi pv. glycinea] (length=696 residues).
MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVAELIKSRALLGKVVDDLKLNTLQTPDFFPV
IGPYLYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLIAGKPGQFSLYDNEHNLLLGGTINRIVE
GNGVKIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTY
RSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPV
KPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGMPVYASLPHSRQQERLEKRDQDSKDSRLLSIAAPGEL
AIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDT
LAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNKMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNYHPAPR
>gnl|bykdb|A0A0P9UCX7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas amygdali pv. dendropanacis] (length=700 residues).
MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVAELIKSRALLGKVVDDLKLNTLQTPDFFPV
IGPYLYRTFKPVRDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVE
GNGIKIQVATLRARHGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTY
RSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPV
KPMKTLIVLIATLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGMPVYASLPHSRQQERLEKRDQDSKDSRLLSIAA
PGELAIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFSLQPKHG
LSDTLAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNRMLAELSPLYDLILIDTPPILAVTDATLVGRQAGT
CLLVARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNYHPAPR
>gnl|bykdb|A0A0P9V840 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas savastanoi pv. nerii] (length=696 residues).
MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVAELIKSRALLGKVVDDLKLNTLQTPDFFPV
IGPYLYRTFKPVRDGELAKPLFGLTQYAWGGENIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVE
GNGVKIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDGVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTY
RSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPV
KPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGMPVYASLPHSRQQERLEKRDQDSKDSRLLSIAAPGEL
AIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDT
LAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNRMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNYHPAPR
>gnl|bykdb|A0A0P9VA27 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. lapsa] (length=696 residues).
MDRRRVFSDRPGLCHSCHAGVSGHRHDSDRASKNRHRGHAGSQCQATLGVAELIKSRALLGKVVDDLQLNRLQTPDLFPV
IGPYLYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDSEHTLLLGGAINRVVE
GHGIKIQVATLQARPGTDFTVSRQRTLSTALIYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLKRVELERLYTREHPTY
RSLMSQMSQLEQQRQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGNIGNVRVIDNADTNVERPV
KPMKTLIVLIATLLGALVAMTMVFVRQAFYRGVESAEIIENLGMPVYASLPYSRQQEHLDKRDHAGKESKLLSIAAPAEL
AIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGKRVLLIDADMRKGYLHRLLGLQPKHGLSDT
LAARLRCTEVINTTRVRHLDFISCGFAAPNPSELLMHDNFHKMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTVQEIEASKRRLGQNGILIKGAIFNAVVRKATTSDYDCAAYGYNYHPAPR
>gnl|bykdb|A0A0P9VHH8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas meliae] (length=696 residues).
MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVAELIKSRALLGKVVDDLKLNTLQTPDFFPV
IGPYLYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVE
GNGVKIQVAALRAHPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQEAQRANRILDEVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRLELERLYTREHPTY
RSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPV
KPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGMPVYASLPHSRQQERLEKRDQDSKDSRLLSIAAPGEL
AIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDT
LAARLRCTEVIHQTRGRHLDFMSCGFAAPNPSELLMHDNFNKMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNYHPAPR
>gnl|bykdb|A0A0P9VKB0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas amygdali pv. lachrymans] (length=696 residues).
MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVAELIKSRALLGKVVDDLKLNTLQTPDFFPV
IGPYLYRTFKPVREGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLIAGKPGQFSLYDNEHNLLLGGTINRIVE
GNGVKIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTY
RSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPV
KPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEIIESLGMPVYASLPHSRQQERLEKRDQDSKDSRLLSIAAPGEL
AIESLRSLRTSVHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDT
LAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNKMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNYHPAPR
>gnl|bykdb|A0A0P9VVH7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas coronafaciens pv. oryzae] (length=828 residues).
MCAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWPVARPARSRCSRPLSATPFSLRTDLCAALAV
HRRLASSFSVRRDTINDRHEPCSFGSLPGFTGRSGNRSADVVRSQSLDSLDRRAVLPDRAGLRDSGDALLPGQCHDPDRA
QKNWHRGHARGQRQADVSVPELIKSRALLGKVVDDLKLNVLQTPDFFPVIGPYLHRTFTPGSQRTLAEPLFGLNRYAWGG
EKIDVFQLDVPESLLGENLTLTAGQPGQFSLYDDEHRLLLRGATNRVVEGSGVTIQVAALQARPGTDFTVSRQRTFSTAL
SYQNRLKITEAGRDSGIIYLSIEDPDAQKANRILEEVSHLYVRQNVERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNN
FQTSAKSVDLSIETKGVLDQVVSLDATLSELKLKRVELERLYTREHPTYRGLMSQINQLEQQRQALLKKIEALPMTQQEL
LRLTRDMQVTSQTYTLMLNKSQEQDILRAGSIGNVRIIDNADSNIERPVRPMKKLIVLIASLFGVLVAVTIIFIRQAFYR
GVESAEVIESLGMPVYASLAFSRHQDRLEKPGKNSRATLEPKLLSIAAPDELAVESLRSLRTSLHFAMLEARNNVLMISS
PTPGAGKSFVSANLAAIIAQTGKRVLLIDADMRKGYLHRIFGLQPRHGLSDTLAARLPCSEVINPTRIHHLDLISCGFAA
PNPSELLMHDNFHKMLAELSPRYDLILIDTPPILAVTDATLVGRQAGTCLLVARFGMTTIKEIEACKRRLGQNGVLIKGA
IFNAVVRNAMTSDYDCAAYGYNYHPAPR
>gnl|bykdb|A0A0P9WIR8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas coronafaciens pv. porri] (length=828 residues).
MCAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWPVARPARSRCSRPLSAPPFSLRTDLCAALAV
HRRLASSFSVRRDTINDRHEPCSFGSLPGFTGRSGNRSADVVRSQSLDSLDRRAVLPYRAGLRDSGDALLPGQCHDPDRA
QKNRHRGHARGQRQADVSVPELIKSRALLGKVVDDLKLNVLQTPDFFPVIGPYLHRTFTPGSQRTLAEPLFGLNRYAWGG
EKIDVFQLDVPESLLGENLTLTAGQPGQFSLYDDERRLLLRGATNRVVEGSGVTIQVAALQARPGTDFTVSRQRTFSTAL
SYQNRLKITEAGRDSGIIYLSIEDPDAQKANRILEEVSHLYVRQNVERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNN
FQTSAKSVDLSIETKGVLDQVVSLDATLSELKLKRVELERLYTREHPTYRSLMSQINQLEQQRQALLKKIEALPMTQQEL
LRLTRDMQVTSQTYTLMLNKSQEQDILRAGSIGNVRIIDNADSNIERPVRPMKKLIVLIASLFGVLVAVTIIFIRQAFYR
GVESAEVIESLGMPVYASLAFSRHQDRLEKPGKNSRATLEPKLLSIAAPDELAVESLRSLRTSLHFAMLEARNNVLMISS
PTPGAGKSFVSANLAAIIAQTGKRVLLIDADMRKGYLHRIFGLQPRHGLSDTLAARLPCSEVINPTRIHHLDLISCGFAA
PNPSELLMHDNFHKMLAELSPRYDLILIDTPPILAVTDATLVGRQAGTCLLVARFGMTTIKEIEACKRRLGQNGVLIKGA
IFNAVVRNAMTSDYDCAAYGYNYHPAPR
>gnl|bykdb|A0A0P9XCE1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. papulans] (length=696 residues).
MDRRPVFSARPGLRHSGHAGVSGHRHDSDRTPKNRHRGYTGSQCQATLGVAELIKSRALLGKVVDDLKLNRLQTPDLFPV
IGPYLYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDSEHNLLLGGAINRVVE
GHGIKIQVATLQARPGTDFTVSRQRTLSTALIYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLKRVELERLYTREHPTY
RSLMSQMNQLEQQRQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGNIGNVRVIDNADTNIERPV
KPMKTLIVLIATLLGALVAMTMVFVRQAFYRGIESAEIIENLGMPVYASLPHSRQQEHLDKRDHAGQESKLLSIAAPAEL
AIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGKRVLLIDADMRKGYLHRLFGLQPKHGLSDT
LAARLRCTEVINSTRVRHLDFISCGFAAPNPSELLMHDNFHKILAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTVQEIEASKRRLGQNGILIKGAIFNAVVRKATTSDYDCAAYGYNYHPAPR
>gnl|bykdb|A0A0P9YV98 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas savastanoi pv. phaseolicola] (length=696 residues).
MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVAELIKSRALLGKVVDDLKLNTLQTPDFFPV
IGPYLYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLIAGKPGQFSLYDNEHNLLLGGTINRIVE
GNGVKIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEDAETALNNFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTY
RSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPV
KPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGMPVYASLPHSRQQERLEKRDQDSKDSRLLSIAAPGEL
AIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDT
LAARLRCTEVIHQTRVRRLDFMSCGFAAPNPSELLMHDNFNKMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNYHPAPR
>gnl|bykdb|A0A0Q0A5T8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas amygdali pv. sesami] (length=696 residues).
MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVAELIKSRALLGKVVDDLKLNTLQTPDFFPV
IGPYLYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVE
GNGVKIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEEAETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLKRVELERLYTREHPTY
RSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPV
KPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGMPVYASLPHSRQQERLEKRDQDSKDSRLLSIAAPGEL
AIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDT
LAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNKMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNYHPAPR
>gnl|bykdb|A0A0Q0AIE5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas savastanoi pv. savastanoi] (length=696 residues).
MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVAELIKSRALLGKVVDDLKLNTLQTPDFFPV
IGPYLYRTFKPVRDGELAKPLFGLTQYAWGGENIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVE
GNGVKIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDGVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTY
RSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPV
KPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGMPVYASLPHSRQQERLEKRDQDSKDSRLLSIAAPGEL
AIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDT
LAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNRMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNYHPAPR
>gnl|bykdb|A0A0Q0AUD0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. syringae] (length=773 residues).
MAGPARHHRPLPAARVSLRTDLRAALALHRRLAPSFSVRSNRINDRHEPSFPEFPSGLPDRSGNSPADAVRSQDPDPVDR
RRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHAGSQCQATLGVAELIKSRALLGKVVDDLQLNRLQTPDLFPVIGA
YLYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGERLTLTAGKPGQFSLYDSEHNLLLGGAINRVVEGHG
IKIQVATLQARPGTDFTVSRQRTLSTALIYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERSSAE
AAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLKRVELERLYTREHPTYRSL
MSQMNQLEQQRQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGNIGNVRVIDNADTNVERPVKPM
KTLIVLIATLLGALVAMTMVFVRQAFYRGVESAEIIENLGMPVYASLPYSRQQEHLDKRDHAGQESKLLSIAAPAELAIE
SLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGKRVLLIDADMRKGYLHRLLGLQPKHGLSDTLAA
RLRCTEVINTTRVRHLDFISCGFAAPNPSELLMHDNFHKMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLVARF
GMTTVQEIEASKRRLGQNGILIKGAIFNAVVRKATTSDYDCAAYGYNYHPAPR
>gnl|bykdb|A0A0Q0B3J8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. rhaphiolepidis] (length=696 residues).
MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVAELIKSRALLGKVVDDLKLNTLQTPDFFSV
IGPYLYRTFKPVREGELSKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVE
GNGVKIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANQILDEVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEEAETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTY
RSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPV
KPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGMPVYASLPHSRQQERLEKRDQDSKDSRLLSIAAPGEL
AIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDT
LAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNKMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNYHPAPR
>gnl|bykdb|A0A0Q0B9T0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. tagetis] (length=746 residues).
MHRRLASSFSVRSNRINDRHEPSIPGFPTGLADRSGNSSADAVRPQDPDRVDRRPVFSGGSGLCHSRHAGVSGHRHDSDR
AQKNRHRRHSGGQRQTTLSVAELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPLRDGELAEPLFGLTHYAWG
GEKIDVFQLEVPEYLLGEKLTLTAGRPGQFSLYDNEHNLLLGGTTNRVVEGNGIRIQVATLLARPGTNFSLSRQRTLSTA
LVYQNRLKIAEAGRDSGIIYLSIEDQNAQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESEAALN
TFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTYRSLMSQMNQLEQQKQGLLKKIDALPMTQQE
LLRLTRDMQVISQTYTLMLNKSQEQDILRAGNIGNVRVIDNADTNVEKPVKPMKTLIVSLATLIGALVAMIIVFIRQAFY
RGIESAETIESLGMPVYASLPHSRQQERLEKRTPDSKESRLLSIAAPSELAIESLRSLRTSLHFAMLEARNNVLMISSPT
PSAGKSFVSSNLATIIAQTGKRVLLIDADMRKGYLHRVLGLQPKHGLSDTLAARLRCTDVINQTRVRHLDFISCGFAAPN
PSELLMHDNFHKMLAELSPLYDLILIDTPPVLAVTDATLVGRQAGTCLLVARFGMTTVQEIEACKRRLGQNGILIKGAIF
NAVVRKATTSDYDCAAYGYNYHPAPR
>gnl|bykdb|A0A0Q0BM35 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas amygdali pv. tabaci] (length=696 residues).
MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVAELIKSRALLGKVVDDLKLNTLQTPDFFPV
IGPYLYRTFKPVREGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLIAGKPGQFSLYDNEHNLLLGGTINRIVE
GNGVKIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTY
RSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPV
KPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEIIESLGMPVYASLPHSRQQERLEKRDQDSKDSRLLSIAAPGEL
AIESLRSLRTSVHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDT
LAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNKMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNYHPAPR
>gnl|bykdb|A0A0Q0D3D2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas amygdali pv. ulmi] (length=588 residues).
FQRLPKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVEGNGVKIQVAALRA
HPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQEAQRANRILDEVSHIYVRQNVERSSAEAAQRLQFLRS
QLPAVRKQLEDAETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTYRSLMSQMNQLEQQ
KQGLLKKIDALPMTQQELLMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPVKPMKTLIVLIATLIGALVAMTIVFVRQA
FYRGIESAEVIESLGMPVYASLPHSRQQERLEKRDQDSKDSRLLSIAAPGELAIESLRSLRTSLHFAMLEARNNVLMISS
PTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDTLAARLRCTEVIHQTRVRHLDFMSCGFAA
PNPSELLMHDNFNKMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLVARFGMTTAQEIEACKRRLGQNGILIKGA
IFNAVVRKATTSDYDYAAYGYNYHPAPR
>gnl|bykdb|A0A0Q0EVJ8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. solidagae] (length=696 residues).
MDRRRVFSDRPGLCHSGHAGVSGHRHDSDRAPENRHRGHAGGQCQATLGVAELIKSRALLGKVVDDLQLNRLQTPDLFPV
IGPYLYRTFKPAREGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDSEHTLLLGGAINRVVE
GHGIKIQVATLQARPGTDFTVSRQRTLSTALIYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLKRVELERLYTREHPTY
RSLMSQINQLEQQRQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGNIGNVRVIDNADTNVERPV
KPMKTLIVLIATLLGALVAMTMVFVRQAFYRGVESAEIIENLGMPVYASLPHSRQQEHLDKRDHAGKESKLLSIAAPAEL
AIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGKRVLLIDADMRKGYLHRLFGLQPKHGLSDT
LAARLRCTEVINTTRVRHLDFISCGFAAPNPSELLMHDNFHKMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTVQEIEASKRRLGQNGILIKGAIFNAVVRKATTSDYDCAAYGYNYHPAPR
>gnl|bykdb|A0A0Q0FJK6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas coronafaciens pv. zizaniae] (length=828 residues).
MCAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWPVARPARSRCSRPLSATPFSLRTDLCAALAV
HRRLASSFSVRRDTINDRHEPCSFGSLPGFTGRSGNRSADVVRSQSLDSLDRRAVLPDRAGLRDSGDALLPGQCHDPDRA
QKNRHRGHARGQRQADVSVPELIKSRALLGKVVDDLKLNVLQTPDFFPVIGPYLHRTFTPGSQRTLAEPLFGLNRYAWGG
EKIDVFQLDVPESLLGENLTLTAGQPGQFSLYDDERRLLLRGATNRVVEGSGVTIQVAALQARPGTDFTVSRQRTFSTAL
SYQNRLKITEAGRDSGIIYLSIEDPDAQKANRILEEVSHLYVRQNVERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNN
FQTSAKSVDLSIETKGVLDQVVSLDATLSELKLKRVELERLYTREHPTYRGLMSQINQLEQQRQALLKKIEALPMTQQEL
LRLTRDMQVTSQTYTLMLNKSQEQDILRAGSIGNVRIIDNADSNIERPVRPMKKLIVLIASLFGVLVAVTIIFIRQAFYR
GVESAEVIESLGMPVYASLAFSRHQDRLEKPGKNSRATLEPKLLSIAAPDELAVESLRSLRTSLHFAMLEARNNVLMISS
PTPGAGKSFVSANLAAIIAQTGKRVLLIDADMRKGYLHRIFGLQPRHGLSDTLAARLPCSEVINPTRIHHLDLISCGFAA
PNPSELLMHDNFHKMLAELSPRYDLILIDTPPILAVTDATLVGRQAGTCLLVARFGMTTIKEIEACKRRLGQNGVLIKGA
IFNAVVRNAMTSDYDCAAYGYNYHPAPR
>gnl|bykdb|A0A0Q0FK97 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. aptata] (length=773 residues).
MAGPARHNRPLPAARVSLRADLRAALALHRRLASPFSVRSNRINDRHEPSFPEFPSGLPDRSGNSPADAVRSQDPDPVDR
RRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHAGSQCQATLGVAELIKSRALLGKVVDDLQLNRLQTPDLFPVIGP
YLYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDSEHNLLLGGALNRVVEGHG
IKIQVATLQARPGTDFTISRQRTLSTALIYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERSSAE
AAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLKRVELERLYTREHPTYRSL
MSQMNQLEQQRLGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGNIGNVRVIDNADTNVERPVKPM
KTLIVLIATLLGALVAMTMVFVRQAFYRGVESAEIIENLGMPVYASLPYSRQQEHLDKRDHAGQESKLLSIAAPAELAIE
SLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGKRVLLIDADMRKGYLHRLFGLQPKHGLSDTLAA
RLRCTEVINTTRVRHLDFISCGFAAPNPSELLMHDNFHKMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLVARF
GMTTVQEIEASKRRLGQNGILIKGAIFNAVVRKATTSDYDCAAYGYNYHPAPR
>gnl|bykdb|A0A0Q0G2J0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas tremae] (length=828 residues).
MCAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWPVARPARSRCSRPLSATPFSLRTDLCAALAV
HRRLASSFSVRRDTINDRHEPCSFGSLPGFTGRSGNRSADVVRSQSLDSLDRRAVLPDRAGLRDSGDALLPGQCHDPDRA
QKNWHRGHARGQRQADVSVPELIKSRALLGKVVDDLKLNVLQTPDFFPVIGPYLHRTFTPGSQRTLAEPLFGLNRYAWGG
EKIDVFQLDVPESLLGENLTLTAGQPGQFSLYDDEHRLLLRGATNRVVEGSGVTIQVAALQARPGTDFTVSRQRTFSTAL
SYQNRLKITEAGRDSGIIYLSIEDPDAQKANRILEEVSHLYVRQNVERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNN
FQTSAKSVDLSIETKGVLDQVVSLDATLSELKLKRVELERLYTREHPTYRGLMSQINQLEQQRQALLKKIEALPMTQQEL
LRLTRDMQVTSQTYTLMLNKSQEQDILRAGSIGNVRIIDNADSNIERPVRPMKKLIVLIASLFGVLVAVTIIFIRQAFYR
GVESAEVIESLGMPVYASLAFSRHQDRLEKPGKNSRATLEPKLLSIAAPDELAVESLRSLRTSLHFAMLEARNNVLMISS
PTPGAGKSFVSANLAAIIAQTGKRVLLIDADMRKGYLHRIFGLQPRHGLSDTLAARLPCSEVINPTRIHHLDLISCGFAA
PNPSELLMHDNFHKMLAELSPRYDLILIDTPPILAVTDATLVGRQAGTCLLVARFGMTTIKEIEACKRRLGQNGVLIKGA
IFNAVVRNAMTSDYDCAAYGYNYHPAPR
>gnl|bykdb|A0A0Q4CFJ9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. Leaf9] (length=593 residues).
MVNGRYPASGRATRQRVAGEILIDHLAIVPTRLSRLVDIRFTSPNPEFSAKIVNTWSDAFIQTNLERKVQATSYGRNLLQ
RQLAQQKERLDESQRQLVTYASQERIINLPAQSNADGSTAERSIVADDLASLNTALSQATAERIAAESRYREGSRAGASS
EALRNQAINSLRQRRAEYAAEYQKLLTQFEPEYPAAKALKSQIDQLDRSITNEERRVSGSIETDYRGAVERERALQARVE
QLKSSYLDLRRRSIQYNIFQQEVDTNRALYEGLLQRFKEIGVAGGVGVNNVAVVDQADVPQHPSSPRLLINLAIALVAGL
SIGAALAFALEQMDEAIADPGEVERRLGLPLLGSVPKVENVTPKEALLDRKSELVDAYLAIQTNLAFTTEHGVPRSLSVT
STRPAEGKSTTALALATMLARSGKRVILVDGDMRSPSVHHLGGVNHDHGLSNFLAGQEDIAPLTFDMADLGFTAMSAGPI
PPNAAELLTGNRLSLLIERLHEHFDHVVIDSPPVMGLADAPLIASRVEGVVYAVESHGIRSTLVKTALARLAAANAHIFG
GVLTKFEARKAHYGYGYEYGYGYGREKATEAKG
>gnl|bykdb|A0A0Q4FE58 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. Leaf16] (length=592 residues).
MVNGRYPASGREIRQRVAGETLLKNLNIAPTRLSRLVDIRFTSPNPEFSAKIVNTWSEAFIQTNLERKVEATSYGRNLLQ
RQLAQQKERLDESQRQLVGYASQERIINLPAQSNADGSTSERSIVADDLASLNTALSQATAERIAVEARYREGGRAGASS
EALRNQAINALRQRRAEYAADYQKLLTQFEPEYPAARALKSQIDQLDRSISNEERRVSGSLETEYRGAVERERALKARVE
QLKGSYLDLRRRSIQYNIFQQEVDTNRALYEGLLQRFKEIGVAGGVGVNNISIVDQADIPQKPSSPRLLVNLAISLLAGL
GLGAALAFALEQMDEAIADPAEVERRLGLPLLGSVPKVDGVTPRDALLDRKSDLVDAYLAIQTNLAFTTEHGVPRSLSVT
STRPAEGKSTTALALATMLARSGKRVILVDGDMRSPSVHHLGGVNHDYGLSNFLAGQEDIAPLTFDMADLGFTAMSAGPI
PPNAAELLTGNRLSLLIERLHEHFDHVVIDSPPVMGLADAPLIASRVEGVVYAVESHGIRSTLVKTALARLASANAHIFG
GVLTKFEARKAHYGYGYEYGYGYGREKAEAKG
>gnl|bykdb|A0A0Q4IGG1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. Leaf226] (length=593 residues).
MVNGQYKAAGRAERQQLAGKILLDNISINPTRLSSLVDISFDSPDPILSTQIVNAWSDSFIQTNLERKVQATSYGRNMLQ
RQLALQKSRLDDSQRQLVAYASAQQIINLPAQGAGSGGSTTVERSIVADDLAALNATLSQATAERIQAQARAQQSGRAGA
STEALRNQAINTLRQRRAELAADYQRLMVQFEPGYPAARAIQTQIDQLDRSISREESRVTGSIQAEYREALQREGALQAR
VNQLKSSYLDNRRRSIQYNIYQQEVDTNRALYDGLLQRYKEIGVAGNIGVNNISVVDAANVPQRPSSPRLLLNLLVSLLA
GLAIGSLAAFALEQMDEAIADPAEVERQLGLPLLGSVPKVAGESSPRDQLLDRKSDLVDAYIAINTNLGFTTEHGVPRTF
SVTSTRPAEGKSTTALALATMLTRAGKRVILIDGDMRSPSVHELGGVDHDRGLSNFLAGDDAIETLTFPMHDLGFVAMSA
GPIPPNAAELLTGNRLSVLIERLLERFDHIVIDSPPVMGLADAPLIASRVEGVVYAVESHGIRTTLVKTALHRLAAGNVR
IFGGVLTKFESRKAHYGYGYEYGYGYGRHEAKS
>gnl|bykdb|A0A0Q4JWC8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. Leaf29] (length=592 residues).
MVNGRYPASGREIRQRVAGETLLKNLNIAPTRLSRLVDIRFTSPNPEFSAKIVNTWSEAFIQTNLERKVEATSYGRNLLQ
RQLAQQKERLDESQRQLVGYASQERIINLPAQSNADGSTSERSIVADDLASLNTALSQATAERIAVEARYREGGRAGASS
EALRNQAINALRQRRAEYAADYQKLLTQFEPEYPAARALKSQIDQLDRSISNEERRVSGSLETEYRGAVERERALKARVE
QLKGSYLDLRRRSIQYNIFQQEVDTNRALYEGLLQRFKEIGVAGGVGVNNISIVDQADIPQKPSSPRLLVNLAISLLAGL
GLGAALAFALEQMDEAIADPAEVERRLGLPLLGSVPKVDGVTPRDALLDRKSDLVDAYLAIQTNLAFTTEHGVPRSLSVT
STRPAEGKSTTALALATMLARSGKRVILVDGDMRSPSVHHLGGVNHDYGLSNFLAGQEDIAPLTFDMADLGFTAMSAGPI
PPNAAELLTGNRLSLLIERLHEHFDHVVIDSPPVMGLADAPLIASRVEGVVYAVESHGIRSTLVKTALARLASANAHIFG
GVLTKFEARKAHYGYGYEYGYGYGREKAEAKG
>gnl|bykdb|A0A0Q4KFL8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. Leaf32] (length=592 residues).
MVNGRYPASGREIRQRVAGETLLKNLNIAPTRLSRLVDIRFTSPNPEFSAKIVNTWSEAFIQTNLERKVEATSYGRNLLQ
RQLAQQKERLDESQRQLVGYASQERIINLPAQSNADGSTSERSIVADDLASLNTALSQATAERIAVEARYREGGRAGASS
EALRNQAINALRQRRAEYAADYQKLLTQFEPEYPAARALKSQIDQLDRSISNEERRVSGSLETEYRGAVERERALKARVE
QLKGSYLDLRRRSIQYNIFQQEVDTNRALYEGLLQRFKEIGVAGGVGVNNISIVDQADIPQKPSSPRLLVNLAISLLAGL
GLGAALAFALEQMDEAIADPAEVERRLGLPLLGSVPKVDGVTPRDALLDRKSDLVDAYLAIQTNLAFTTEHGVPRSLSVT
STRPAEGKSTTALALATMLARSGKRVILVDGDMRSPSVHHLGGVNHDYGLSNFLAGQEDIAPLTFDMADLGFTAMSAGPI
PPNAAELLTGNRLSLLIERLHEHFDHVVIDSPPVMGLADAPLIASRVEGVVYAVESHGIRSTLVKTALARLASANAHIFG
GVLTKFEARKAHYGYGYEYGYGYGREKAEAKG
>gnl|bykdb|A0A0Q4Q524 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. Leaf67] (length=593 residues).
MVNGRYPAAGRPIRQRTAGQILRDHLDVAPTRLSRLVEIRFTSPDAAFSARIVNTWSDAFIQTNLERKVQATSYGRNLLQ
RQLAQQKERLDESQRQLVAYASQERIINLPAQQNGDGTTSERSIVADDLASLNTALSQATAERIAAEARYREGGRAGASS
EALRNQAINTLRQRRAEFAAEYQKLLIQFEPEYPAVKALKSQIDQLDRSIANEERRVSGSLETDYRGAVERERALQARVE
QLKSSYLDLRRRSIQYNIYQQEVDTNRALYEGLLQRFKEIGVAGGVGVNNVSVVDQADVPQKPSSPRLLVNLAIALIAGL
GISAVLAFALEQMDEAIADPAEVERRLGLPLLGSVPKVDGVTPKEALLDRKSDLVDAYLAIQTNLAFTTEHGVPRSLSVT
STRPAEGKSTTALALATMLARSGKRVILVDGDMRSPSVHHLGGVSHDHGLSNFLAGQDDIAPLTFDMTDLGFTAMSAGPI
PPNAAELLTGNRLSLLIERLHEHFDHVVIDSPPVMGLADAPLIASRVEGVVYAVESHGIRSTLVKTALARLASANAHIFG
GVLTKFEARKAHYGYGYEYGYGYGRDKAAEAKG
>gnl|bykdb|A0A0Q4UFQ5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. Leaf257] (length=597 residues).
MFESGRPIQTAAARASRIKAAGNLILARMDVEPERMSRLVEISFTSPDPELSKRVVDAWSTNFIQSTLERRYSATSYARN
FLEERLKQLRIRIDESERALVNYASQQNIVNIPGSTDSNGQTTGERSLVVDDLANLNRELAQATAERVAAESRLNSGGAT
KEQLDNTANSTLRTKRAELAADYARMLQQFDPAYPPAKALQAQIRSIDAALRGEGSRVDAVLRATYQASLSREQQLTSQV
NKLTGRVLDFRRRSIQYNILQREVDTNRQLYDALLQRYKEIGVAGGVGVNNIAVVDDAELPVAPDRPRPLFNMALALFAG
LVVGAALAIVFEQIDEGLTDPIEVEEVLGLPLIGVTPKLPNDKPVVALDDPKSILTEAYASIVANLGFATSHGIPRTLAI
TSARAAEGKSSTSYAIARSIARTNRSVLLIDADMRSPSVHALLEKPLDQGLSNFLAGANDIDRLIRPTEIAGLSIISAGP
QPPSTPELLSGDRLRALLEQMGDRFDHIVLDLPPVMGLADAPLIASQVEGTLVITAAHSTHKNVARIAIGRLRSAHAHML
GVVLTMFDAKQASYGYGYGYGYGNGYGYGSSSDEAAN
>gnl|bykdb|A0A0Q6QPG8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas sp. Root329] (length=262 residues).
MEIFNPDTENAEQQTSSKAMTPTAQSTGLNALSYVQTKVVPLRPDHLERHRIVAYNKNSNMGGAFDLLRTQVLKIMEENG
WRTLAITSPTPEAGKTVLAINLAMSIAHHTTKTALLVDFDLRRPKVGEYLGLPMEKSLNELLADEAELQEVLVNPTLPRF
VVLPTREPIPLSTEVLSSPAVSHLIADLRERYNSRIVIFDLPPLLSSDDVINVLPRFDCVLLVVANGLNSRKEIEESLHH
LGTANLIGTVLNKAEPENRSYY
>gnl|bykdb|A0A0Q6QV61 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhizobium sp. Root1203] (length=241 residues).
MRSREEENQITWTELPPLKIDPDAIARNRIVTANRSDIAHVAFDMMRTKLLQSLRQNNWKSVAITSPTPACGKTFTAVNL
AFSLANQPDCRTLLLDLDLRRPQVGKTLGIKNAGSMESFLRREIECDDVFMRYGDNLAIAPNRQPAQYSAELLQSTTTAE
ALLEMRQRMSPDIILFDLPPMLSTDDVLAFLPNVDCVVLVAAAEHSTLSEVDVCEQSLAEKTNVLGVVLNRCQYSAEKYG
Y
>gnl|bykdb|A0A0Q6TS97 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Caulobacter sp. Root342] (length=574 residues).
MAGKILLQHVGVAPVRGSSLVDVRAVTPDPALSQRIAQAWGEDFIASNLERRFEASGYARKFLEGRIEQLREKLEMSERQ
VVAYAVQQGIINLPSSVDASTSGAAVGGRSLLTDDLIALNSALEVATAERIVAESRLNEIKRPDASSIALGNDAIASMRQ
RRADAAAEYAKLMVQFRPDYPQAKALASQIQALDAAIGQEEGRVRVSLQQAYDSSQTRERALTARVEGLKDGLADLRRRS
IQYNIYQRDADTNRELYNALLQRYKEIGVAGGAENNNVAIVDPARLPDRPASPKLLVNLVLAMMAGGLAAALVAAGLEQI
DEGIVDPADLEEKLGLPLLGVAPKVQVEDPLMALRDPRSKLVEAYLSVHANLELSTAKGAPRSLAVISTRPREGKSTTTV
ALAQSLARARRKVVLVDADLRSPSVHSAFGLKNGLGVSNFLSGAEDLDSVLHATEHEGLWVMTAGPPPPNAGDLLMGDRL
ALLVKRLKERFDHVIVDSPPVIGLADAPLVAAAVDGVVYAVEARSVPAGTVRAALSRLRASQAHILGAVLTKFEAKKAGY
GFDYGYGFDYDYGR
>gnl|bykdb|A0A0Q6UYB4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Caulobacter sp. Root343] (length=574 residues).
MAGKILLQHVGVAPVRGSSLVDVRAVTPDPALSQRIAQAWGEDFIASNLERRFEASGYARKFLEGRIEQLREKLEMSERQ
VVAYAVQQGIINLPSSVDASTSGAAVGGRSLLTDDLIALNSALEVATAERIVAESRLNEIKRPDASSIALGNDAIASMRQ
RRADAAAEYAKLMVQFRPDYPQAKALASQIQALDAAIGQEEGRVRVSLQQAYDSSQTRERALTARVEGLKDGLADLRRRS
IQYNIYQRDADTNRELYNALLQRYKEIGVAGGAENNNVAIVDPARLPDRPASPKLLVNLVLAMMAGGLAAALVAAGLEQI
DEGIVDPADLEEKLGLPLLGVAPKVQVEDPLMALRDPRSKLVEAYLSVHANLELSTAKGAPRSLAVISTRPREGKSTTTV
ALAQSLARARRKVVLVDADLRSPSVHSAFGLKNGLGVSNFLSGAEDLDSVLHATEHEGLWVMTAGPPPPNAGDLLMGDRL
ALLVKRLKERFDHVIVDSPPVIGLADAPLVAAAVDGVVYAVEARSVPAGTVRAALSRLRASQAHILGAVLTKFEAKKAGY
GFDYGYGFDYDYGR
>gnl|bykdb|A0A0Q6VA36 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhizobium sp. Root1220] (length=262 residues).
MEQTVVSAQNPAAHRDGDRMPVSRSQELSQIAWDALSPLVIDHDAIARNRIVTANRSDTAHVAFDMLRTKLLQELRQNNW
TSVAITSPTPGCGKTFVAANLAFSLANQKDCRTLLLDLDLRRPQVGKTLGIKNAASMESFLKGEIEVGDTFLRHEENLAI
AANRKPAQFSAELLQSTASTDALFEMKQRMMPDIILFDLPPMLSTDDVLAFLPNVDCVILVAAAEHSTLAEVDVCEHSLA
AKANVLGVVLNKCKFTPEKYGY
>gnl|bykdb|A0A0Q8RMY3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingopyxis sp. Root214] (length=255 residues).
MVILKLADLASFTPAISEIKKHRIVGFDSRDARARPFNLLRTSFAKKLKEDGHRLVGITSATPAAGKSFLSMNLASSLAR
VIEEPVFLVDLDIRRASLAEEIGLVPERGIESFLEGDITDLTEIGHRIEGTNLGLFPAVRRTSNTAELLASDRFTQMIEV
LRGRCEASTILFDLPPAFASDDAMISLSHLDGFILVVDAGKTTRRHVTDVLSMLSPTPCLGTILNRYSGGLGDSYGYGYG
GPDYGKYYNLKDPAA
>gnl|bykdb|A0A0Q8XKK5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. Root241] (length=587 residues).
MTAVERAKREKAAVQILQSNIAISPIRNSALVDIKYTSGSPELAAQIANTWAQQFIEASMDRRFASTADARKFLESRLAD
LRTRLETSERDLVNYAAEKGITALGTSKSADGRTEVERTLVSSDLEALNAALASATADRLAAESRSVRQRGASPQALTNP
AISSLRQRRAEVASELAKLSVQFEPGYPASRALAEQLQSLDSAISREEARVDSSRSTEYREAQMREEGLRRQVETLRLQL
GKQSRDSIQYNIYQREADTNRQLYDGLLQRYKEIGVAGVGANNIALVDVAKVPDRQSSPRLMFNMALALVAGFALAGLAT
FALEQIDEGFREPGEVSKQLQIPLLGSVPNIEEGDALQQLMDAKSSVSEAYLSIRSNLAFSTDHGVPRAFMVTSTSPAEG
KSTTSFAMAVVLGRTGKNVLILDADMRSPSIHQFLDADNAAGLSNILAGDNDWQKLIKPSSFKGLSLLSAGPTPPSAAEL
LSSDRMSMLIEQLLEHFDHVVVDAPPILGLADAPLLSKAVEGCIYVIETERVAVRGVRAALDRLHSVHAHIFGGVLTKLS
SRHAGYGYGYGYGYGYGDTADTNARDG
>gnl|bykdb|A0A0R0BVC7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Stenotrophomonas terrae] (length=207 residues).
LRTSLHFAMMEAKNNILVVSGPRPGIGKTFIAANLAAVIAQAGQKVIVVDADMRRGTLHKVLGAAHSAGLSDVLAGKVEL
NAAISTAPGLDGMHYIGRGEVPPSPSELLMHPRFAQILEELERNYDLVIIDTPPVLAVTDAVIVAKHAGSTLMVTRFGVN
HPKEIRLAMKRFEQNGVQVKGAIFNAVEKRKTGYHSYAYYEYASDTP
>gnl|bykdb|A0A0R3KGJ5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Bradyrhizobium jicamae] (length=270 residues).
MDSIKQAVELARAADVHHPGTLSGPPLAADGSLHSSAESQHNEVRLRADHLEANRIVAYGTSGKNGRYYDMLRTQVLQEM
DKKSWQFLAVTSPTAGCGKTVTACNLALSISRLPERSVLLVDLDLRRPAVGKYLGISGNGAVLNVLEGRTPLSSAVVQAS
VGPNRMLVLPGSVSSNSSEWMASQTMGALLQTIKRDFRSRIVIFDLPPLLLGDDVISILPRIDATLLVAGVGSTSVSDIK
ECQKHLQRTPVVRVVVNKVTETGGPYYGYY
>gnl|bykdb|A0A0R3N604 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Bradyrhizobium lablabi] (length=270 residues).
MDSIKQAVELARAAEVHRPGALSGSALAAEGPLQRSAESPFNEVRLRADHLEANRIVAHGTSGQNGRYYDMLRTQVLQEM
DKKSWQFLAVTSPTAGCGKTVTACNLALSISRLPERSVLLVDLDLRRPAVGNYLGISGTGGVLDVLEGRAPLSSSVVQAS
VGPNNILVLPGGVSSNSSEWMASQTMGAMLQTIKRDFRSRIVIFDLPPMLLGDDVISILPRIDAALLVAGIGNTTVADIK
ECQRHLQRTPVIRVVVNKSTETVGSYYGYY
>gnl|bykdb|A0A0S4XR18 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sulfurovum sp. enrichment culture clone C5] (length=610 residues).
MAQNSTKPWEIDGEYKFGQAIKTPYFTFVIKATKDFGLNDTSYKIIHQSNKNSFIDGFIRPNLNVAQISKQASIVKITFE
DAIPQRGVDIVNNLVKVYFAQKLDYQREEVEKKLKFVNDQLTITHDNLSKSQLEIKDFKQSNTVATIPNSASTLLNAMVD
IDTQLQQANMKLSVLEGLIRQMKTGNGINFVSIDVLGAPNSSINNIITALQQKNAARTALLAEYTPKHPDVIEISEEISA
LEVSLRGSIKSLYNSVQKQKNDLETTKKSYEYSLGGMPSSELGLMNLSRNFEVNQKMYSYLLEKKAEFEIMNAATISKNR
ILDNAIVYPQPIKPKRSLIMMVGFILGLILGLFVAFIKEFFNNKIITPEDIERITDIPMYGVVPENTQEETAFIESLNMI
RTNMEFISSESNSKVIMISSNIPEEGKTTISANLARTLAKGNKKVVLLDLDMRKSKLLREFSNLNVKDGSSSLLVGKVAL
DDVIIHAGENLDVIFAGKIPPNPSELLLSSNVEKIVNELKNSYDYVIIDTAPIGLVTDTMILLKKHIHDLFLVVVRSEFT
DKSLLVNFNKMTHKHHLHSVGLILNGVKISQGNYYGYGYGYGYGTNEKIK
>gnl|bykdb|A0A0S6X1X6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Novosphingobium sp. MBES04] (length=343 residues).
MDEQNSGVQYNLLKRVADTNRSLYDTLLARFNQLNAASGAVSNNITVVDYAEVPTTPSSPKMLINLVIALLIGLVVSALV
ILLREYFDDAIRSPEDVERKLGIPLLALVPNSEDVQSAISNVRSPVAEAYHTLVANLSLSTQTGLPRVLMLTSSKESEGK
SSSCEAIARDLAALGKSVLLVDADLRRPTLHSKFCDRKAPGLSAYLTGNASFEEVLQPSGVENLTCITALPIPLQPSLLL
GGVRLGELVARARAMFDVVILDCPPMLGLSDTASISAYVDGVLVVIDAQAYHRGAVKSVLRRLQLTGAPVLGVALTKFDT
QRAHGQYSYYGNNYYQYGDASKA
>gnl|bykdb|A0A0T2QIS1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Altererythrobacter sp. Root672] (length=588 residues).
MDDSSAASSSEDRAGREKLAVDLLLSHVTISPITRSRLVDIGYTSGSADLSATIANTWAQQFVASSLDRRFSSTADARKF
LEGRLAELAQRLEESERLAVNYAARNDIVLLGRTITPDGRTLVDRTLTSSDLEALNTALAQATAERVAAESRARTAGPSE
LSITNPTIVALRDRRAQAAADYAKLMVQFEPGYPAAQALQEQIASLDSAIAREDARIVNSRTAEFRNVATRESDLRRRVA
DLKAQLNTQQRASIQYNIYQREADTNRQLYDSLLQRYKEIGVAGVSISNIAIVDGAQVPDSPTSPDLLLNLALASIAGLG
LAFLVVLGLEQIDEGVRDPSQIGRELDVALLGSVPRMDDVEAEEALKDVKSELSEAYFSVQSNLSFATDHGFPRSLMLTS
SRPAEGKTTSSVALAAAIGRTGKRVLLIDADMRSPSCHQYFELPNDAGLSNFLTGSEDWSALVLPTDLRGLSLMTAGPTP
PSAAELYTGDRLKDLVQKALTEFDHVVVDSPPILGLADAPLISRAVEGCAFVIEAEGVAVRGLRSAVNRLRQANARIYGA
IVTKLDHKSAGYGYGYGYGYGYGNQTEA
>gnl|bykdb|A0A0T5NSU3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Roseovarius atlanticus] (length=249 residues).
MPPKTGQSDTDRPAWEALEALQIDGKRLLHNRVTTYEHGDESAPFDLLRTRMLQQAHDNGWRRIGLVSPNAGCGKSTVAV
NLAFSLARHRDIYSLVLDFDLRRKGMTNVLGQFPSLGTADVLRRQADFSDVARRFGPNVAFGLNSERRVQDPSEILQSSM
AAEVLEEIETKYQPDIVLFDLPPIMDSDDNFGFLKKVDCALVVVAAEKTSMSQIDVAERHVAELTNVMGLVLNKCRYPSK
TQGQVYGKY
>gnl|bykdb|A0A0T9WT26 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Salmonella enterica subsp. enterica serovar Bovismorbificans] (length=356 residues).
MPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITEASTVGDVRIVDPAITQPGVLKPKKALIILGSIILGLMLSIVGVL
LRSLFNRGIESPQALEEHGISVYASIPLSEWQKARDSVKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQA
QNNVLMLTGVSPSIGKTFVCANLAAVISQTHKRVLLIDCDMRKGYTHELLGTNNVDGLSDILAGKGEIASCAKPTAIANF
DLIPRGQVPPNPSELLMSERFGELIAWASSRYDLVLIDTPPILAVTDAAIVGRHAGTTLMVARYAVNTLKEVETSLSRFD
QNGIQVKGVILNSIFRRATGYQDYGYYEYEYQSDSK
>gnl|bykdb|A0A0U2VAW2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudoalteromonas translucida KMM 520] (length=390 residues).
MLTDWHYPTYQGLVEQIAAVKEQRKALVGEVGNLPETQQELLRLKRDVEVSNQIYTLLLGKTQELDIVRAGTVGNVRIID
YAEVNTSKPVKPKKALIVVMATMLGGMLGVAIVLVQKAMHKGVEDPSEIEALGIPVYASVPHSEHQDKLAGFNKGRKSKA
AKAKSILATDNPADLAVEALRSLRTSLHFAMMEAKNNVIAISGPSPGVGKSFISVNLAVVLAQSGKKVLIVDADMRKGYL
QTQFNIEAAEGLSDYLSGRLNLRQVTKATKVEGLSVITRGQIPPNPSELLMHSNFSKFIAELSTAYDLVIIDTPPILAVT
DPAIVSAHAGTTLLVTRFGQNHLREIELTRNRFEQNGIDIKGVVFNGVLKKASNAYGYYGYYNYEYKSDA
>gnl|bykdb|A0A0W1DLQ3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingopyxis sp. H050] (length=270 residues).
MADADPTTLNSRDTLRLADLPVFTPEKSRISSHKLVGFDSRDIRARPFNLLRTSLAKKTKEKGFRLVGTTSATPAAGKSY
LSLNLASSLARVTEQPVFLVDLDIRRASLAEEIGLVTEQGIESFLEGEVVDLTQVGVRIEGTQLGLFPAVRRKRNTAELL
AGERFAEMIEIFRNRCEAAIILFDLPPAFANDDAMISLEHLDGYLLVVDSGRTTRKHVQDVLAMLHPTPCIGSVLNRYEG
GFADSYGYGYGTGHYGKYYEATDDAADGTD
>gnl|bykdb|A0A0W1GMS6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingopyxis sp. H071] (length=261 residues).
MNSFPNLPQPLGGTPLIAGLPGIGEVPDARDLELSEKLVGFESKDPRSRSFNLLRTQLIKKLAESGGRLVGITSPAPHAG
KSFVASNLAASIGQLPNKRTFLIDLDLRRATIARIFGLDVPEGITEFLIGDEIELRQIGRRIGESNLVVYPTLAAPVNSA
ELMVSERLDDLVARARALGDDAIVIFDLPPVFANDDAILVAEKLDGVLLVIEQGVTTKKQLQGAMQLIHPTPLLGTVFNR
FTGGNGDPYGYGGKYDSYYNS
>gnl|bykdb|A0A0W1ICB0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingopyxis sp. A083] (length=675 residues).
MTPQYTATSRIEIAREQANVTNVEGLKRDSNAPDQEFYLTQYSLLNARSLAERVERRLRLARNPEFFAAHGETPEGEGLL
SGLRSGPVSAADLRQRERQAVELLLDNVGISPLRGSALVDVSYSSASPQLSRLIASTWVNEFVQQSMDRRLASTADARIY
LEGRLQGLRDRLEKSERDLVNYAARQGIVRLSEIQGEDGRTRTTQTLASSDLEQLNRLLVQATAERAEAESKLSAARAPG
ATQLGLSNQSLSTLRQRRAEANAAYQELLVQFEPEYPQAQAAREKVAALDRAISAEETRVRGAYSADYNAAVQRETDLRA
RVDRLLGRLDTENRSSIQYNIYQREVDTNRELYDGLLQRYKEIGVAGVGTNNISVVDDAVNPVKPSSPRLVLNLAAALLL
GLLFAGLTVVILENLDESVREPQQISDRLGVPLLGAIPVVDDEVLSDIEDPKSILSEAYMTVRTNLGFSTDHGLPRTMAL
TSTSPSEGKSTSAYSLARVIGRTSGSVVLVDVDMRRPVVATRLGLDNSKGVSNFLAGEDNWEDLIQTIGKSNVSFISAGP
VPPSASELLSGDRLASLVRALSERFDHVILDSPPMLGLSDAPLIANVVEGLIYVIEADRTAVRASQAAITRLRESRAHIL
GALLTKYRARQSGYGYGYGYGYSYGKDAAATDGAN
>gnl|bykdb|A0A0W7WHP4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Ponticoccus marisrubri] (length=499 residues).
MTDQRKFRRKGKRVRDAAPTETDMTPVPPLEPRARRSEDTLPETGGTSARETEEAREAEEARAAETQRATEEQAKRDAEA
QRAADAKRAADAKRAAEEQARREAEEQARREAAEHARREEQAQREAQAQRAAEEQAHREAEEQREARARSAAAVEALRRA
EAERQAAAARKAELEERAAEEARLAEEARLKELDARRRALAEARSIAARRGADPDGPAAPPRPDPERQPAPQSSRPGRPP
PLALTNPAERAERVEAATRAAWARLDSFALDAGHLNRNRIITARRDDPAHAAFDVLRTRLLQALHEHGWKRVAITSPGKD
CGKTFTAANLAISLSRQENCRTLLLDCDMRRPSLHSVMGVEAPGAIGDLLRGTVAPEEHLLRPGPNDIHAGRNIAFGFND
MTEPYASELLQDPRTRGMLDLIETQMQPDVMLFDLPPALFYDDVIAFRPLFDGVLLVVGGGLTTQKEIKEVERRLGDSTP
LLGMVLNKAEHTEISRYRY
>gnl|bykdb|A0A0W8HFU1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas savastanoi pv. fraxini] (length=696 residues).
MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVAELIKSRALLGKVVDDLKLNTLQTPDFFPV
IGPYLYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVE
GNGVKIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDGVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTY
RSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPV
KPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGMPVYASLPHSRQQERLEKRDQDSKDSRLLSIAAPGEL
AIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDT
LAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNRMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNYHPAPR
>gnl|bykdb|A0A127AL56 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Candidatus Desulfofervidus auxilii] (length=273 residues).
MGKIHDALEKAERERYLINRSLPKSTPKRESGVENIEVQAPTLPKAEKDIIKKKKGYYKDTYALATEQFRILKSKILYVK
NGTPPKTILVTSSVPLEGKTTVAVNLAISIAQGVKEHVLLVDCDFRKPEIHKLFNLSPQRGLSDYLLGQVTIPEILLKTK
TPKLSVLPSGKQVSNPADLLASERMKELIQELKNRYNDRYIIFDSSPLQLTSETMVLLSQVEGVILVVRAGKTNRNLVLN
TIKEIEKERLLGVVLNGVEKSLTNKYYSHYKYY
>gnl|bykdb|A0A142W0R3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingopyxis terrae subsp. terrae NBRC 15098] (length=655 residues).
METDVEGAREKTISNEIAFFNTQYSLLESRSLAARTVRAGNLLNDKDFLAQYDLTGGEEGTPNSAQRARMAERAEKILLD
AVSIEPVRQSSLVDVSFSTPSATLSAKLTNLWVQQFVAANLDRRFSATSDARRFLEQRIGSLRRNLEDSERELITYAANN
DIITLETRSDPGTGRTIGDRTLVAADVEKISTALSVARDARIAAESQLSSSVSSTDLSSNAAVSALRQRRAELMADLARL
RKIFGEEYPEIVAKKEQLAALNQSVSTETQRSRALNQESYASALKREKELQAELDRLTGKYRDQQRRSIEYAILQREVDT
NRQLYDGLLQRYKEIGAAGVGTNNIAVVDTATPSPGPSSPKLILNVALALIAGFGLAGALVFLLEQLDQSIRDPSEVSDR
FGLPLLGSIPKVDADTFEELLLDKKSMIYEAYFAAQTNLTFLTNHGAPRSFMLTSTRPAEGKSSSALSLASVFGQTGKKV
MLIDADIRSPSLNELLDVDNRNGLSNYLTGFDKVSELIASSPEFGFDYILAGPMPPNAAELFSSSRLSELVELLLRDYDH
VILDAPPVLGLADAPLLARPVEGVIFTIDASSSSARAIKSALNRLRQTDAQIFGALVTKVGRRNEIYGYGYGYGYGYGYG
YGYGYGADKSRGNSE
>gnl|bykdb|A0A154VE85 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Oceanibaculum pacificum] (length=763 residues).
MSALAPLQPNPAARAGMAPSPADAPMPLRRGLSRNKPLFAISFLALAGLGLAIVAGLPERYRATAQLVFQDRSSGFGGSA
LLLDRGAIETEAAIVASRDLALRAVESLRLIDDPAFNPALQPSASFAFGAWLRDHVLAPLGVAPSSGSGRASQGSAVIAP
PPAVLAERAVDAYLDRLSVSPADNARIVAVDFTAADPDLAAAAANRTAGLYVEDRVAQRAAAARRADEWLGGRLERLREE
AAAAQQRLDAYRRETGMLEIGGGSIYRDQLTQVNAQLVAARGSRTEAEARAAQARRLIGQGSNTGTNTGGGLETAAAVLN
ADLVRELRLQEAALQRRIAELRVEYRDDHPRLQEALSESEGLRRTIAGEVEKIGIGLANEVEVARARERALQQEVDRLQV
LVDDRNDALLSLRALEGDLRSRTQLYEVMLARFNEAKLQDERLVGPEARVISAAVPPAEPLFPGKAVLAVLAVLVAAVLA
AGIAMLRERLRKGYGSVRQVERSTGLPVLGALPALSRASLRGMQPHELALDDPAAAYAEAVRGLRTGLLLAAAGDRPVRT
LLVTSSIAGEGKTATAVSLAALAAKAGRKVLLIDADLRDPGIGPALYFPHERGLATYLAGAASAEAVTEFHLACGIYFIP
AGPAGDDPSALLSAPAMQTLLQQKAGEFDLVVIDSPPVLPVSDALILSRLVDATLYVVAAESVRRDAVRAGLQALRQAGA
AVAGTVLTRLDPRRQPPEDAARYAYAAPASGQTAIEERRRIAG
>gnl|bykdb|A0A160UA87 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Bradyrhizobium sp] (length=269 residues).
MDSIKQAVELARSGDRLAHQEFIGGSKPIATGQEPASASEVRLDVDHLEANRIVAFATGSESVRYYDMLRTQVLQEMDKK
NWQFLAITSPTAGCGKTVTACNLAMSIARLPERSAVVVDLDLRKPMVANYLGLPPSGGVLSVLDGQVPISSAVIKAGVGP
NSLFLLPGSVPTSGSSEWMSSQTMTTLLQAIKREFRSHTVIFDLPPMLLGDDVISILPRMDAVLLVTGVGSSSVADVKEC
QKHLERVPVLRVVVNKVSEDVDTYYGSYY
>gnl|bykdb|A0A166Y9U5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Erythrobacter sp. HI0037] (length=607 residues).
MFDSDEDGPAFQLENGRFPADGRVARAREAGELLLENVGIEPTRLSRLVDISFSSPDAEFSARVANAWAEQFIKMNLERK
IQATSYGRDVLQRQLAEYKTRLNESQRQLVGYASNQEIINLPAAGAADGSSTQERSIVADDLATLNAALNEAKADRIAAE
ARFQQAGNGGSSLEALRNDTINRLRQRRAELAAEYKQLMVRFEPGYPQAQAIESQIEELDRAIAGEEARVSNSVRNEYRQ
ALAREQALENRVNSLKGDFLDLRRRSIQYNIYQQEVDTNRALYDGLLQRFKEIGVAAGVGVNNISIVDTANAPEKPSSPK
LLINLVVSILAGLGLGVALAIGLEQMDDAITDPSEVPRRVGLPLLGSIPKVDDKSTPREVLLDRKSDLVDAYLAVQTNLG
FTTEHGIPRSFSVTSTKPAEGKSTTSLALATMLARTGKRVILIDGDMRSPSVHHLGNVANVRGVSNFLAGNDDLSGAIFE
IEDLGIAALSAGPIPPNAAELLTGARLKVLIEHLHGTYDHIVVDSPPVMGLADAPLIASHVEGVIYAVESHGIKSSQVKT
ALNRLAAANAHILGAVLTKFEARRSHYGYGYEYGYGYGREEQAQASS
>gnl|bykdb|A0A167HVD6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Hydrogenophaga crassostreae] (length=280 residues).
MERIKLAIKKAKDGEADSKKSDSRLLRGGRAPDPSTAGRKAESGDLGSLQYVQTAVVSLEPEHLDRHRIIAHQKAHPSSW
AFDVLRTQVLQKMDENGWRTLAITSPSVESGKTVVAINLAMSIAQQTNRTALLVDFDLRRPSVARYLGLKRPLSLNDYLD
GQVGIAEAMVNPGVERLVVLPTNSPVFGASEVLSSDKVGNLISELRERYSDRIVIFDLPPVLAADDVMTVLPRIDCVLMV
VASGVSTQNEVEEAMNRLSKADLLGVVLNKDEAPTQNAYY
>gnl|bykdb|A0A167IR75 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Erythrobacter sp. HI0063] (length=594 residues).
MTNERYSAEGRAERQREAADILLTNVTINPTRLSRLVDISMTSPDPAFSAEVANSWAENFITTNLERKVQATSYGRDALQ
RQLTEYKERLDESQRQLVAYASDQEIVNLPSEGGNDGTNTQERPIVVDNLASLNAALNEATADRIAAEARFRRAGGGGSS
AEALSNNAINNLRQRRAELNAEYQDLMIRFEPGYPQARAIQSQIEALDQAIAREESRVSGSVRAEYQQAEAREQALRQRV
NALTDEYLDVRRRSIQYNIYQQEVDTNRALYDGLLQRFQELGVAAGVGVNNIAIVDTANVPERPSSPRLLINLLVSLLAG
IGIGAALALALEQLDEAIADPSEVQRRLGLPLLGTVPKVDEEETPRDALLDRKSEMVDAYIAVQTNLAFTTEHGVPRSFS
VTSTRPAEGKSTTSLALATMLARSGKRVILLDGDMRSPSVHHLGNVSHDRGVSNFLAGDEDFTGSIFRMDDLGIDAMSAG
PIPPNAAELLTGDRMRGLIDRLHEKYDHVIVDSPPVMGLADAPLIAGHVEGVIYAVESHGIRSTQVKTALGRLQAAHTRV
FGAVLTKFEARKAHYGYGYEYGYGYGRDTDTKAA
>gnl|bykdb|A0A168QTU8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella oxytoca] (length=456 residues).
MPKISADLDQAEARLNAYRAQRDSVDLSLEAKSVLDQVVNVENQLNELTFREAEISQLFKKSHPTYRALHEKRQTLERER
ERLNNRVSAMPSTQQEILRLSRDVESGRTIYLQLLTRQQELNISRSSAVGNVRIIDEAVTLPDPIKPRKALIIVLGALFG
LMLSMGTVLVRQAFKRGITLSEQLEAQGMPVLATLPRSQWLWSKTQLRRKNPFSRRWKHKTSDVPFLPVDRPADMFVEAV
RGLRTSLHFTMMEAENRIVMISGPTQDCGKTLVATNLAAIAGQSGQRVLFIDADMRQGYVHNIFGLENRHGLSCLLEGKR
DLAEVIQHAEKGGIDVITCGPEPLRPLELLLSERFLSVMSWVNEQYDIVIIDTPPVLAVTDAALVARAAGTTLMVARFDK
TSVKEMENTVKRLQHVGVKVSGTILNDIIKSAALYYSSGYSQYEYGYASRKKGERR
>gnl|bykdb|A0A176S762 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Candidatus Thiomargarita nelsonii] (length=235 residues).
MFLKEPKSAFAESVRTARTGIMLSNLDIKHKVLIVTSSIPNEGKTTFAINQAFALGQMAKTLLIDADMRRPSIAKSLGLN
DDAPGLSDLVTGERGLDECIDDHLSKDGRNVDIIPSGVVPPNPLDLLSSSRFGELLEQLSQDYEYIVIDSAPTIAVSDAL
VLAKYASGVLYVIKANATPYQLVREGLKRLRQVKAPVHHIVLNQLDIHKPSKYYGYGYGYGKNYYGYYKSYYGEK
>gnl|bykdb|A0A1A7QC21 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Erythrobacter sp. QSSC1-22B] (length=258 residues).
MQDADTAFIGSDQLDIRRLQVVQPRKGAVEANKIVGFNSRDKRSRPFNLMRTQLAKQFIEEKVRLVGITSATPAAGKSFL
SANLAASLSRILQVSTFLVDLDLRRGCVAKELGIDFQSGISDYLLGDQQNLREVGLSIEGTSLAVFPTRAVSMDSAQAIA
GGTYDSLVRTMRDETAGAVIIFDLPPVFANDDAVLSTRLLDGYIMVVDSGKTTRRQLTDAMEMLAPVPCLGTVLNRYAGG
ILDSYGYGSANYDRYYSE
>gnl|bykdb|A0A1A7QJ97 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Erythrobacter sp. QSSC1-22B] (length=589 residues).
MNNGRFPAQGRAQRQRVAGEVLLDHVSIEPTRLSRLVDIRFTSPDPAFSASVANAWAENFIESNLERKLQSTSYGRDALQ
RQLTDYKQRLDESQRQLVTYASNQEIINLPATSEGAQERPIVADNLAALNSALSEAIADRIAAESRFRQAGSAGSTAAAL
GNTAINNLRQRRAELAADYQQLMVRFEPGYPAAQAIQQQIDALDSAITREESRVSGSVQAEYRQAVQRESALEMRVNSLK
DEYLDLRRRSIQYNIFEQEVDTNQALYDGLLQRFEEIGIAGGVGVNNIAIVDLADVPQIPSSPRLVLNLLIALLGGMLLG
VAIALGLEQLDESIGDPTELQRRLGLPLLGSVPKVADETPMEALLDRKSELVDAYLAVQTNLGFTTEHGIPRAFSVTSTR
PGEGKSTTALALATILSRQGRKVILIDGDMRSPSVHQLAGVDHDRGLSNFLTGEDALESLIFKMEDLGVDAMTAGPIPPN
AAELLTGNRLSLLVDRLLVTYDHVVVDSPPVLGLADAPLIGSQLDGVIYAVESHGIRSTQVKTALGRLVSARVKVFGGIV
TKFDARKAHFGYDYDYGYGYGRDAKTESA
>gnl|bykdb|A0A1A9KEF8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas citronellolis] (length=265 residues).
MDRNTPAHDDSQQQSPPAPSHAVSPAVRPDVPGQFDYVQTRVVPLRAEHLERNRIVAYNKNSNMSWTFDLLRTQVLQAME
ENGWRTLAITSPTPEAGKTVLAINLAMSIAHHTTKTALLVDFDLRRPRVGACLDLPMEKSLNELLAGEARLEDVLVNPTL
PRFVVLPTREPIPLSTEVLSSPQVSELIGDLRERYDSRIIIFDLPPLLSSDDAITVLPKFDCVLLVVANGMNSKKEIEDS
LYHLANANLIGAVLNKAELQTRTYY
>gnl|bykdb|A0A1B1PNL6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Yangia sp. CCB-MM3] (length=373 residues).
MVERRRFRRRKRSEETPEDPPILPLERREERLARRRADRDAEEARAAAQVRVRRQAEEAEREQAERERAAQEQAEREQAE
MEAARRELASLRPTAPAASAEQLAPAQTVPPAAEAPARPPRRAVTRRPAPQATLLWDQLPVFEIDSDHLERNRIITANRE
DPAHAAFDVLRTRLTQALAENGWTRVGITSPSKGCGKTFTAANLAISLSRQEGLRAMLMDLDLRNPSLHKAMGVRAPGCM
GALLRGAISPEAHLMRMGENHIHAGHDIAFGFNEVIEPYAAELLNAPATAEVLTSIEARLQPDVMLFDLPPALYYDDVLA
FRPQIDGVLLVVGGGITTEREIREVERRLGTSTPLLGMVLNKAEGTELKKYQY
>gnl|bykdb|A0A1B1UCM8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Bradyrhizobium icense] (length=271 residues).
MDSIKQAVELARAAEVVHRPGVLSGSALAANGPLQRSAESPINEVRLRADHLEANRIVAYGTSGPNGRYYDMLRTQVLQE
MDKKSWQFLAVTSPTAGCGKTVTACNLALSISRLPERSVLLVDLDLRRPAVGNYLGIDGNGGVLDVLEGRTPLSSAVLQA
SIGPNNMLVLPGSVSSNSSEWMASQTMGALLQTIKRDFRSRIVIFDLPPMLLGDDVISILPRMDAALLVAGVGSTTVSDI
KECQRHLRRTTVVRVVVNKSTEAAGSYYGYY
>gnl|bykdb|A0A1B2EQN1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Microvirga ossetica] (length=264 residues).
MEQIHDVLLNSENETSVTFAESRASSFPPDENLTWMRLRQMKVDESRAADERIVTITRTNPAHFPFDILRTKMLRIMREN
KWTSVAITSPTVGCGKTVVGLNLAFSFASLLDCRTVLVDLDLRQPKVADVLGMGQLSSIEDFLVRDAPIECVFARFGENL
AIGANRGYIAHAAELLHGPGIRRRMTEMKEQLRPDLILFDLPPMLATDDVLAFLPNVDCAILVAAAEVSTISEIDVCEHT
LREETNLLGVVLNKCRFDPRKYGY
>gnl|bykdb|A0A1B9Z0F1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Bradyrhizobium paxllaeri] (length=271 residues).
MDSIKQAVELARAAEAVSRPGALSGSALAAEGPLQRSAESPFNEVRLRADHLEANRIVAHGTSGQNGRYYDMLRTQVLQE
MDKKSWQFLAVTSPTAGCGKTVTACNLALSISRLPERSVLLVDLDLRRPAVGNYLGIGGHGGVLEVLEGRAPLSSSVVQA
SVGPNNILVLPGGVSSNSSEWMASQTMGAMLQTIKRDFRSRIVIFDLPPMLLGDDVISILPRIDAALLVAGIGNTTVSDI
KECQRHLQRTPVIRVVVNKSTETVGSYYGYY
>gnl|bykdb|A0A1C2JGD0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acidithiobacillus thiooxidans] (length=342 residues).
MFLLEKQKEAAISRASTITKNRILDTALVHSVPVSPKASKAVLIGAFLGLLLGLAVVFARFLLHKGFHSDEGILSRYPSI
PLFGKLPEYEAFQSVGDSAKIKPIVPSDPRSTYGEALRLLRGKLYLDSGAGNAGKVLMFSSAFQGDGKTTVVSQLAVALA
KDGKRALLIDADLRHPQLHSAFDCKQSPGLAEYLAGNAKLEDCTRVMTRFDVPLTCLPSGQTPDSPVELIGKERFAELID
KARSEYDYVLIDTPPFPVLSDGLIIARLVDRLVSVIRVGETPRSAFKEHMQGVAEIGCPQALLINGAPTSQGGVYHYHPR
SSVRLDLENRVRSFISQFQRKR
>gnl|bykdb|A0A1D2RNR5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acidovorax sp. SCN 68-22] (length=410 residues).
MDELKARINAEVQSVLASVRNQALMAKRQENLIRTRLQQTRAEIMAAQDRSVDFNLLKREVDTNRELYNGLLQQVKEVGV
AGGVETNNIQVVDKAEVPLFPYKPRLALNAAIGLLAGIVLGLGIVFLMESMDDSIKFADEVEKLLQVPLLGVIPKVKEKT
TNLASLALLVHEDPRGQMAEAYRSVRTALQFSTADGAPRRLVLTSTTKNEGKSTTALALAINFAQMGAKVVLIDADMRNP
SVHKYLNLPNTAGLSNYLSGHGKPGEITRMSAIDNLMIITAGPIPPSPVDLLTGPRLGELMDLLEVRGAQYIIFDGPPVL
GLADAIVLGNQVHSVLFVAQASQTRKSHIKDAFRRLRMAGVVPCGVVLTKTTAQNTAYYTYDNYYGYGVDTPPKPGPSAG
DRTEPSLTTA
>gnl|bykdb|A0A1D2S760 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Comamonas sp. SCN 65-56] (length=285 residues).
MERIKQALEKARQQSAGAAPHPAHPSAPALTAPAAAAQQADALASGAIEVNYTQTEIVRLDRATLERNRIVAFEKTNPDN
WVYDVLRTQVLQKMDEKGWRTLAITSPTVGSGKTVTAINLAISIAHHTQRTAMLVDFDLRRPRVGTYLGVRKTPSLSEVL
TGKAQLADAMVNPDLPRLVVLPTSRPVPHAAEVLSSVVVRSMVADLRERYADRIVIFDLPPVMAGDDVMALLPSVDAVLL
VVGNGDSTRKEIEESMRHLPPEQLLGVVLNKAEAEVRRGYGYGYY
>gnl|bykdb|A0A1D3JZN6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas veronii 1YdBTEX2] (length=479 residues).
MRTLNEISSLYVRQNVDRTSAEAAQSLAFLNDQLPQVRRDLEKAESALNSFQTRSKSIDISLEAKAVLDQVVALDTGISE
LKLQQAEMDRKFTRQHPAYRALLAKLDELTGKQAQLTKRIEGLPSTQQELLSLTRDVQVGTEIYTQLLNRSQELDVMRAG
TVGNVRLIDSADANISKPVEPRKVIVVLLAMLLGGMLSVGLVLMRSLLSRGLENPDDIEKLGLPVYASIPFSSLQKTEEI
RAFKGRSAVPSLLALNHPNDLVMEAMRSLRTSLHFAMLEAKDNRLMICGPSPGVGKTFVSANLAAVVAQSGQRVLLIDAD
MRKGYMHKMLGTTAEIGLSDLLVKRCQLQEATQKTDVELFDFIGRGQIPPNPSELLMHPNFAALLAEVSELYDLVIIDTP
PLLAVTDAAIVGRQSGTSLLVTRFGINSAKEVELTLRRFNQNGIELKGAIFNGVEKRRSASYGYGDYGYYHYAYQSDKA
>gnl|bykdb|A0A1E2UHX3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Candidatus Thiodiazotropha endoloripes] (length=275 residues).
MEKIKKALERAREKRSSELIDSSDQYHSHMRINPMEKVDLTKISYTKTKKIEVSKELLRKKRVFSGNENSNISSQYKVLR
THVLQCLKSNNWNSIAITSPNEGCGKTLTAINLAISMAREVNHSVLLVDMDLRRPSVQDYFVDERLPGISEYLQNEKDLN
EILFNPGLDRMVVLPGNKSIENSSEMLSSPKMVDLVTELKKRYPNRIVIFDLPPLLSCDDVIAFSPYIDALMLVVSEGET
LKKDLVRSYELLSTRNIIGTVLNKSNEECSNSSYY
>gnl|bykdb|A0A1E2URD3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Candidatus Thiodiazotropha endoloripes] (length=272 residues).
MEKIKDALDKAKKIQSSSRNIKGQNIISSDNRNYLDLENINYTKTKKVKVSEELLRNKRILIGDVKDEISDEYKVLRTQV
IQLMNKNNWSTLAISGPKEGCGKTLTSINLCISIARDVNQSVLLVDLDLRRPNIHNYFFTQEVLGISDYLVNKKNLDEIL
FNPGIERLVVLPGNKSIQNSSEMLSSPQVVQLVNELKNKYSNRLVIFDMPPLLSCDDMLAFTPYVDAFMLVVEDGVTLKQ
DLKRSVELLDTNKLLGIVLNKSKDSVGINQYY
>gnl|bykdb|A0A1E2ZGQ8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Candidatus Thiodiazotropha endolucinida] (length=272 residues).
MEKIKQALERARDLRTSMKRSDNSHIASQQTAEPEFPTKITYTKTKSVEISKDLLRAKRVIVGDTNDLISDQYKVLRTHV
LQRLKANQWNSLAITSPNEECGKTITAINLAISLAREVNHTVLLVDLDLRRPSIQQYFFQDEQPGISDYLTDGMELSEIM
FNPGVERLVILPGSKPFSNSSEMLSSPKMVKLVEEIKHRYPNRIVLFDMPPLLSCDDVIAFLPYVDTAMIIVAEGGTRKV
DLKRANELLSNIEIIGTVLNKSKDNNAGYSYY
>gnl|bykdb|A0A1E3DAN4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Ruegeria sp. PBVC088] (length=265 residues).
MVPVTEQPASAPASAQAPQEPDQVDSAWAGLAEMTVDKGHLDRNRIITASRDDPAHAAFDVLRTRLLQALHENGWRRVAI
TSPGKECGKTFTAANLAISLSRQENCRTLLLDLDMRRPSLHRILGVSDPGSLGDMLRGMTAPGDHLLRMGRNPVNAGRNI
AFGLNGRPEAYASELLQDPRAESCLQRIEDEFDPDVVLIDLPPALSYDDVIAARPLFDGVLLVIGGGMTTEKEIAEVERR
LGDGTPILGMILNKAEGTELDRYSY
>gnl|bykdb|A0A1E4JHX8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. SCN 67-18] (length=589 residues).
MRNTPAGREKRSREAARILLENIDIVPDRLSRLVTITFTSPDPKLSARVANAWTANFIESNLERRFEATSYARKFLEERL
RQWRERLEESERVLVAYASDEKIINLPAAGATRDGPTVERSIVADDLASLNAELSAAKGEMVRAHSRVTEVGANGAVEEA
LTNNAITGIRQKRAEVAAEYARLLSQFEPEYPEVKALATQLSQLDRSIASEENRIRTSLQQSYQASVARVGDLEGRVSNL
KSSFLDLRRRSIQYNIYQREADTNRQLYDALLQRYKEIGVAGGVGTNNVSVVDVARIPERPSRPSLILNMLVALILGAGI
GAALAFALEHIDEAISDPQEIADLLGLPVLGIVPKAATESPIEALGDRKSPMVEAYLSVQTNLAFSTNHGVPKTLSVTST
RPAEGKSTTAYAIAHALARSKQKVVLIDADMRSPSVHHLFSIGNERGLSNYLAGSEQLDELISSSSLAGLSIITAGPQPP
NAAELLTGQRLEQLLTALLTRFDHVVVDSPPVMGLADAPLIASRVEGVVFAVESHGIKASMVRVALGRLAAANAHVLGTV
LTKFESKRSYFGYGYDYGYGYGQTSKAES
>gnl|bykdb|A0A1E4UZA0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas sp. 21C1] (length=270 residues).
MERIKQAIEKAKKQASSGFIAKPQASSAVAQPLAELGALNYVQTKVISLRAELLERNRIVAYNKNSNMSWSFDLLRTQVL
KIMEENGWRTLAITSPTPEAGKTVVAINLAMSIAHHTTKTALLVDFDLRRPKVGAYLGLPMEQSLNDLLSGEAELQDVLV
NPSLPRFVVLPTRKSVSHSTEVLSSVAVGNLITDLRERYDSRIVIFDLPPLLSCDDAIAVLPKIDCVLLVVANGMNSKKE
IEDCLHHLPAANLIGTVLNKIEIEPRTYSY
>gnl|bykdb|A0A1E5AJN5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhodobacteraceae bacterium] (length=743 residues).
MADQQHSHSSNPGPVFLPGEASGTGNFVPSLGGSLLTDPVRLFMTAVSYSWLIIACAISGLVMGSVYASLQTKQYRASLQ
INIDVGRASALREFEVVGESRSFFVTAESTIAASIRTRRLARRVVYELNLTEKPNFYIQPVRFSLVGILKRAITGRAEQP
FIPRTYDERERAAINRVLAGMQITTLRRSPIVRIAFVHNERSYPHVVVNQIARSFIELSVDQKAESANKIRLLLQGQADL
VKQQLTSAERELNDYAKSISFTDLEEQPAILASRLSAVNDALNAAVQDRLELGLIVQQITEGKAPSLSAVLESQAIEGLK
QRLATLRADYQDKLSIYKPDFPEMVRLAGQIEDTQNQLAKEISIISDSFVLRLAQAQQREETLRQELALVTASSREYREK
SVEFIILRREVDSKRSQFEALIEKLNNIGVGAELRSENVAVLDYAVRTPDFFSPRRSRIVVAAMAVMIMLSIVIIFILEL
INNRFSNPDQIESELELPLLGIVPFSDAGDDLHALDELDPALEEAYSSLRSAIQFSAIGGNLPSLSVTSSEPSEGKSITS
YKIAEGFAKLGKRVILIDADLRRPKLHKWFGVANTLGLSTILADEVTPEDEADLYIESGQKNLVFMRAGNIPPNPTDLLG
SNNMARLVHRLTKEFDLVIIDGPPVMGLADAPILARHTAATLYVVAANQATRPSVRHAINRLRASNVNLIGTVLTKFRLR
RFDYNYAYSYARSDYYTYNPTET
>gnl|bykdb|A0A1E7H876 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobulbaceae bacterium S3730MH12] (length=262 residues).
MSGQPAAEPVRKKTIKHQTLSSSEAWDERLLKVTHSSSEAAESFRILRSRILYPQDGRQRPQSILVTSSAPQEGKSFVSA
NLAVTIARGLDQHALLVDCDLRRPSLARLFGLASICRRGLSDYLREDCDISELIHKTSIEKLSLLSSGDSPVNPAELLSS
SRMSRLVTELSSRYKDRFIIFDTPPYQVASETNVLAKEVEGVVLVVGYGKSDKSHIKTMVDLIGPEKILGVVFNGMKNSY
IQKKVFSSYGYSGGYYGEDETD
>gnl|bykdb|A0A1E7HFN0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobacterales bacterium C00003104] (length=271 residues).
MSMIKKALQRARKDRHEEGHRIPVEQAASEMPGLAEKVRGDTRTKAISLDHSHIEKHRIVMPSGDPKILDCYNLLRTQVL
QRTRDKGYRTIMVTSAVAGEGKTVTAVNLAVSIARDVQHTVLLVDTDLRNPQIHHYLGCNATRGLSDYILDDVPLAELLV
NPGIGKMVVLPAGKSLPGSTEILGSPAIKNLVLEMKNRYPDRYVIFDSPPLLGLPDSLVFSSYIDGIILVVEAGSTPKDQ
IRKAIQLLEGKTILGLVMNKSPEAEQDYYYY
>gnl|bykdb|A0A1E7HSL6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobacterales bacterium S5133MH16] (length=270 residues).
MGKISSAIEKSNRENWSTSINKKSETDPPPPNITTFKEFGLLRKNRNIDKGLIALLKPDSFEAEQFRKLGTTLLYAGSET
KPRCFLVTSVASGEGKTFVAANLAISIAQNLEENVLLIDCDLRAPSVHARFGMHGVNGISEHFLKGIDILPLIQKTPVKN
LTVLPAGGTSLESAKLLSSQRMSKALDLLKAGQENQFIFIDAPPPLLTAETAALAKYVDGIILVIQYGSTPRDMVAELIK
YIGKEKIAGIVLNRYKMKRAGYYKYGYGSA
>gnl|bykdb|A0A1E7IQC3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfuromonadales bacterium C00003093] (length=278 residues).
MSRIQDALNKAASRRKSPVESAAEINHAAAQKNELVSESQLPEKQFSNLLDVPPIKVDNLMLATARDEKTEVVEEYNKLR
SAVIALTKGDKFSNTLMVTSTVSEEGKSMTALNLAISLAKEHDHTVLLVDTDLRRPSVHKFLDIKPEVGLVHCLRDNLPI
EKALIKTGIGKLVVLPAGEAVNDPVDMLSSNRMKEIIRELRERYADRYVIFDTPPALPFADAGVLAANMDATLFVVREGK
ARREDIVKTLDNFKGHNLLGVIYNDAHAFMKKQDYYYY
>gnl|bykdb|A0A1E7JCL5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobacterales bacterium S5133MH4] (length=271 residues).
MGKFFEALRKSETTKRQTSARLLPKNVVNISPQTIEKSPLPQSAMDPRLVSFMDPDSPAVECFKMLRATIFTINPGFRPR
TIMVTSAQPMEGKTIVAANLAISIAHGINEHVLLVDCDLRRPSMNTLLGLNAGKGIHEYMEDGTSVAPYLMKTPIKKLSL
LPAGKPPSNPSELLSSEKMRRLVEELRGRYEDRYIIFDSAPAQCASEAAFLASMVDTVLLVVRSGKSAKDLILKAIEKIG
RKKILGVVFNASNESAKDYNYYYRYYRKEQK
>gnl|bykdb|A0A1E7JEV6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobacterales bacterium S5133MH4] (length=270 residues).
MYLRKSVEKVKKMPNIAKQSNLSENLPEREEAGWTKVANREIKCVDLEEKKAVENHCVCILPDAEELDFYKILRAQIQHR
CKKNGWNTIMITSALPGEGKTLTSVNLALTFAKELTHPVLLVDCDLRRQNIHQYLGFSSDKGVIDNLADDFPLDDLIIWP
GIEKLHVISGGRTVHDSTEMLSSHKMKAAIVEMKKRYKDRYVFFDAPPILSAADAIAFSPLVDCILIVVQAASTSIRDVK
KAVEMIPKDKFLGFVLNRQRSPIKGYYKYH
>gnl|bykdb|A0A1F2YJ88 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter sp. RIFCSPHIGHO2_12_41_5] (length=552 residues).
VILTGKTNQANTLRTADGLWNISIYTQDQLNDVYLIQKQSLPSAVNNILANYSVAEKGKLTGILGLNYQGTDKTHITQVL
NAILVSYSQQNIERRSAETAQTLKFLDEQLPELKQQLDVAEREFNKFRQQYNTVDVTKESELFLTQSVTLETQKAQLEQQ
VAEAGAKYTAEHPVMQQMNAQLGAINKKIGELNSTLKELPDLQRRYLQLYREVEVKQQLYTALLNSYQQLRIAKAGEIGN
VRIVDTAIEPVEPIKPKKLQVLILSLFLGGFLGTLLALLRNMMRSGIKDSTQIENELDLPVYATVPRSPVQESRINILKK
KKNIPILAVKNSDDIAIESLRSMRTAIHFALSSARNNLITISGPAPEVGKSFISTNLATILAQSDKRVLIIDADLRRGYL
HKYFNLDTQPGLTELLNGQQSLDTVIRPTEVPGLSVISRGKSPANPSELLSSNQFKNLLEQMSEKFDHVIIDTPPVLAVT
DGIIISQYTGVNLVIARYAKTQMKELELTLNRFEQAGVKVNGFILNDIQRSSAGYGYGYNYAYAYKANKESD
>gnl|bykdb|A0A1F8XMK2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Deltaproteobacteria bacterium GWA2_55_10] (length=269 residues).
MSRIEEAIEKALRMRESGAAVKERAPLDPKHSPVVPEYDDSNTLEIQCDNPYIVSLNQPNTPVAEEYRKLKSAVVGLTSR
DSFLNTIMVTSTISGEGKSITALNLAITLSKDYDYTVLLVDTDLRKPTLHKYLNLEPRAGISECLMEERDLQDVLVKTNI
GKLSFLPAGRRVDNPVELLSSQRMKDFLAGIKERYPDRYIIIDTPPILPFAETRAMSALVDGVIFVIKERAAALKEVQEA
LGLFNGNMLGVVYNGVSPEQLKSNHYYGY
>gnl|bykdb|A0A1F9BJF7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Deltaproteobacteria bacterium RBG_13_58_19] (length=305 residues).
MSFIDKALEKAKALHKKEDKRVISSRPEKVPADTPSVQAAIPTEREVIPPEISYTVTRTVAVDPEVMRRNRLMVGGGEVE
PAVAEGYKLLRTHILQRTKAEGRNTLIITGPQQGEGKTLTAINLAISISQEMDLTVLLVDADLRSPSIHRYFGIRTGEGL
VDHLTAGVPISELLIHPEGFDKLVILPGGRPSRQAAELINSPLMADLVQELKHYYPNRYVLFDLPPLLTFADALAFAPSV
DGVVVVVEAGKTSREDIERCQEMLKQFNLLGFVLNKLEILQQGYYYYPPRNERALTKKPRLSLFK
>gnl|bykdb|A0A1F9CFF0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Deltaproteobacteria bacterium RBG_16_64_85] (length=241 residues).
MKIPFLKHFELPSEKPNRGSLFRSTDLIFNEQFKNFSARFEYNVDLRGLKAVAVTSSIAGEGKTVSTVNLAMNLASTGRK
KVLLVDFDLRKSDLARELRITPLPGMVEYLGGSVSLGDTVRDGLAKGLHVIPSGTQVDATWDLITGDKFRAFLKEIRDAY
DVILLDTPPIIPVSDTLALREVVDGFILVYRLGYTPHTLFRRAMEDIGVPKLLGVLLNGEEPESGRYYQRYYGKYYKKPE
V
>gnl|bykdb|A0A1F9E324 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11] (length=431 residues).
MKLSENYKSEYPEMKRLRNQMETIQKRLTLEGNRIIAGIRSEYESGLRKESLLRAAFEEQKGKAVEMKQKAIQYNILKRE
SDTNKELYRGLLQRMKEAGVSAGITASNIQVVDQAEPPTRPYRPNKRLNLLLAAVVGLFLGVGLAFFFEYLDNTVKTADD
VEELVHLPSFGMVPAVSYERRKQRQTANSFPVELITYGHPKSMLSEAYRNIRTSILLSFSEKPPKAVVISSPNPSEGKTT
TVINTAIALSQTGAQVLVVDADMRKPRIHRIFTNENGAGLSNFLSGNVHLEAIIKKSIIPNLSFIPSGPIPPNPSELLGS
SLFKNMIQSLCERFDHLIIDSPPVLGFADSTILSAAVDGTIIVVLGGKTPRETLQQAKEILLQVNARIIGVVINRVDIRR
SDYGASYYRYYYGHEKRQKKELPGATEKDPL
>gnl|bykdb|A0A1F9EUS2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Deltaproteobacteria bacterium RBG_19FT_COMBO_46_12] (length=285 residues).
MSRIYRALEKAEEEKRQKVREEPSVQIFEEKAVLKKEEPTLIFPEEKITNIEKIKEFDLPSKEEIPVLIVPPKSIAAEEF
RKLKTQIFHRLPNPPHSILVTSATPGEGKTMVSVNLAIAISQEIQRKAILIDGDLRKPSIRLEKRQNSKGLSNYLSDGVP
LSEILIKSEVENLRIITAGHPTNKPSELIGSKRMGELFKSLNELEDSSYIVVDSSPIVSTTEPALLSKMVDGIILVVIAD
RIPRETIQRAIRSIDRQKIIGVVFNQIDMKPSIYYSKSYYKYYRN
>gnl|bykdb|A0A1F9L9G4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Deltaproteobacteria bacterium RIFOXYC2_FULL_48_10] (length=282 residues).
MGKIFEALEKSKHIRSSDTVENQENPFSGDDQRQMDTIKESTLPMEEADLDLPKNLSASLVTLTKPNSIEAEQFRLLKNN
ILFPEKGTPPRSIMVTSASPGEGKSFVSSNLAVSIAQNIDEHVLLMDCDLRSPRIHSIFNLPQGPGLSEYLSQAKPLSSL
LVKTFIGKLTILPAGAIPKNPSELLSSEQMRRLIHEVRLRYSDRYIIIDTPPPYITSEANALVRQVDGVIMVIRHGKTRK
KDVEDIINIYGREKIIGVVQNFAEKRAGYGYGYYKYGYGYGK
>gnl|bykdb|A0A1F9MR25 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Deltaproteobacteria bacterium RIFOXYD12_FULL_50_9] (length=304 residues).
MGKFFNVLAKAKKNEAIEQEISQSRAAEGREVMPGPSSTEPQDNQAVQNVEEGLESLGIQLKDWDERLVAVNASYSEVAE
NFRRVRTHILHPAEGPQPKSILVTSATPDEGKSFVVANLGIALAQGVEHHALLVDCDLRRPALAAMFGISNDRGVTNHLL
EGTALEHLIVKTAMQKLSIMPSGRLPINPAEIIGSQKMVEMAREVVDRYNDRFVVIDSPPLLAASETAVLAKQVDAVIVV
VKWGKAARQEVLQLVEAIDRQKIIGVVFNAFRMSEFESRVSGHYYSKYGYSKKGYYKKKAGQRK
>gnl|bykdb|A0A1F9N669 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobacula sp. GWF2_41_7] (length=290 residues).
MGKMFEALEKSKNVIADNVGQTKRSLSGDDQIQRSFSEPSVITSDKEKKKSISEIDPNLPQNLDSSLVTLLRPDSIEAEQ
FRLLKNNILFPEKGTPPRSIMITSASPGEGKSFVASNLAVSIAQNIDEHVLLMDCDLRSPKIHSIFKLPQGPGLSEYLSK
AKPLSSLLVKSFINKLTILTAGANPKNPSELLSSEQMRRLIYEVRSRYSDRYVIIDTPPPYITSEANALVRQVEGVIMVI
RHGKTRKKDVEDVINIYGKDKIIGVVQNFAEKRTGYGYGYYKYGYGYGND
>gnl|bykdb|A0A1F9NFD0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobacterales bacterium GWB2_56_26] (length=249 residues).
MESFTEQHRPAKSLSGKWDERLFKAANDDSYLPEVFKTLRSRILHPLDGGKIPKTIMVTSAIPREGKSFVTANLGISLAH
GLDQHSLLVDCDLRKPVLAKMFGLDNSVGLVDYLRDDVKLSKLIANTAVKTLSVLTSGKSPTNPAELLGSARMPALVEEL
SDRYEDRLIIFDSPPLLVAAESSVLAGQVDAIILVVRQSTSGKAQIQKLIDIIGAERILGIVFNAQNLSPFQQKLGMGCG
SYYGGYHHQ
>gnl|bykdb|A0A1F9NI02 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobacterales bacterium GWB2_56_26] (length=291 residues).
MKISEALEKAGYGEDLEKRAEEGPEKEFDHDRIAVSQTRAGQEEEHSANIRSVQKSISGKWDERLFKAVNDSSYVPEIFK
TLRSRILHPLSGEAIPKTILITSAIPREGKSFVAANLGISLAHGLDQHSLLVDCDLRKPAMAKMFGLDNSPGLVDYLRDG
VALSKLIQKTQITALSVLASGIPPENPAELLGSSKMSALVEELSSRYDDRIIIFDSPPMLVAAESSVLAGQVDAMVLVVR
QSTSGKVQIQKLIDIVGTERILGIVFNDQKINLLQKRIIKGYASNHGAYYD
>gnl|bykdb|A0A1F9PFA7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobacterales bacterium RIFOXYA12_FULL_46_15] (length=290 residues).
MGKMFEALEKSKNVIADNVGQTKRSLSGDDQIQRSFSEPSVITSDKEKKKSISEIDPNLPQNLDSSLVTLLRPDSIEAEQ
FRLLKNNILFPEKGTPPRSIMITSASPGEGKSFVASNLAVSIAQNIDEHVLLMDCDLRSPKIHSIFKLPQGPGLSEYLSK
AKPLSSLLVKSFINKLTILTAGANPKNPSELLSSEQMRRLIYEVRSRYSDRYVIIDTPPPYITSEANALVRQVEGVIMVI
RHGKTRKKDVEDVINIYGKDKIIGVVQNFAEKRTGYGYGYYKYGYGYGND
>gnl|bykdb|A0A1G0KSD0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Gammaproteobacteria bacterium RIFOXYD12_FULL_61_37] (length=285 residues).
MERIKEAIERAKRERVSVPPPPQDAKADASRDGGGRAAEDPDSRPKDSSLRSVKYQQTKVVELDMEHLASHRIFAHLKNN
PMTAYIDMLRTQVLQKMDEHGWRTLGVTSPTPGSGKSLIAINLAISIARHTQKTALLVDLDLRRPKVAEYLGLDCRVDSL
VSALKGKVDISEAMVNPSIRHLVVLPTSRPVANPAEALASKRVANLISDLRERYESRIVIFDLAPLVNTDDALSVVPKMD
AVLMVVGNGMSTKREIEESMRHLQSTSLLGVVLNKAETDITPAYY
>gnl|bykdb|A0A1G0LDK7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Geobacteraceae bacterium GWB2_52_12] (length=269 residues).
MSRIEEALEKAEKLRSAMFPVSEEKKSPREHVPPPMPGVALKITNQLLVSAGHLNTPAAEEYRKLKSAIVRLTKGDGFSN
MLMVTSSIGSEGKSITALNLALSLAQEFDHTVLLIDADLRKPSVHTCLGIENKMGLTECLLDGVDVKDAMIRTGIGKLSL
LTAGREVRNPAELFTSQRVREFFLELKNRYHDRYIIIDTPPVLPFAETRSLSAVVDGVVLVVKEGEVSLDKISETMECLR
GTSLLGIVYNEAANYHSDSHQYYRQSYAI
>gnl|bykdb|A0A1G0M8Q7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Geobacteraceae bacterium GWC2_58_44] (length=284 residues).
MSRIEMAMEKAARLREEGKGAQPAAPEQPNQPASNRPVPGAVHTAPPVAARALAPKNPFLVNLLEPHSVAAEEYRKLKSA
LVKLTEGETFKNTIMVSSAVSGEGKSLTALNLALCLAQGLDHTVLLIDADLRRPSLHRYLDLEQGPGLAEVLMDEAEIGE
TLVATGLGKLSVIRAGRQVDNPTELFSSLKMKGLVEELKLRYPDRYVIFDTPPLLPFAESRSLARLVDGVLFVVMERLAS
QAEVKDALDAIKGSALLGVVYNAACVNSADEHYYYYRNKGGANG
>gnl|bykdb|A0A1G0NL95 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Hydrogenophilales bacterium RIFOXYD1_FULL_62_11] (length=516 residues).
MTTVREQGKQSGVLQLSVRADSPQAAALAANAVAGAYLQQNVSRRSREAGLTLAFIARQLPQVRARLETAEDALNRYRLA
SSSADLEIETQGRLTRLLEVDKQITELRQKRDETAQQFAPGHPRMLALAQQEARLQTAARSLNDWVKKLPETQRNILRLS
REVQVNTQLYTSLLDSLQEQRVEQGGSLGTARIVDSSIPPAAPAGPSRNLVLVMGLIVGLFGGAAVALLRESMRQPLSDA
RWLERRLGLPVLGVVPHSSRQLLLSRPGLMSRRAVLAQDDPADQAVESLRALPHMLRLPTPVYPPDPQAESAVPHDPSLP
PQWHNSQTAPQGAVWLICGALAGAGKSFLSANLAVLMARSEVRVLLVDADLRNGSLHRSLGTEGDPGLSDLLAGHPVTPQ
RVANSSLDFLPRGSLHPVPAALFTGGRLAWQMRHWASHYDLVLIDTTPVLEVADALALAPLADACLLVIKPDHTKVEEVE
AAVQRLVQAGGNVRGVVLNDMRPAPGASYGYGYGTR
>gnl|bykdb|A0A1G3JY11 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonadales bacterium GWF1_63_6] (length=219 residues).
MLGAVPVTGDNPQPPEIFAPIASSLLLASAGGLPRSILVTSAQEGEGKSLTLHALALALGLMGKRVLVIDGDMRRPVQHS
LFRLTPARGISEVLTGQASAEETIIDSGVPGVFLLPCGAVPPNPAELLATPALDALLASVRDAYDTVLIDAPPILGLGDT
PLLAARVQASLLVVEWGRNHHGGLRAAVERLRQAGGTLIGAILTKQQGRMMEYDYHRGG
>gnl|bykdb|A0A1G3VVY5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Syntrophus sp. RIFOXYC2_FULL_54_9] (length=327 residues).
MGKMFDALQKAEKERYRESERVSYKGVPKDNVFDRQEAQPEQYQESERATYKDAPKDNIFDKQKVQPSKPAPKDIALDDR
LVSYFDPSSMVAEQFKRLRTYVIKPGTENSPKTILVTSTMEGEGKSMIAINLAITIAVDLNSNALIVDCDLRNPSLSRWF
GFREQRGLSNYLLGEAQLPELLVKTSVDKLTILPGGTVRDNPVELIGSKKMKSLVADLKMRYDDRYIILDSSPLLATTEP
RVLSDMADGILFVIKSADTPRESVQQALKLIDKKCIIGVVLNQVEFKTEALIRRYFGTDRYSDYRYSAKQSEPSSSRQSA
SRTRIRK
>gnl|bykdb|A0A1G5C236 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfoluna spongiiphila] (length=289 residues).
MGHFSKALEKRDSERGDKPVVSTPDKVKNEVPADGSRADDHRAAEQKPGAAGHPLVVLSDPWSYSSEQFRSIKTTIMFPE
DGKKRRLILVTSSVPAEGKSFVATNVAAAIAGSLDNQVMVIDSDLRRPTVADIFALPPDAKGLEAYLNNQCPLDDVVYPT
HMEKLSVIPAGKAVENPSELISSSTMVQLLDDVRDRYSDRYVIIDSPPPLFAPETIALSRHVDGIVIVIRNDKTSKRVVA
DMLDKVDRTKVIGIVLNRYDVPFARDRGYKEYYAYRKGAGNGSRDPGKK
>gnl|bykdb|A0A1G6EKK9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfonatronum thiosulfatophilum] (length=287 residues).
MSRIEQALEKAAKMRLGVTENQVGYVSAARLKPTPPQTSPEIFTPPEGSLKINNPTLVAATNPQSPMAEEYRKLKEMVIK
LTRNDLTKNTLMVTSSMVGEGKTTTALNLAISLAQEYDHTVLLIDADLRRPCIMQYLGLDTKPGLTDCLLEKAQVSDVLV
KTGIGKLTVLPSGRKAPNPGELFSSRKMRELVREMKHRYAERYIIIDTPPVLPFAETRSLSGIVDGVIMVVKSGLSTLEN
IRDAQYAMSGAHILGLVYNHAKPESLSSSYSYYYKNDYVEYGEALSR
>gnl|bykdb|A0A1G7CFZ2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Salipiger thiooxidans] (length=388 residues).
MTMTERRRFRRRNRPLDDLPDEDISPVEPLATRAERLARRETKTSAAQATRRAEAERVAEAARLQQQVEKEARRQREAER
RRTEARQAEAAARMAQTTRQTGAEHRVETGRVSTEPARPEARRGQTAPRPAAPAVATRTAQSPAPLQQRGWDDLAEFSVD
ARHLERNRIVTAARQDPAHAAFDILRTKLLQGLADHGWKRVAITSPTKDCGKTFTAANLAISLSRHQNCRTLLLDCDLRR
PTLHKIMGFRDPGSMGDMLRGLLPPERHLVRMGENAIHAGHNIAFGFNGAVEPYASELLQTPRTAETLRQVETMLQPDVV
LFDLPPALYFDDVMAFRPLFDGVLLVIGGGLTTDKEVREVERLLGKNTPLLGMVLNKAEGTSLDKYTY
>gnl|bykdb|A0A1G8NKI0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Salipiger marinus] (length=368 residues).
MTMSERRPFRRRNRPEDTPPPAPTPRPDPQAEALAKAQAQAEAQREAEADAEDQRRRAEAAGDQARRQAEAAAQAQADAE
AEEQQRQAEAAARTRAQAAAEARAAREAENARAQVEADAASAPIPGTDQRWSALTPFPVDLAHLDRHRIVTARREDPAHT
AFDILRTKLVQTLAERGWSRVAITSPTKDCGKTFTAANLAISLSRQEALRTVLLDCDLRRPSLHKVMGVKTPGSMGDMLR
GRVPAEQHLLRMGPNSFHAGPNLAFGFNHIPESYPAELLQDPGTATALAALQERLKPDVMLFDLPPALYFDDVMAFRAQF
DGVLLVIGGGLSTEKEIREVERRLGDQTPLLGMILNKAEGTNLGKYGY
>gnl|bykdb|A0A1G8QZS5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Lutimaribacter saemankumensis] (length=286 residues).
MERIQAALKKAREERSQPKSSEPPEQVQTHERKPDPLILEQSHSVGDTEQLWKAVKGFNPSDRWLKRNRIVAFQSGEEAA
PYDVMRTKVLHSMRKNKWTRLGVTSPSQGAGKTMTSLNLAFSLARQSDLRIMLIDLDMRRPSVLKTLGVKDPIQFSKVLS
GESDAQDQMLRYGKNLIIAANSAPARNPAELLQSNRAAHAIDQVEAAFQPNILIFDTAPLFAGDDTMAFLDQVDCVLLMA
EAEKSTIEEIDKSEQDLAARTNVLGVVLNKCRYLNRHEEYGKAYGY
>gnl|bykdb|A0A1G9FY29 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudoruegeria lutimaris] (length=283 residues).
MDRLQTAIEKAREQRAEVLKQRPTNGPLTDVGFLPETVEHLPSREEIWQGLQSVDMTARALRDLRLMSNQGGSQSVPYDL
LRTRVLHQARQNGWRHIGIVSPTAACGKTTAAANLAFAFSHQPEVRMLLLDLDLRRPRLAGMMGQKIETGMEDVLLGRVP
FTEHARRMGNNVAIGFNNGASERPSELLQSIQTEERIAEITEQFDPDLVLIDLPPMMSTDDNFGFLSKVDAVLLMVAAEE
SSNEQIEVALRQLGELTTVMGIVLNKCRHTGGAYGYDSKYYYS
>gnl|bykdb|A0A1H1DBA0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas moorei] (length=266 residues).
MEIIKPASDKGEPQASSSLVTTSSGQPAPAPTLNALSYVQTKVVPLRADHLERHRIVAYNKNSAMGGAFDLLRTQVLKAM
EENGWRTLAITSPTPDSGKTVLAINLAMSIAHHTTKTALLVDFDLRRPRVGACLGLPMEKSLNELLADEAELQEVLVNPT
LPRFVVLPTREPIPLSTEVLSSPAVSHLITDLRDRYNSRIVIFDLPPVLSSDDVITVLPKFDCVLLVVANGMNSKKEIEE
SLHHLGSANLIGTVLNKAEPQNRSYY
>gnl|bykdb|A0A1H2EN09 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobacula phenolica] (length=287 residues).
MGKIYNAFKKKESEVFDSVMDDGTEPVPEETEYEFCISDADTSISEPYEEIPEKEVMPGNIDPSLVTVHSPHSIESEQFR
LLKNNILFPEIGTPPKSIMITSPSPDEGKSFVAANLAISIAGSIDEHVLLMDCDLRLPTIHKLFGLPDTKGLSDHLSTAI
SLNDLLLKTFIPKLTILPGGTIPRNPSELLSSGQMRSLIHEVKLRYRDRYIIIDTPPPYITSEGNALARQVDGIIVIIRH
GKTRIKDVQDIINIYGKEKIIGVVHNFAEKRPGYGYGYYKYGYGTVK
>gnl|bykdb|A0A1H2Y469 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Ruegeria halocynthiae] (length=282 residues).
MERIQAAIQKARESRQDQDEPEKAKGGTSPALAFEHDQQDQILPHSSADQLWAELTKIQLDPRQLHRARIIADQAGEDAA
SFDVLRTRMIHQMQSNNWRRVAITSPGSACGKTTLCLNLAFSFARQRDIKTMVIDLDMRRPSIDKLLNPTGQRSFANALE
RESAPEEHMLCFERKLAFATNSMPAKNPAELLQDKGSAHVIDRLEERYKPDVMLFDTTPMLACDDTYAFLDQIDCVLLVA
AADSTTAEELEKCESEISARTNLMGVVLNKCRYLNKADSYGY
>gnl|bykdb|A0A1H3I2J1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Lentibacter algarum] (length=443 residues).
MGERRSFSRTPRKALSREARQQLISDMLDEEFGTSTVEVTEIGEPARAAPAPVARDTLADSFDALDALDAQPLALEDELR
SPERDETEHDTQDHQPELQDEDDAAFDALLAEFEASDDHDDDDLDETVALTPPYELEASEALALEESYRAPSEPAQQAAP
VSEPEPEPELPPARSDAEKARQERLRAAYQASAPALHIEPADRWNALDVMPVDVEHLEQNLVITASRNEPAHGAFDVLRT
RLVQTLLEHNWKRVAVTSPTRNCGKTFTSVNLAISLSRYEATRTILMDFDMRNPSVAGVIGDTQPGKMGDFLRGTISAEE
LLVRFDQNTLNIGAGLAIGTNNVIEPYASELAHEPSTRASLDRMMEEMSPDIVLFDMPPALAFDDVIAFRQHFDGVLMVV
GGGETSPEEVREVMRRMGEETPLLGVVLNQAEGEDGSDYSYGY
>gnl|bykdb|A0A1H3IZW6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Jannaschia faecimaris] (length=293 residues).
MDRIQAAIARARTAREAVLAGHTAPGPQPAAQPAVSPRPADPVPEPAKSTTDQSWDALQWFEPDPAHLTKRRIVTRESGP
KSAPFDVLRTRALQQMSAQGWKRLAVTSPGPGCGKSTVTMNLAFSLARRPDIRTLVIDLDLRRPMLANLLGIKDRHEISS
VIRGTSDARSQIVRVADNLVFATTRTPVHDPAELLQGRRIGDMLTRLEEDFAPDVILFDLPPMMVSDDAIAFMPNADCAL
MIAAAEQSTLSQVDICEKELAAQTSVLGVVLNKCNHQSEGQRYGYAYGSDVDG
>gnl|bykdb|A0A1H3KC95 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Citreimonas salinaria] (length=513 residues).
MNAGPRFRRRWPLHDGAEDYREAPLVLGPETRSCDRFAPQEDPPPPSAESDDVPRPRRPRLVRKHRKAVPSAPEERHDVP
STPRATEPTVANTGDASAPPDTGPSREAFDAQLPKAAGKAEAHPTPPDMEPAPAASPASGARRVRLAALPKAELARVLRR
VRGQGPAIAAPPQEERPEYPPRASPTPGERPSAAGARGPVTAAEPQHPQPADAPPATTPAAADDDPGDASGSARDADAMP
ALPRQEAPETPPAAQELARPAHPPATPRTDSRTSSWDALGRFTASSAHLDRHRIVAARRDDPAHAAFDMLRTRLLQALSD
NGWKRVAITSPTARCGKTFTAANLAISLSRQENCRTVMLDLDLRRPSLHTTLGHADPAAIGAMLRGEVAPSGHLLRLGQN
DFDGGHNLAIGFNGRREPYAAELMQDPRTADTLSRIEAELAPDVMLFDLPPALYTDDVMALRPHFDGVILVIGGGITTPK
EVKSVERRMGDRVPLLCMVLNMAEDSDVRHYPY
>gnl|bykdb|A0A1H4B8T3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfuromusa kysingii] (length=279 residues).
MSRIEEALKKVSSQRTRVNQNKSTLRNKVDDAAPIRPKTVKNMINSLLDVVPLKIDHLMLATARDEKTIVVEEFNKLRST
VIALTKGDKFLNTIMVTSTASEEGKSMTALNLAISLAKEQDHTVLLVDTDLRRPSVHKYLDINPKVGLVHCLRDNLPIEK
ALIKTGVGKLVILPAGEAVRDPLDMLSSNRMKEIVHELKDRYPERYVIFDTPPSHPFADAGVLASFLDATLFVVREGKAN
KDDVVKALEEFKDHNLLGVVYNDARVFFKTTSGYYYDYD
>gnl|bykdb|A0A1H4N2K9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas mohnii] (length=263 residues).
MEIIKPAGDKAEQPASSSLVTTSTGQSATLNALSYVQTKVVPLRADHLERNRIVAYNKNSSMGGAFDLLRTQVLKAMEEN
GWRTLAITSPTPDSGKTVLAINLAMSIAHHTTKTALLVDFDLRRPKVGACLGLPMEKSLNELLADEAELQDVLVNPTLPR
FVVLPTREPIPLSTEVLSSPAVSHLISDLRDRYNSRIVIFDLPPVLSSDDVITVLPKFDCVLLVVANGMNSKKEIEESLH
HLANANLIGTVLNKAEPQNRSYY
>gnl|bykdb|A0A1H4RKV5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Bradyrhizobium lablabi] (length=270 residues).
MDSIKQAVELARAAESAPRNDTGLAGAFGISRQTTSDTQIRDVRLNAAHLQAARIIAYGTSSEHGRYYDMLRTQVLQEMD
KKSWQFLAVTSPTAGCGKTVTACNLAISIARLPGRSVLLVDLDLRKPMVANYLGLGATDGVLSVLEGRSTLSSAMLKASI
GPASFLVLPGSESSPGSSEWMASQTMANVLQTIQRDFRSCVVIFDLPPMLLGDDVISILPRMDAALLVAGVGSTSVSDIK
ECQKHLQRTPVVRVVVNKATELAGSYYGYY
>gnl|bykdb|A0A1H5J974 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas migulae] (length=262 residues).
MEIIKPDTENTEPKNSSKAMTATAQSSSLNALSYVQTKVVPLRPDHLERNRIVAYNKNSNMGGAFDLLRTQVLKVMEENG
WRTLAITSPTPEAGKTVLAINLAMSIAHHTTKTALLVDFDLRRPTVGACLGLSMEKSLNEYLVDEAELQEVLVNPTLPRF
VVLPTRKAIPLSTEVLSSPKVSHLISDLRERYNSRIVIFDLPPILSSDDVITVLPKFDCVLLVVANGMNNRKEIEESLHH
LGTANLIGTVLNKAEPQNRSYY
>gnl|bykdb|A0A1H5YYQ4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Thalassococcus halodurans] (length=350 residues).
MTQRPKFTRKKRAGAQSLPEIEPAVPAPQIDDTERKQAEIRARQAEEAAAAAKARAAEEEAERQRLAEQLRRVEEERKAE
ARRQAEAEQAAAAQSAQPEPEYVPDAPTLSDWDSLGTVSLDAATLDRHRIITGTRKDGAHTTFDVLRTRLLQALSEKGWK
RVAITSPTQGCGKTFTAANLALSLSRQENCRTLLLDFDMRRPSLAKVLGVQNPGSIGEMLRGTKDPQDHIKRLGPNTLHA
GQNIAFGLNDSAESYASELLLDPRTGAALDDLEERLNPDVILFDLPPALFSDDVLALQPHLDGVLLVVGGGVTTQAEIQE
VESRLGEATPLLGIVLNKAEGVHSANYEYF
>gnl|bykdb|A0A1H6G7A3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingopyxis sp. YR583] (length=266 residues).
MADADMPLSRDQQLLTLSALASFAPPLTAIKKHRIVGFDNRDARARPFNLLRTSFAKKLKEEGHRLIGITSATPAAGKSF
LSMNLASSLARVIEEPLFLVDLDIRRASLADEIGLVPDRGIESYLEGAVEDLREVGHRIEGTKLAVFPTVRRTRNTAELL
AGERFAQMIDTLRNRSEASVILFDLPPAFANDDAMISLAQLDAFVLVVDSGKTTRRHVQDVMSMLYPTPCIGSILNRYRG
GLGDSYGYGYGGPDYGKYYARSDPDA
>gnl|bykdb|A0A1H7G8B0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Jannaschia helgolandensis] (length=281 residues).
MDRLQAAIAQARAARQAVLSTQAGVPATTPEQAVSLPKDNWQALTRFEPDTDHLTENRIVTRDSGAKSAPFDVLRTRALQ
QMSMQGWKRLAVTSPGPGCGKSTVTMNLAFSLARQPDIRTLVIDLDLRRPMLATLLGLEARHEVTAAIRGTATPASQIVR
VSDNLAFATTRTPVHDPAELLQGRRIGDLLSRLEEEFAPDVILFDLPPIMVSDDAIAFLPNTDCALMITAAEQSTLSQVD
ICEKELAAQTSVLGVVLNKCAHPGDGQRYGYNYGYGVEPAA
>gnl|bykdb|A0A1H7KZF8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. JS21-1] (length=699 residues).
MNAPFGRIEAAVAPPPAPLFALDFDRLWVPVRRSLVPMAAIVFASLAAALLAFVLIRPSFRADATLRIDAAAQRIVGTED
VAGPVQVADIDRQMETTLLMARSVPVAEAVMRALKLSADDTFLRQMHADPAPTPGERRQAVLDLLDRKRSAAIIPNSRAA
SIAFTSPDPQLSALIANSFADHLVRRDVQQRADQSRYARAFLESELANIRTRLSESERRANDYARRAAIIAVPARKNQRT
DATLTSDTLDRVNQQLSDAAQRRIRAQADWRAVAARPPLSIPEVIGNAAVQSLVSQSTDVQARLNAAAARHGPEHPEVRQ
LTAQATALHRELTRLADGIKAGLHTPLDSATRDEAELASRFARLQTSRLSEQDNNVALAILQREADTNRNQYDALLARLN
QLNAEAGVQVSNLSILDRAVPPDRAYFPSLPLFAAIGLLLGVVAATLFLLVRELLFVRLRTPADVAARLSLPVIAAIPIA
RGENEARLESSYGEALAALHVASDRGLPASVLVTSASIGDGKSTTVHALAQAVGATGKSVLVIDADLRRPVQHRLFDVAG
DYGLTEVLAGQRALADATQRSGVTGVDVLAAGTRPPQPAILLASPRLRDTIEAATRAYDLVLIDTPPIVGVGDPLLLAVR
AQTVLFAIRADTSRVATVQGAIGKLAKLGVTPLGAMLTFYRPTGAEEYDYGIYRHEAAE
>gnl|bykdb|A0A1H7YHK3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudoxanthomonas sp. GM95] (length=473 residues).
MEAYGRRKVDRNSAEVSSQLKFVKDQLLEVRKQVEAAQAAMNAYQTKAKSVDITMQTKGLLEQQVAVETSIQQLHMQQAE
MDRSFTREHPAYRALMKQIGELESRKAGFNKQVGELPDTQQELLRLTRDLQVSNELYTALLNQAQQLDVARAGTVGNVRI
IDPAAVDVTSPVKPRRPLIVLVGTLLGGFLAVGLVFLRRIMNPGIEEPSQIEELGLPVYAAIPLSDSKDVQDIAKRSRRT
GGTGRHHLLAVNAPADLAVEAMRSLRTSLHFAMLEAKNNVLMISGPRPGVGKTFVSANLAAVIAQAGQKVLVIDADMRKG
TLHKVLGVVPGNGLSDVLVGKADAASAIHIMDRVPNMHYMTRGEIPPNPSELLMHPRFTQLLESLASQYDLVIIDTPPIL
AVTDAAIVGQQAGSSLLVTRFGLNQPKELMLTKKRFEQNGVHIKGAIFNAVEKRATGYYSYGYYEYKSGGANA
>gnl|bykdb|A0A1H8C800 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Roseovarius tolerans] (length=353 residues).
MKLQRHDAYMRRREARHTAEEAGDVAETSLEERGDERAFPLDPEMRAEPEEAFAVTPESLDSPEPEPEPEPEPEPEPEPE
PEPEPEPEPEPEPEPEPEPEPEPEPEPVASTQQPLWDDLRAVPLDTRHLIRNRLISATREDPAHVAFDVLRTKLVATLRA
RGWHRVAITSATPDCGKSFVAANLAISLSRQSGLRTVLMDMDLRRPSLAKMLGVSEPGSMSRFLTGELSAERHFLRPDKN
AMHIGPHLALGLNDRAEAYAAELLQAPGTAAVLADLCARLAPDVVIFDMPPALYYDDVLGFRPQFDGVLLVVGGGRSTAK
EVRDLKARFGDEVPLLGVVMNRAEGENITKYGY
>gnl|bykdb|A0A1H9C241 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Litorimicrobium taeanense] (length=305 residues).
MAEHVVRRRGQKRLGREDKTKLLERVARYSDEIEKQEKAVRAAMVSSERAPTVAAVPSAPEVKQVDIWDMLPTVPVDEAL
LERNLVITASRNDPAHAAFDVLRARLVQTLTENGWKRVGITSPTRDCGKTFVAANLAITLSRYENSRTVLLDLDMRNPSV
ANTLGAHNVGSIGDYLRAVTSTRDQFRRIGKNTLKIGGSLAIAMNDRIEPYAAELLQDPVTRERLHQMELELSPDIILFD
LPPALAQDDVIAFRQNLDGVLVVTDGRKTSAAEVREVMRRLGTDLPLLGVILNKAEDASDSDYGY
>gnl|bykdb|A0A1H9KL56 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas cuatrocienegasensis] (length=270 residues).
MERIKQAIEKAKKQASSGFIAKPQASSAVAQPLAELGALNYVQTKVISLRAELLERNRIVAYNKNSNMSWSFDLLRTQVL
KIMEENGWRTLAITSPTPEAGKTVVAINLAMSIAHHTTKTALLVDFDLRRPKVGAYLGLPMEQSLNDLLSGEAELQDVLV
NPSLPRFVVLPTRKSVSHSTEVLSSVAVGNLITDLRERYDSRIVIFDLPPLLSCDDAIAVLPKIDCVLLVVANGMNSKKE
IEDCLHHLPAANLIGTVLNKIEIEPRTYSY
>gnl|bykdb|A0A1I0R9R6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Aliiroseovarius sediminilitoris] (length=272 residues).
MEKLQAAIEKARRQRDGKPRARRSQERSSKPPASMPEAWAELEPFDISASLAQKNRLVSLNGGAAAGPFDMLRTRILQQA
TNNGWKRIALVSPHSACGKTTTAANLIFSFGRQTDLLTMVLDLDLRRQGLAKVLGLQCDGNMGDVLQGKKSFAEHGRRFG
ENVAVGLNRGEVSNASEILQSNQTKVILDELQDDYEPDIMLLDMPPLIGADDNFGFLQNVDCALLLAEAERTTVEQVDIA
ERQLSELTTVMGVVLNKSHFSDGAYGYGYGTA
>gnl|bykdb|A0A1I1UM01 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Roseivivax sediminis] (length=423 residues).
MTNRPKFRRRRRTQPEQEPAEDDLRPIPPLDTRQERLARREAEAEAERQREEARQQAEEDARRQAQEDRLRAEEEARRQA
EQDRQRAEAEAQRQAEAERLRVEAETRRRAEEVRLREETEARQQAEEDRQRARARADQVAHGDAGPDGADEQRTDRRPHI
ERAPVPASGRAVARAPAVEDDPGLIWDTMSSFPVDERELDRNRIITASRHDPAHASFDVLRTRLMQALSERQWSRVAVTS
PTQGCGKTFTTANLGISLSRQSGLRTVVLDLDLRRPGLHEVFGLSNPGPLGAVLRGTTPPEAHLRRLGPNGFHAGRDIAF
GFNDAPEPYAAELLQDSRTARALDTIEERLAPDVMLFDLPPALVSDDVLALRPCFDAVLLVVGGGLTNQSEIRAVEQRLG
ENTPLLGVILNRAEGTNSRKYAY
>gnl|bykdb|A0A1I3PSR2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfomicrobium apsheronum] (length=266 residues).
MSRIEEALAKAAGMQSGLHSKGNRAEVSGIARAPMGEPTSVGGFRLPEETMVVINAPLSPMAEEYRKLKEALVKMTKRER
FDNLIAVTSSIAGEGKSMTAVNLAASLAGEYDHTVLLVDADLRRPSVHKYLGLGSGKGLSDCMREGLDVGELLVKTGIGK
LSVLPAGTPTPNPVELFSSDAMRSLFREMKIRYGDRYIIVDTPPVLPFAETRSIASIVDGVILVVKEGMPSLDQIEEAIE
ALDQKVLGLVYNGAYLQSKSSYYYAE
>gnl|bykdb|A0A1I3TTC3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Jannaschia pohangensis] (length=305 residues).
MDRLHAAIAQARKAREAVLAGAGPAMEAEAHAPAYSDPSMFQAPKPRRPVAPVEDATVTTSDPDAAWAALPYHAPPVDAL
LQRKIVTRDGGPKSAPFDVLRTRALQQMSAQGWRRLAITSPGPGCGKSTVTMNLAFSLARQPDIRTVVIDLDLRRPMIAS
LLGLDTGHEITSAIRGTTSVADQMVRVADNLAFATTANPVHDPAELLQGRRMTEMLLRLEDDFAPDVILFDLPPIMVSDD
AIAFLPNADCALMIAAAEQSTLGDVDACEKELAAQTNVLGVVLNKCGHGNDGGRYGYGYGYGSDG
>gnl|bykdb|A0A1I3XJ27 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium albiziae] (length=282 residues).
MSGSEASAQKTPEGPGVLDRIQTAMQKAREEHSPVRLPERSIPSVHSVGDALWAKLEAGRLIPDQATAARLVTARRSDPA
HTAFDMMRTRVLQLLRQNNWRSIAITSPTPGCGKTMVTLNLAFSLAHQKDCRTVVVDLDLRRPQIAKSLGIRNPSSMEDF
LKGQVPLESTLLRYGDNVAVASNSRPVHLAAELLQNTDTTKALASLQQRLNPDVVLFDLPPMLANDDVMAFLPNVDCAIL
VVAAESSTLTEADLCERELALKTNVLGVVLNKSQHVTETYGY
>gnl|bykdb|A0A1I4GEK4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfomicrobium norvegicum] (length=266 residues).
MSRIEEALAKAAGMQSGLHSKGNRAGVSGIARAPMGEPTSVGGVRLAEETMVVINAPLSPMAEEYRKLKEALVKMTKRER
FDNLIAVTSSTAGEGKSMTAVNLAASLAGEYDHTVLLVDADLRRPSVHKYLGLGSCKGLSDCMREGLDVGELLVKTGIGK
LSVLPAGTPTPNPVELFSSDAMRSLFREMKIRYGDRYIIVDTPPVLPFAETRSIASIVDGVILVVKEGMPNLEQIEEAID
ALDQKVLGIVYNGAHLQNRSSYYYAE
>gnl|bykdb|A0A1I5E9E9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Roseovarius lutimaris] (length=371 residues).
MKLSRYEAYMRRRAARRDALENAQSDTPVQEDIPIPDAEAATPEADEAPLALNPENIEPPLAEKPLAPEPAAQQLPEPEP
EPEPDDAPDVADESEGAPEVVVVPVPDVAAVNEPAKAASGDAADTALAPVPLLWPNLRQVPLDARHLARNRLISATREDP
AHVAFDVLRTKLLAALRAKGWHRVAITSPTPDCGKSFVAANLAISLSRQTSVHTVLMDLDLRRPSLARTLGLAAPGPMAS
FLTGDTPLEQQFVRPAKNTLNIGDNLALGLNERVETYAAELLQAPHTGEVLDDLHTRLRPDVVLFDMPPALYYDDVLGFR
PQFDGVLLVIGGGRSTAQEVRDVKRRFGADTPLLGVVMNRAEDGDIAKYGY
>gnl|bykdb|A0A1I5YYQ0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Roseivivax halotolerans] (length=410 residues).
MSADRTFRRKNRPVRAREEDDMRPVAPLERPKDRVPQDAAPPAALESGEARDKPRTFRRKNPPRRTPEAQRPAGPPEARP
DPADKEPDVPRKTLTEPPVRLEPEMRQDAPTDAAPEETPPPMAEAQEPAALMRADEPKDGPATAPAMAPPAERTATPVTP
SLSESAADQDANWRALDTFRVDERLLDRNRIITASRYDPAHSSFDVLRTRLLQALAERGWTRIAITSPTQGCGKTFTAAN
LAISLARQENCRTILFDTDLRNPSLSKVFGLSGMGPIGNLLRGASGPEDHLLRLGPNAIHASQNLAIAFNDAPETYASEL
LQDPRTGRALNHVQERYRPDVMLFDMPPALYGDDVIAMRPHIDAVILVVGGGLTSEREIREVEARLGTETPLLGVVLNRA
EGSTARKYTY
>gnl|bykdb|A0A1I6ENM4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Poseidonocella sedimentorum] (length=279 residues).
MEKLQKALSKARQDRAAQGAAPRRAAPDTPAASAAARAPAPSATDAAWAGLAPIELDDAHLTENMVMTYSARPDANPFDV
LRTKIFLAMRENGWKRLAVTSPDVGCGKTTIACNLAVGFARQREVRAMLFDTDLRRPNISKVLGCTPEHDLPQMLSGEVS
PQEQFLRLRDNVALSLTRSPVEDPSQVLLANSTARSLSEVETLFDPDIMIFDLPPMLVTDDARAVLKNVDCALIVVRSEK
TRMARLDQCEREIAEYTNVLGVALNDCRNVSREDSHYGY
>gnl|bykdb|A0A1I6U4V1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Yangia pacifica] (length=366 residues).
MVERRKFSRRKRAEELPEDPPILPLERREERLARRRADREAEEARAAEQRRAEQQRLEDQRLEERRLEEHRAEMDTARRQ
LAAARPRAAAAVAAPVNASAAPAHPAPETAPAFRRPITHRTAPQAEALWDRLPVFEIDTDHLERSRIITASREDPAHTAF
DVLRTRLTQALAENGWTRVGITSPSKGCGKTFTAANLAISLSRQEGLRALLMDLDLRNPSLHKVMGVRTPGAMGALLRGV
VSPEAHLMRMGENRIHAGHNIAFGFNEVVEPYAAELLNAPATAEVVTAIESRLQPDVMLFDLPPALYYDDVLAFRPQIDG
VLLVVGGGLTTEREIREVERRLGANTPLLGMVLNKAEGTELKKYQY
>gnl|bykdb|A0A1I6X762 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sedimentitalea nanhaiensis] (length=279 residues).
MTDRLQQAIKKARSERESRVGASRPQMPQSVSSRAPQKRTPVQDAWQRLTPLIVDPKAVVNNRLVAHTSGELAIPFDMLR
TKVLQQAKKNNWRRVALVSPHSACGKSTIAANLGYSFSRMTELRTIVMDFDLRRMGLGRVLGQTPTQGMPDVLVREADFA
DVACCLNGNVAFGLNARSGRHPSEILQSRQTSDVLDEIERTYQPDVMLFDMPPLMANDDSHGFLRSVDCALLIVVAEKTP
MEQIDVAERQLGELTNVMGIVLNRCRYTTGAHGYENEYY
>gnl|bykdb|A0A1I7DCG1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium sp. YR577] (length=266 residues).
MEHIHAALQKAKQQRGSDPANDQTATTVARMGSDMLWASLPSLKPDPKHLAKTRLVTINRSDLAHTQFDMLRTKVLQYLR
QNNWTSVAITSPTPACGKTVVGLNLAFSMAHHKECRTVLIDLDLRRPQVSKVLGIKEPPSIESFLRGRSEVEDVFIRYGD
NIAIGANGRPVRFAAELLQSPEAAQALKSLKQKLKPDVLIFDLPPMLANDDVMAFLPNVDCVILVAAAEASTFSEVDICE
RDLSEKSKVLGVVLNKCRYAPEKYGY
>gnl|bykdb|A0A1J5DAY8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Deltaproteobacteria bacterium CG2_30_66_27] (length=249 residues).
MKIFTMGGGRPGTESPSGRIGILNLRSIDPFYYEMVKGLRAKVEYKMDSLNLRVLAVTSAVAGEGKTLTATHLAANMAST
GRKKVLLMDLDLRKSGIARELGMSANPGLSEYLSGAVPVERIVRNSVVPGLSVIVGGKTVSSPADMLAGERFRSLLQGLR
ERFDLIILDTPPVLPVPDAVTISEQVDAFILLFRFGYTPHQLFRQAIDELGERKIVGVVLNGEEKKPDKYYHKYYGKYYQ
VANTKGKPA
>gnl|bykdb|A0A1J5EVZ6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobacterales bacterium CG2_30_60_27] (length=293 residues).
MGKIHTALSKAGAEEPTTRQMEETPAPPLPMPGSARPTAKERRPERPAPQATAEGQRWDERLDAASSVLTGIAESFRRLR
ATILHPKKGQPARTIMVTSSVPSEGKSFVCANLGIAFAQGVEEHALLIDCDLRRPSLAQLFGLGNDRGLVNHLRGGDDLG
GLIKKTSLDKLAIIPAGPPPMNPSELLGSEVMQALITEVSGRYPDRFIFFDSPPLQAASETSVLAKQVDGIVLVVRWGRS
GRKQVQQLVETLGKEKILGVVFNACETGRLESKLQGYSHGYDYYYTSGYGRKD
>gnl|bykdb|A0A1J5ICP0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Syntrophaceae bacterium CG2_30_49_12] (length=632 residues).
SYVLKFDGPDSYKIIEDKSGALAGKGELNKPFLGPNFSILVEGDHARKGRKMKFSVLTPASAVEGLQGSLAVSPIKNTEL
VTISATAPNPSMAATKVNVIVSEYKSLAVLKDTQNAASALAFIDEQIGILEKSLRSSEGRLMSFKEKEKLVSLSDDARAT
LQQLMNFDTELKQAEGLRKQAEFIAENIMQSDGMPDKSIVALGASTKSERLNALAQKLSELQSRMITLKINYKEKHPLVV
EAVEQIKETKKGIMAELSSIIASLKVNERSIKGNISSYEKRINALPAAEKRLAELTRGAEVQQSAYSSLLRNKQEFEIMK
AGEIGNVWVVDSAASAKIIKPKVMRSLMLAVVVGLFVGVGIAFFLEYLDNTIKNPDDVKRITDLPLLGSIAKLDTRAGEN
GGELITHTMPKANISEAFRTIRTNIFFASFDTPKRLIGVTSSVPEEGKTLFAANLAVSIAQADKRVLLIDADMRRPRLHR
IFNQKRAPGLSNLIMAEDIEGAIGEAIRKLPIPGVDVIYSGDIPHNPNELLGSQKLKGIIDLISERYDYILFDSPPILSV
SDPVVLTNRLDGTILIIHAEKTDKNALKQALESIPDEKVMGLVLNNINIERDRYYYRYYHQYYYSYEPKSTA
>gnl|bykdb|A0A1J5N774 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudodesulfovibrio hydrargyri] (length=288 residues).
MSRIEEALKKATQLRGREEQRQDRAIPTGPHGGESANDLGRAPRKEIPQEVLDRVAGQHMLVSLNDIVSPAAEEFRKLKQ
NLVRLTKKKGFQNTIVITSGTVGEGKSVTSTNLAISLAQEFDHTVLLVDADLRKPSCHELLCLDQAYGLSDCLLEGTDVS
NAIIRTGIGKLSFLPAGTPMANPGELLASQRMATVLREMKERYSDRFLIIDTPPVLPFAESRILARLADMVVLVVREQRL
SKYELNETLEALGGANVAGAVFTQASSGHSVAGYSGYAHYSYKYSYNA
>gnl|bykdb|A0A1L3GKM9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pelobacter sp. SFB93] (length=275 residues).
MSRIEKAIEKANQLRQGAPADISPVKVTPLPAAASTIQPPAEDLPTGQALQPDHPCLVINRDPGEGIAEEYRKLKSVVFE
LTRQGGFDNTLLVTSDLPDAGKSLTALNLALTMAKEYDHTVLLVDTDLRKPSVHKYLGIAPEKGLLHCLTENYPLEKALI
RTGIGKLVVLPAGGTVADPAELLASNRMRDLVAELKARYPDRYVIFDTTPVLPFAEASVLGSLVDKILFVVRERQTRNDH
LQEALGMLKGNNLLGIVYNDADVSHKMDHYRYYNY
>gnl|bykdb|A0A1M3BXA5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderiales bacterium 66-5] (length=288 residues).
MERIKQALEKARQQSVGAAPAAPAHPQTAPVAATAPAAVAQQADALASGVIEINYTQTEVVRLDRATLERNRIVAFEKTN
PDNWAFDVLRTQVLQKMDEKGWRTLAITSPTVGSGKTVTAINLAISIAHHTQRTAMLVDFDLRRPRVGAYLGVRKKPSLS
EVLTGKAQLADALVNPDLPRLVVLPTSSPVPHAAEVLSSVVVRSMVADLRERYADRIVIFDLPPVMAGDDVMALLPSVDA
VLLVVGNGDSTRKEIEESMRHLPPGQLLGVVLNKAEAEVRRGYGYGYY
>gnl|bykdb|A0A1M5GH86 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfacinum infernum DSM 9756] (length=276 residues).
MGKIYEALERAKKSPKRETGPRRGVVVPSLPASPGGLVVLDEPGSPTAECFRFLRSVLVRPMEGDPPRTILVTSPLIGDG
KTYVASNLAAAISQGLDEWVLLMDCDLRYPRLDRVFGLHGGHRGLSTYLTSDTPLDQLLRKTPVHKLTILPGGNSTHQPT
ELLTSEKMLRLIREVRDRYPDRFVVMDSTPLELAPETFVIANEVDAVILVVRRGRTPRNAVRNAVNRIRREKLLGVVFND
YDKSSKVYKKYKYTPVFGNHEGEEEPTGGGGEKAAE
>gnl|bykdb|A0A1M5TI07 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Bradyrhizobium erythrophlei] (length=268 residues).
MDSIKQAIDLARATEGGARRAAVSVPDPARPGLHDPQFRQVRLSEADLEQTRIVAHGVGTPNGRYYDMLRAQVLQEMDQN
SWQFLAVTSPTVACGKTVTSCNLAMSVARLPERSVLLVDMDMRKPMVANYLGLESDPGIVGVLEERRTLGSALIEASIGP
SKLLVLPGEVAASTSSEWMASQTMATLLQTIKRDFRSRTVIFDLPPMLIGDDVISILPRMDAVILVTGVGTTSVADIKEC
QKHLKQSNLVRVVVNKVTDIADDYHAYY
>gnl|bykdb|A0A1M5UQ38 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Marivita hallyeonensis] (length=351 residues).
MTEQPKFQRRKRRGAVDDVPTPTPKAPKKATPPRKDINALLAEKEALLQRKAALKAEVARKKAQATQVSERPAPTVTTTD
AKPRTKSRPLVLASPPRPKAPKTPEPKHDPEAVWSQLDRFALNPKRLAKHNVITALREDPAHTRFDILRTRMLQALAENG
WRRVAITSPTKDCGKTFTAANLAISLSRHETCRTVLLDLDMRSPSLHKIFGVSDCGVIGDMLRGEISPERHLQGFANNTI
SAGSHVAIGFNGMVEPYAAELLQDPATEKALQRIEKSLEPDVMLFDLPPALLNDDVLAMRPHFDALLIVAGGGTTRANDI
KETERRLGSTVPLLGVILNKADQSEAGDYAY
>gnl|bykdb|A0A1M5YLH5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfofustis glycolicus DSM 9705] (length=286 residues).
MGKLADVLEKAGYGTEGTEKQKPSQSEQPKNRSAKPVERAAPAPRTKLVRSNDNSGKWDERLFKAVNSDAYIPEIFKTLR
SHILHPLEGQKVPKTIMVTSAIPKEGKSFVTANLGITLAQGMDQYALLVDCDLRRPSLAPMFGLNKSPGLADYLRDDIDL
SELIVRSSVDKLSILPSGDPPVNPAELLSSAKMSSLVEELATRYDDRLIIFDSPPFYVASEATVLSRQVDGVLLVVRSGG
AGKPQIQMMLDTVGEERIIGVVFNAYTTNIVERSLMKGYGYYQQSY
>gnl|bykdb|A0A1M6KEN5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Malonomonas rubra DSM 5091] (length=282 residues).
MSRIEEALKKAASQRSTPSGEEEGNATSSALKKVDSKISPSPDAGEGFSSLLEVPPIKVDNLLLATAYDAKSDVVEEYNK
LRSTVIALTKGEKFSNTLLVTSTISEEGKSMTALNLAISLAKEHDHTVLLVDTDLRRPSVHRFLGLKPDVGLVHCLRDGL
PIEKALIKTGIGKLVVLPAGEAIKDPLDMLSSNRMKEIILELKQRYAERYVIFDTPPSMPFADASVLAANIDATLFVARE
GRARKQDLLSTIEEFKKHNLLGVIYNDAHAFTKKNNYYYYYR
>gnl|bykdb|A0A1M6N1X5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Paraburkholderia terricola] (length=315 residues).
MTIAIGTLLGLLLGVGFAFVHNYLFAGIAEAEEIESHAGLTVYATIPESRYQQQLNKERNTHPLDVRLLVQAYPHEPAVE
SLRSLRTALQFAMLNAKNNVVLISGPTPDVGKSFVSANFAALLAASGKRVLVIDGDIRRGHLHQYFGRQRERGFTDVVAR
KLALDQVIHRDVVPHLDFIATGGLPGSAAEVLIQERVGQILDASARNYDVVLVDSPPVLAVTDAMVLADHCATVLLVARA
GRTRVAELSESVKRFAHSGISVAGALLNGLDPKSGRRSYGRKTGAYRYVQYRYEEAQPALVSRWRQILVRLGLGR
>gnl|bykdb|A0A1M7BLL7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Roseovarius marisflavi] (length=386 residues).
MPWRATSLWALSGDGAMKLSRYEAHMRRRAARRDALENPHSHSPDQEDILSPEADEATQEADEAPFALSPEMIAPPLDEK
PLVAEADGQLPEPEPEPDVEDAPNVADAAEDESEVIVVPVPEVAVVNGPVEQAPEDAVDEVPAPLPLLWPNLRSVPLDAR
HLTRNRLITATREDPAHVAFDVLRTKLLAALRAKGWHRVAITSPTPDCGKSFVAANLAISLSRQPSVHTVLMDLDLRRPS
LARTLGLSAPGPIASFLKGDTSLEQQFVRPAENALNIGENLAFGLNDRVESYAAELLQAPRTGEVLDNLYARLRPDVVLF
DMPPALYYDDALGFRPQFDGVLLVIGGGRSTAQEVRDVKRRFGAETPLLGVVMNRAEDGDIAKYGY
>gnl|bykdb|A0A1M7HC79 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Halomonas subglaciescola] (length=470 residues).
MAETFLTQNVERQSAEAQQSLEFLQEQSPELRAQLADAEERLNQYRVAMDSVDLSSESQATIQQFIALEQQLNELEFQEA
EMAQRFTPRHPNYKTLQRKKRQLQQERAELNERVNQLPAEQQEVVRLTRDVEVTQAIYVNVLNKAQELKLARAGTVGNVR
IIDEALVGSGPIEPKKPLIVVLATLLGGLLAVGLVLVRGLFNRGVESPEQIEDVGIPVYASVPLSDEQNTLIKRVKHRRE
RQGHNVMTGILALREPTDTAIEALRGLRTSLHFAMMEATSNRLMITGPSPGVGKSFVSINLAAVCAQTGQKVLVVDADMR
KGHVHDAFGGKSGNGLSERLTGKADLSEVLRNSSLDGLDYVARGSAPPNPSELLMHANFSAFLEQVSQRFDLVIIDTPPI
LAVTDAAIVGKQCGTSLMVARFQMNPVKELMIANRRMETAGVEIKGAILNAMERKAAASYSYGYYNYSYK
>gnl|bykdb|A0A1M7Y300 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfopila aestuarii DSM 18488] (length=301 residues).
MGNIADALKKAGVELPDHAPVEVRRDDEVVAAEEPSSYQESTYTVTNKRAPAVDASQPLQSGPWNERIQMVLDSVGPVAE
SFKVLRSKILFPKDGKARPRTIMISSSSPEEGKSFVSINLAVAIARGLDQHALLVDCDLRRPSLLGLLGMGAEYTRGLAE
YLQGDSELAELICRTSVDKLSLLPSGTPPQNPAELLTSVRMSRLVNELSGRYSDRFIIFDSAPFQIASETMVLAKNVDGV
VLVIGSGKSDKARLRRMVENIGPDKILGIVFNGHKQGYFKKKMFDPYGSYYGKYYSSNARK
>gnl|bykdb|A0A1N6JQ20 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Bradyrhizobium erythrophlei] (length=269 residues).
MDSIKQAVELARATENMPRQGERAPGLSAGVRPGSVDARTREVRLNSAHLESSRIVAHGASIEHGRYYDMLRTQVLQEMD
KKSWQFLAVTSPTAACGKTVTACNLALSIARLPERLVLLVDLDLRKPAVAKYLGLGDTGGILSVLEGASPSSEIIQANIG
PNSLLVLPGSVSSSGSSEWMASQTMSTLLQTIKRDFRSRIVIFDMPPILLGDDVISILPRMDAALLVAGVGTTSVSDIKE
CQKHLQRTPVVRVVLNKATESADSYYGYY
>gnl|bykdb|A0A1N6SH58 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhizobium sp. RU20A] (length=188 residues).
PGEGKSTLALALARMYALSGRKTLLIDCDLRKPTLHKHVGLQPNAGFIDFLRHHDTESNASMPNVLVNDPLSDLILMLGG
RSSDIGTDEFFMDERLARVLATARKHFDYIILDTPPIDPVVDGLYLARNADVVFFVVKWATTPQTVAKRSLEALKDNIGS
NTQIYTVLNQQDMASFSKSNVYSEYYNS
>gnl|bykdb|A0A1N7JVZ7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Roseivivax lentus] (length=687 residues).
MTAERVFRRKNRPHARSEPEAQAQPAASRDDSADAHDSPSPKVFRRQKRSVAPGETQAEPTPEPQQPAPKPQLVHNERPR
RSAEQAFPPLASDEPAPHPETSREALLAFAEDLAFPDLTVEDDAPPARSEKPTPEAAPAAWDDTKMEGHAEADEEKPSVP
PTASEPDAPNSSGPGADTRSDAATAPDAPLVLQDTQRADAPEPAPKEADPVTPPVAQKPDQTPETHPLPPQAIAPTREPE
KPLPTAMPPADTTRDAQELDEADEIAAIEATPSISARAPEDAGDRARTEPDPLMAQHPEPETSPEAERIAVEAEPSPHVG
GEESSDIENLFADEPTTESVEPDHHLGDRIEDGPVAPRTDPVDAGAREGGAEMMNGGGAKASETADEPDSVETDVDRDEP
EAGNQVSEAEDTEPKAGQAQVTDPGAPDPDPAIAKPPTDAASPETDGALWARLAPVIVDERVLDRHRVITATRYDPAHAA
FDVLRTRLLQAVAERGWSRIAITSPTKGCGKTFTAANLAISLARQENCPTILFDTDLRDPMLARTFGATATGAIGDMLRG
KTAPEDHLQRLGPNSIHAGPNLAFAFNDAREAYASELLQDPRTADTLRRIEERFAPKLMLFDTPPALYGDDVLAMRPLID
AVILVVGGGLTTANEIREVENRLGTETPLLGVVLNRAEGSKTRQYGY
>gnl|bykdb|A0A1P8ENT1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas frederiksbergensis] (length=262 residues).
MEIINSDTEKAEQQTSSKAMTPTAQSTSLNALSYVQTKVVPLRPGHLERNRIVAYNKNSNVGGAFDLLRTQVLKIMEENG
WRTLAITSPTPEAGKTVLAINLAMSIAHHTTKTALLVDFDLRRPKVGEYLGLPMDKSLNELLADEAELQEVLVNPTLPRF
VVLPTREPIPLSTEVLSSPAVSHLIADLRERYNSRIVIFDLPPLLSSDDVINVLPRFDCVLLVVANGLNSKKEIEESLHH
LGTANLIGTVLNKAEPENRSYY
>gnl|bykdb|A0A1P8USW9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pelagibaca abyssi] (length=430 residues).
MNMVDRRKFRRKFGRTEAPAPETQPEDPPIEPLESRETRLARRKAETEAAAAAEEAARKAQEDDARRKAEAKRKAEDARR
AAERLEAVQRQRAEAARRKREAEEQARKQAEDAAREAELRAQQEAAREAESARAAEKARQEDETRRAAIAERREERRKAR
EDALRRAQEDTETVPAAAAAPEPKPAPQATPLWDALPTFAVDARHLERNRIVTAGRQDPAHAAFDVLRTRLLQALADNGW
KRVAITSPTKDCGKTFTAANLAISLSRQETCRTLLLDCDLRRPTLHKVMGLRNPGSMGDMLRGLVPPERQLARLGPNDIH
AGQNIAFGFNGTVEPYASELLQDPRTEETLNAIEKSLAPDVILFDLPPALYFDDVMAFRPQFDGVLLVIGGGLTTDKEVR
EVERRLGDNTPLLGTVLNKAEGTNLRKYSY
>gnl|bykdb|A0A1Q3MB35 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Altererythrobacter sp. 66-12] (length=583 residues).
MASAAQQRLELATDILLDNVSINPVRGSRLVDVKFTSPSPKLSAQVADLWVSQFQQAALDRRFLSTADAREFLEGRLAEL
RGRLEDAQRQLVAYAADKQIITLANGQDESGRTDTAETLVSNDLKVLNGALADATRARITAESTVRQTSSASEGSLNNQA
LNLMRDRRAQYASELASSLAVFEPEYPQVQALQSQLSELDRNIAREEARVRQAAQTTYQEALARENSLNREVAALKRRML
DERRDSIQYAIYQREVDTTRELYQGLLQRYKEIGVAGVGANNVTVVDRAVVPLEPSSPNLPLNLALGIIAALGLGAAYVF
TREQLDQSLSDPSHVSERLGLPLLGTIPHEHDRDIQEDFKDPKSTISEAYLAATSNLTFLTSSGAPRSLIITSTRASEGK
STTAYGLALSFARIGKRTLLIDSDLRNPSQHAFFGLPKEDGLTNLLTAEAPGNLDRYVRSTDRERLFFMSAGPLPPDPGG
LLNSERMRQLIQELAGKFDQVIVDGPPVLGLADAPLLSKAGDGVVYVVESGGVKVRGVLAGVRRMEFADARMCGVILTKL
EASHLAYGYGEVYGYEYGTKDKK
>gnl|bykdb|A0A1Q5SFV5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Bradyrhizobium sp. AS23.2] (length=268 residues).
MESIKQAVELARSGDSLAQQELIGGSKPIARGHESTSVREVRLDADHLEANRIVAFAAGGESGRYYDMLRTQVLQEMDKK
NWQFLAVTSPTAGCGKTVTACNLAMSIARLPERSALVVDLDLRKPMVANYLGLPRSGGVLSVLEGQVPISSAVVKAGVGP
NSLFLLPGSTSISGSSEWMASQTMTALLQGIKREFRSHTVIFDLPPMLLGDDVISILPRMDAVLLVTGVGSSSVADIKEC
QKHLERVPVVRVVVNKVSEKIDTYYGYY
>gnl|bykdb|A0A1Q6DMW3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobulbaceae bacterium DB1] (length=289 residues).
MGKVFDALSKSGADNKPVERKSPASVKSEGENVPSGEFPKEPRITGATIMPSRSPVVPAGWDERFLAARANPAVTESFRR
LRAKILHLQDVNPIRSLLVTSSSPGEGKSFVCANLGAIMAHGVAQHALLVDCDLRRPSLARFFGIESGSGLVDHLRDGRD
LSSLIVRTGMERLSLIPAGTPPQNPSELLASHAMSELMKEVISRYQDRFVIFDSPPAQAASETAVLAQHVDKVVIVVKWG
GSGREQVKKLVEQLGHEKILGVVFNAFEMNFFEKRLQGEGYYKYYSEEY
>gnl|bykdb|A0A1Q8QQ99 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfovibrio sp. DV] (length=269 residues).
MGRIEEALEKAVRRIVPDTPPPPLRADDNTPSTPPANMDPEQVTDERLVVIKRPHSPEAEEFRKLKEALFKEIKRRETFG
NVILITSAGPREGKSLVTLNLAVSLAQEHDHTVLVIDADLRKPSCHRPFGIEVAPGLSDYLTDNLPLSRVMVRSGVGNLV
ILPAGKQITTPCELFSSNTMRQMIQEIKHRYPDRIILIDSPPILSFAETRILADQADATILVVREKLCTLESIQECLKLL
QNKIIGIAYNGSTVQYNHQNGYNYEYDKN
>gnl|bykdb|A0A1S0ZAI3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Salmonella enterica subsp. enterica serovar Saintpaul] (length=230 residues).
MPTLEIAHKKLEQARKAEEYYNALRTNIQLSGNNLKVIAITSVKPGEGKSTTSTNIAWAFARAGYKTLLIDADIRNSVMS
GVFKSREKITGLTEYLSGTTDLSQGLCETNVENLFVIQAGSVSPNPTALLQSENFATMIDTLHKYFDYIIVDTAPIGVVI
DAAIITQKCDASVLVTAAGETNRRDVQKAKEQLEQTSKPFLGVVLNKFNTSVEKYGSYGAYGNYGNYGKK
>gnl|bykdb|A0A1S7S3I8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Agrobacterium tumefaciens str. Kerr 14] (length=273 residues).
MENAKAGTSAATPGGEHATLDESGQVSFQKMLRLAVDSPRSSFAETLRNVKLTADVVIQERQCRVIGVISCLPNEGKSVV
ALNLAGLIASTGKRTLVVDADIRNPGLSRMLTTRQSAGLVEVVLDEIPWTQAVKVDTRTKMGILPVSTSNQFAHSSELLS
SSGMRKFIDSAREACDYIIVDLAPVVPVIDAKAFAPQVDGFVFVTEWGKTPIQMVQNLMANEPQIANKTLGIVLNKTDMT
ELQRYAGPGGSEHYHEKFSAYYGDAKPPVKEEA
>gnl|bykdb|A0A1T2KYM8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Solemya pervernicosa gill symbiont] (length=447 residues).
QSRLVATGDYAPSILSPWRAAKEAKREELDSELEIAQLAKRYGPKHPKMIAAKAAHQARISRMKKEVDIVLNNIDKEFER
AQWLEKKLQKQFDDLKLQAQAIDSKQSEYRALERNLEADQKLYDTFLTRFKETNISSGNNTPNARIIDEARVPGGHYWPN
LERIVAIATLAGLFLGLLLAFLLDYINDTLKNSQDVEEKIGIATLGNLQVLKSDKSNLSPERMYIDDQKSLFSESIRTIR
TGVLLTSLDSPDKVVAVTSSVPGEGKTTVSINLAVALGQLEKVLLIDADMRRASLGPHFGIEKNTPGLSDLLAGTEEEAK
CIIHNEDAGIYILPAGMIPPNPQELLSSQRFSEALQKLASHYDRVIIDTAPTQLVSDAILVANQASGVIYVIKAESTPYH
LVKEGVKRLRQVDSHIIGGVLNQMSQGASGYGGYYKYGKYRNYDYTY
>gnl|bykdb|A0A1T4TW59 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Enterovibrio nigricans DSM 22720] (length=668 residues).
MHLILIKKYYQTQFEILRSSHIAESVIDELGLANLPEFNSLVGKPSARDQLLTLLRQIDGLDGFLPKPIAPSTDPNSEVA
KRAVLKKFKSHFAIEPIRYTQLVRIHFDSANPELAAKVANAVGNAYIESNLEARLLATQTASTWLTERLAVLEDSLEAAE
FALTDFLRQEGLIELDDIDELAGTELTNLTIRVSEAKERRVAAEAIYSLLQSSGSSAASLLSVPEISNHPQVRDVKSAEI
DAERKVSELAKRYGPKHDKMIQARAQLDAVRARSRAVIRELGIGIGIQKELDNAIKQEAALVADLENKKGDYQNITGKRA
QYDALKRDVDSNRQLYEMFLNRQKETTATSDFESLNARFTDKAKSPQDPFRPQTTKLIVISAAFALLIAIMGAFLADAYR
NTIEKPDDVEEKLGLQQLGFLPRVKVKRFKQTPIDHTLYLDPDAALFSESVRTIRTSILLTLANSHRKVLSVTSSLPSEG
KTTVALNLAQSLATMERTLLIDCDLRVPAIGQRYGLPRNQAGLTNILVMGASHTECIYHDEDSSLDILPAGLLPPNPQEL
LSSPKFAALLNQLKQSYDRIVLDTPPVQIVSDSLILGKLAGGMILVVKAESTTEKQINQTVGQLVRHDITIDGVVLNQLS
SKYAEEKYKLHYGYYNNNKQNDETLEAS
>gnl|bykdb|A0A1U7D3R6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Salipiger profundus] (length=415 residues).
MTAERTRSESASDAQEAARVAAARRAERAREAMAQRKAEEARLAEEQRQAAAQREAERLRLEQTRAAEEAEAARRAEDAE
RARLADEARRQQEAEHRAQEQREAEARAAEAARKAEQLRLAEAAREAEIARATEKANRDAEAAASEARQIDEARQALRAQ
RAARRVAPADDADVDDRWARLGSFPVDPAHLQRHRIVTALREDPAHAAFDVLRTRLLQALADNGWKRVAITSPTKDCGKT
FTAANLAISLSRQQNCRTLLLDCDMRRPSLHKVMGLRDPGSMGDMLRGGIPPEDHFQRIAENRIHAGDTIAFGFNGAVEP
YASELLQSPETARTLQRIEDRFAPDVMLFDLPPALYYDDVIAFRPLFDGVLLVVGGGLTTEKEVREVERRLGESTPLLGT
VLNRAEGTSLKKYSY
>gnl|bykdb|A0A1V0RR48 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Roseovarius mucosus] (length=254 residues).
MAALETPADSRPAALLWPALRRVVLDPKHLAKHRLISATREDPAHVAFDVLRTKLLAALRAHGWHRVAITSPTPDCGKSF
VAANLAISLSRQSSVRTVLMDMDLRRPSLAQTLGQPDPGRMAGFLSGDIPLQRFLTCPEDNLLNIGQTLAMGLNDRAEPY
AAEILHAPETGEVLQDMYHHLAPDVVIFDMPPALYYDDVLGFRPQFDGVLIVVGGGRTTAQHIRDVKARFGSDTPLLGVV
MNRAEGESIAKYGY
>gnl|bykdb|A0A1V1PDB4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Candidatus Magnetoglobus multicellularis str. Araruama] (length=367 residues).
MELNQKSIQYGVLQREAESARHMYELLIKRFKETSLTEDMKTGNVRVVDPAEVPKSPIRPRKRLNIFLGIVFGLFVGIAV
AFAFEFLDNTLKSPEDIRNFLNIPYLGPVPTFDLERDNTDNPELITQYSPKSTASESYRGIRTSLLFSSADKVPQIILVT
SAGPSEGKTLTSTNLAITMAQAGSRVVIVDCDMRKPKVHKMFGFSRDKGMSSVLVSSELESVLQDVVIHSDIPNLDVIPC
GPIPPNPSEIIGSQKMSRIMQELQKQYDRIIVDSPPITAVTDSTVLAKFVDGVMLVVHAGVTPRQVVKTGLDQLQGVEAN
VLGAVLNDVDTGKESYYYYQYYYYYYGEDGEKKHRSRRKKRSSKRYG
>gnl|bykdb|A0A1V1UJT2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Roseovarius sp. A-2] (length=338 residues).
MNLSRHDAYMRRREARRAAEEAGEMPEPVYEESCGESAIEEIADEFALPLDPGMRADPEEALAVTPESQDVPEPEPEPEP
EPEPEPEPEPEPEPEPEPASWETLRRVTLDRRHLMRNRLISATRENPAHVAFDVLRTRLVATLREKGWRRVAITSPTPDC
GKSFVASNLAISLSRQSALRTILMDLDMRRPSLAQNFGIADPGSMERFLIGDVPMEDHFVRPQGNDMHIGTDLALGLNDQ
AESYAAELLQAPKTAEVLAELYARLNPDVVIFDMPPALFYDDVLGFRPQFDGVLLIIGGGHSKAKDVRDVEARFGAETPL
LGVVMNRAEGENITNYGY
>gnl|bykdb|A0A1V2FV46 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=226 residues).
QLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLLIDCDMRKGYTHELL
GTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVSWASKNYDLVLIDTPPILAVTDAAI
VGRHAGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A1V3SCT6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Hydrogenophaga sp. A37] (length=286 residues).
MERIKLAIEKAKAAEADSARPDVPLLRKVSDSETPAGESSSAIRREASPGDASSVHYTQTAVVSMDAAHLERHRVVSHQK
THSASWAFDVLRTQVLQKMDENGWRTLAITSPSVESGKTVVAINLAMSIAQQTNRTALLVDFDLRRPSVARYLGLNRSLS
LNDFLDGRVNIEEALVNPGVERFVVLPTNHLVTGASEVLSSAKVGNLIGDLRERYSDRIVIFDLPPVLAADDVMTVLPRI
DCVLMVVGSGASTQNEVEEAMGRLSKANLLGVVLNKDEAPVQNAYY
>gnl|bykdb|A0A1V4CIZ7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Hydrogenophaga sp. H7] (length=252 residues).
MPVDQETTARDGDTPDDLGSVQYAQTAVVPMDPAHLERHRVVAHQKAHPASWAFDVLRTQVLQKMDESGWRTLAVTSPSV
ESGKTVVAINLAISIAQQTNRTALLVDFDLRRPSVARSLGLNRPKSLNDFLDGHASLAEALVNPGIERFVVLPTNRPVNS
ASELLSSAKVGKLIKDLRERYSDRIVIFDLPPVLAADDVMSVLPRIDCVLMVVGSGVSTQTEVEEAMNRLSKANMLGVIL
NKDESPTQNAYY
>gnl|bykdb|A0A1V4M8I1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][delta proteobacterium ML8_D] (length=283 residues).
MGKIADALKKAGKEQVPIRHDRGVKPVYQDRILSGTDVHTGKEPGSTPRVLQGPVDPKLVVFRDPKSPASENFKVLRSQI
LYPRDGIRRRVILVTSAMEGAGKTTVACNLSVSIAQSVDPYVLLIDADIRRSSVCGMLGLDSGEGLSEYLKGNESLSKYL
IRTPMTKLTVLPAGRSVTNPAELLTSAKMRQLFAEARERYSDRFIIVDSPPVNLAAETLSLSQNVDAVVFVVRYGFSDKD
LIEEAIAKVGEDRILGIVFNCFESPPGRYSYYKKRYPYYSSKL
>gnl|bykdb|A0A1V4MCJ4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][delta proteobacterium ML8_D] (length=272 residues).
MGKISDALDKYQSEKKEYFYRKSSLSDQPIRAEEREIVSSQDLVQDRGFSDKLLIFTSPHSITAEAFKIIRGSVLYDKNR
TTPKAIMVTSAFPGEGKTFVASNLAISFAMGLNENVLLIDCDLRRPSMHEMFGIKNLYGLADYLQEKKGIPEILIKTNIK
KLTLLLAGIQPSNPVELLSSKKMEDFIHEAKNRYHDRFIILDAAPSQLTAETNTVANHVDGIIFVVMNGRTPRAAILQTI
ENIGREKILGIVFNGSSMSYKEYNKYYKKYYQ
>gnl|bykdb|A0A1V4QMH7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobacca sp. 4484_104] (length=302 residues).
MGFIDKALEKAKTVKPTTEESQIHPVPKVTPVESHSLFTGMEMPVEEIQYHVTRSVPVKADWLRRQRIITEADDDVVKEA
FKVLRTHIVQRTRPANQNVLMITGPLPGEGKTLTAINLAISLAQEVDKTVLLVDADLRRPMVHEYFGIPRGPGLVDYLNG
SLPIHELLVHPEGFPKFVILPGGRPIGEAAELIGSPMMAELVKELKHFYPDRYVLFDVPPLLSYADSLAFAPLVDGIILV
VEIGKTTREDIQSCMKMLKEFPLLGSVLNKVDKEHTSCYYCQRPSSNDSPAVQKRFRDWLGL
>gnl|bykdb|A0A1V4S7E4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobacteraceae bacterium 4484_190.1] (length=279 residues).
MGKIFNALERHKKESSIMTEYLVNKHSEGLIPHKDELALARKITRESNYNHKLVTLSAPGSVDAENFKLLRAKILFPKNG
SRPRTMMITSAFPGEGKTFIAANLAVSIALGINEHVLLVDCDLRRPSLHNILGYSNREGLHEYLTGKKQLADLIIRTKVE
KLSFLTAGSSPSNPSELLSSAMMKDFISKTAGGSQDRFVIIDAPPAQIMSETSVLSNYVDGIIFVIMAGMAPRQTIQKTL
ETLGNKKVLGIVLNGYTKSYKSYHKYYGNYYSSKQEALT
>gnl|bykdb|A0A1V4WHZ7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Syntrophorhabdus sp. PtaB.Bin027] (length=411 residues).
MVNAIKNDYAIARAKENSARSAVEGQKAEAQKLSEHSIQYGVFLREVEKNRELYENLLKRLKETSVEHEFGATNIKIIDS
ATAPIHPAKPKKARNILLSFVVGLFMGVGLAFFLEYLDNTVKSPEDVKEHFNAPNLAIIPSIDFKAEAGEAVSSPELIVH
HKPKSIAAEAFRSLRTAILFSFPENPPKSFVVTSFMPQEGKSFIAVNTALIMASAGDRVLLIDADLRRPMIHNLLKVNNE
RGLTNMIVGGGGARPLDLNERLSVIPSGPIPPNPSELLGSQNFLELMEGLKWEYDKVVIDAPPINSVTDALVVSKSLESG
VIFVIKAGVTTKEMVRDAKGMLDGINARILGGVLNNVRMNSSGYYHYSSYHYYHKYYGDEDKANGDGKKKRGLWAVTKAV
TAAGMGRKTVD
>gnl|bykdb|A0A1V4Y2C3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Syntrophus sp. PtaB.Bin138] (length=298 residues).
MGKMYEALQKVEREKFGEPTDKTLKTTPDELVLDDKLVSFFAPSSMVAEQFRRLRAQIIKPGLNHTPKTILVTSTMAGEG
KSLIAINLAITIAIDLHSHALLVDCDLRNPTLSRFFGLQSERGLSDYLLGEEDISDLLIKTSVDKLTILSGGNSQENPVE
LIGSNRMKAFVQDMTSRYDDRYIILDSSPLLATTEPSLLGEMVDGIILVVKSGETPRESIQQALKLVKKEKILGVVLNST
EFKTQALIQRYFGTNRYYYDYHYNRKNPEPTSWEKVKAAAGDLKAMLGRLAPRKRQDH
>gnl|bykdb|A0A1V5DJV0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Smithella sp. PtaU1.Bin162] (length=385 residues).
MMQQLPVAERELAQLMRHTKVNSELYTFLLQKREEARIAKTSTINNINIIDPAITPLTPVKPQKTQYLLLGLLAGIIFGG
GLAFVQEYLDDTIKDAEGARRELNAPILAIIPHIPRKEGISDSDRSISLVTDLEPRSSASEAFRSLRTSIHFSVINREKK
IILMTSTFPGEGKTTILSNLAVTMAQAGARVLLMDCDMRRPKQHEIFNSLKAPGITEVLAGDASLETALRATGIAGLDLA
AAGTTPPNPAELLGSDKMADLLETLKARYDNILIDAPPILAVTDAPLLTARSDLVIVVMETERVPVKAAQRMAELLGSVR
APVAGLIINDKSGRTRERYGYYGGKYHRHGYGYGFGYGYSYYSDDRKKPRKKAPWWRRILRRFFN
>gnl|bykdb|A0A1V5EEP4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Syntrophaceae bacterium PtaU1.Bin231] (length=342 residues).
MGKLYKALEKAEKERIGGQALKVPKEEPLPEIPEPRFASAAAPVSITVPDEAEITAAKVPEPQPLKTPAPISIPLPDEVV
FPDFDEKLVAYREPGSVVSEQFRKLRTQLLTLNLPGQPKTIMVTSASEGEGKTLVSTNLATVLAHDLHSYALLVDADLRN
PALSRWFGLNNGRGLSDYLTENAEIPDLLLKTKIAKLSVLSSGTVRDNPVELIGSKRMEALVRELKSRYSDRYIIFDSSP
LLATTEPSVLTKLVDGIILVVRAGSTPRESVKQALTTIDPSKILGIVLNDLALESKELNARYFGSSRYYYRYGYGESKEH
GEEATVTNKIVKTVSQFFRKDR
>gnl|bykdb|A0A1V5EF48 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Syntrophaceae bacterium PtaU1.Bin231] (length=342 residues).
MGKLYKALEKAEKERSQAKGVEAVQEETIAQSPEPKFAGAAAPVSIAMPEEVEAPPAKAPDPQPARVAPPIPLPVPDEVV
FPDFDEKLVAYREPGSVVSEQFRKLRTQLLTLNLPGQPKTIMVTSASEGEGKTLVSTNLATILAHDLHSYALLVDADLRN
PALSRWFGLTNGRGLSDYLTGGADIPQLLLKTRIAKLSVLSSGTVRDNPVELIGSKRMEALVNELRSRYSDRYIIFDSSP
LLATTEPSVLTKLVDGIILVVRAGSTPRETVKQALTTIDPSKILGVVLNDLALESKELNSRYFGSSRYYYRYGYGESKER
GDEATMTDRIVKNVLRLFRKDS
>gnl|bykdb|A0A1V6ESG1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Alphaproteobacteria bacterium ADurb.Bin100] (length=495 residues).
MINQTFTDYSAALSKAEQERVKAESQYREMERSPENSAQVLENKTVQTIKEQKAKLEAEYLVNLGTYKPDFPKMLQTKAQ
IAELDLRIKAEIAAVLASVKSQYDAAKRQEDLVRMRLQETRKEVIQTQDKGVDLSLLKRELDTNRQIYDNLLQRLKEVGV
TSGVAANNISVVDEAKAPLFPFKPDMRTNAMIGLAVGLMLALGLVYLREHMDDSIKHADELEAQFGVPLLGIIPKVKKAK
RVEHELALLTVDDPRGSFAEAYRSMRTALQFSTSEGAPHRLMVTSSVASEGKSTTALALAINFAQLGKRVLLIDADMRNP
SLHKSLELSNDRGLSNYLSGEGTRVSLIRPCSVANLKVMTAGPTPPSPVDLLMGPKLMGLLDKAQELGFEQVVIDAPPIL
GIADALVLGNQIQSLLFVVKAGATRRSAIRDALRRLRTAGLLPLGLVLTRATSEHSSYYGYEGYYGYGNAQAAGAAGEAS
VAAQGAAGRLDRKPG
>gnl|bykdb|A0A1V6FYJ1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Deltaproteobacteria bacterium ADurb.Bin072] (length=255 residues).
MHILKALEKQDHEFLKEGGVKGPLDDHLYMHHMPYSYTAEQIRKLRTYIFHMPENRPVPRVIMVTSALPGEGKSTLASNL
AIAIAKGEDQQVLLVDCDLRKPSLHELFKYPHSKGVSEILQGRADIDECLISTPIDKLTILPAAKEPPANPSELLESRKT
GALIQELARREGDWFIVIDTPPIHATVDPKILSNVVDGIVMVVRYRYTRETEFKMAFETLPREKIIGTVLNAVDELPVKK
YTYNKYRYYKNYYNR
>gnl|bykdb|A0A1V8MBH1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Methyloprofundus sedimenti] (length=242 residues).
MKASEESLVINYTQTKTHEINHELLRERRVVSLEKYGAEAETFKLLRTKVLKQLRVNNWNSVGITGPTQGVGKTMVSVNL
AIAMAREVNQTVLLVDLDLRVPRIQWYFDVEVEKGLSDCLMQNIPISEVLINPSIERLVILPGRGRSESSSELLSGPLMR
QIVEEIKQRYQSRIIIFDLPPILASDDVLACMDFFDAALLVVAEGESKPEDVTKSLHMLSGSNLLGMVLNKAENIPDHIG
YY
>gnl|bykdb|A0A1W1XQZ5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfacinum hydrothermale DSM 13146] (length=276 residues).
MGKIYEALERAKRSPKQDVPSPQRVVTPSLPKSTGGLVVLEEPGSPTAECFRFLRSVLVRPMEGDPPRTILVTSPLVGDG
KTYVASNLSAAISQGLDEWVLLMDCDLRYPRLDRIFGLNSSHQGLSTYLTNDTPLDQLLKKTAVHKLTLLPGGNSTRQPT
ELLTSEKMLRLIREVRDRYEDRFVVMDSTPLELAPETFVIANEVDAVILVVRRGRTPRNAVRNAVNRIRRDKLLGVVFND
YDKSSKVYRKYEYTRVFGEHEGEEQSTTGGGEKADQ
>gnl|bykdb|A0A1W1ZH10 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhizobium sp. RU36D] (length=338 residues).
TQYQTLLQRLRELDTKAQLQLADSRVVNAALVPAQPSFPNRKLMFFVSVAFALVLGGAIAVLREHFVGGFTSEEQIEPVL
RAKLATVIPKQTPDANLTTYSVADLVITSPLSVFSESIRRIRVGVERLLFEKTAQAAGQDRRECVVVLVSSSEPNEGKST
VSLALSRTLAKSGKKTLLIDCDFRKPSINSLLGVERSSWFADLLQGTEAAQSVSKQTIADPLSDLSVIVGDRVTDMATDD
LVMGERFSQIISAARRHFEYIVIDTPPVGPVVDALYLSRHADFIVFVVRWASTSQTLVRKSLTALIENAPKGTPAMVAMN
QKENTRNESSYRYSGYVR
>gnl|bykdb|A0A1W1ZQK0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobacterium vacuolatum DSM 3385] (length=315 residues).
MGKFFTALQKSKTPIHERDKKDKVRLVSTQSQKKVEKKTSASLLNPVAPTQLDDDSFIEKKSAFPVQGNVKSAMGDLTES
SPPSWKETSPGILEIRDPHISLIAYNKPHSPEAEQFRMLKTAILFPDKGEPPRTIMITSSTSGEGKSFVAANLAVSMANS
IDEYVLLMDCDLRRPTIHKIFGLPDNTPGLSEYLTQGVPLSHVLKKIMLNKLTILPCGAPPPNPSELISSEQMKKMLKEV
KSRYQDRYIIIDAPPPHLTAEANALARQVDAIIIVVKIGYSKKNALKDLVDAYGKEKILGVVKNYADKTNKYTYE
>gnl|bykdb|A0A1W2FF24 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhizobium sp. RU36D] (length=338 residues).
TQYQTLLQRLRELDTKAQLQLADSRVVNAALVPAQPSFPNRKLMFFVSVAFALVLGGAIAVLREHFVGGFTSEEQIEPVL
RAKLATVIPKQAVDANLTTHSVADLVVTSPLSVFSESIRRIRVGVERLLFEKTAQATGQDRRECVVVLVSSSEPNEGKST
VSLALSRTLAKSGKKTLLIDCDFRKPSINSLLGVERSSWFADLLQGTEAAQSVSKQTIADPLSDLSVIVGDRVTDMATDD
LVMGERFSQIISAARRHFEYIVIDTPPVGPVVDALYLARHADFIVFVVRWASTSQTLVRKSLTALIENAPKGTPAMVAMN
QKENTRNDSSYRYSGYSH
>gnl|bykdb|A0A1W7QPT7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Geobacter pelophilus] (length=281 residues).
MSRIEEAMEKAARMRQGMDQSPPASARQPMESPVLPPLPPRVPAISPQYGRLEPQNPFLVNLHDPHSAAAEEYRKLKSAL
VKMTTGEVFRNCLMVTSSIPSEGKSLTALNLALSLAQELDHTVLLVDADLRRPSVHRYLNVEQGVGLSELLTGEAQVGET
IIPTGIGKLSIIRAGRAIENPAELFTSQRGKALLTELKLRYPDRYIILDTPPVLPFAEARSLAHLVDGVLFVVMERLVSQ
ENLKDALESLKACPILGMVYNAATVDHNDGRYSYYRSAENQ
>gnl|bykdb|A0A1W9F5M9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Serratia nematodiphila DZ0503SBS1] (length=206 residues).
MHFAMLEAKNNVLMVCGASPNIGKTFVSINLAAVIAQAGQRVLVIDADMRKGYSHSLLNTDWHNGLSDILSAQTTMANSV
RKTEIENLDFIPRGQIPPNPSELLMGARFNELIDWASKNYDIVMIDTPPILAVTDAAIIGHRAGTSLMIARFASNTVKEI
EVSIRRFNQNGIDVKGVILNAVEKRASSYYGDYGYYQYEYRSNDKA
>gnl|bykdb|A0A1W9HS52 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Proteobacteria bacterium SG_bin7] (length=832 residues).
MNDRGRTSRALAHSGFDNGDYIFINPRQVVRVLKANKNFIIMCTLSALLLAFLHQSFLYVPIFVSESKLKVEPKSDSMSI
TPLLERFQQNEQLFTRTSAVLEEVQSEPFLNLVVANYLKEGNKISFIVPAERVRGLILFIKAALKKGAKLEDIQKHRDWI
ELRGYFRAAIESFANFETGIITIRIRTRHKDTSFNLAHVASEALVDRNFERLKEKVYRLKDFVGRQTSERKKILEDLEQH
RVELQRKHEVGNTQEYRREVYQRYGDVQSRLTEIERAVEINRHMEKHTESELKKIKENIVNPQLSSSELFLSQNQHRMEL
LQYQKALLENDTSPDSKTRKDEIQSELDTVAQNLQKAIQEADQSGNLTFVSPQEYYKNLENTLVKLKEESRKLETEKSTL
NARLKADKSEISKIPHILQEFEALQRQISVSSDLYLGLQQKLQEIEIMDAGISNDVQIITAATQSSSPIGLPFGTRLFTS
GLVGLFMGLIILVLKNTFIHTVRNYREMQEEGITVIGEVPILPGLNPPIASFLGKNFDRMIGQNLGSITDKMARLAPGMI
KHIQKVAPNIISNQIEKVIPHLSKIQNQLGLKPRDKVCELVVIDKPNSNEADIFRYMRLRLNAFVEQNLKNIPKEKGKVI
MITSPTESLGKTFISTNLAASFGKGEIKTLLVDLDLRNSSVSRTYPDFKGVPGVETAVKTKTSFEDYVISVSKYFDVLLC
RSGLENPTDVLESLALRDFIEKMRDKYDYIFLDTAPALVVCDPSLIAPIADLILMVAGFEITFREDIALAIEGLNAGKAH
PIVGILNLVDSGFDRYGYGYGSGYGNYGKKAG
>gnl|bykdb|A0A1W9J9F8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Proteobacteria bacterium ST_bin12] (length=287 residues).
MEKIKDALAKAKIENTESKSQFKAETKASSTLLQSGVVSQKEIKSFPNTENELGMINYLNTPVIKLDSAHLEKNRIVAQS
KSDVNSYSFDSLRTQILQKMEENNWRTIAVVSPTPQSGKTLVSINLAISIAQQPQKTAILVDFDLRRPKVAAYLGIHTEK
SMNDYLQDKAQLKDVMINPGIDRLVIVPTMKPVSKSAETLSSKKVTSLIADLRERYNSRIVIFDCPPVLNSDDAMVLLPQ
VDCVLLVIANGMSTQSEIEETLHHLPKENLLGIVLNKAEIESKAYYY
>gnl|bykdb|A0A1W9LJP0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobacteraceae bacterium IS3] (length=645 residues).
MSKNWFAEPLRFWKEKLLSLRNTGKPEDKDKKDEDADAWLVNALIGRIKAEPVRNSRLVNVRVEAKDPALAAKIANAVVQ
AYIDQNLETKLTAAKDAVKWLIDQMDEERKKVEISENALLNYKEMQGIITNFSNDAENITAEKLAKLNAQVVESESQRVE
AETRYRQALAAQNSPDMLDSISQVLNNPLVQDIKKMEVELYNRMSELSKKYGAKHPQITAITSELATLQERKMGEAKRVV
SSLRNEYNLALAREQSLKQALNRQKTESLDMNKKAIRYGVLQRDAESSRNMYELLVKRFKEASLTEEMKTGNIRIIDRAE
VPKAPVSPNKTRNILLGAVLGLMLGIGMVFALEYFDNTFKFPEEIKNHLDIPYLGPVPVFDTEEGAEGAVGDLITVKDTK
AMASESFRGIRTGILFSSVDTPPKVILVTSAAPSEGKTICIVNLAVTMAQDGSKVIILDCDMRRPRVHHVFQLPKDKGMS
GLIAGKNKLDDVIFSTGIENLDVIPSGPVPPNPAEIIGSKKMTELLDELKTRYDKILIDSPPITAVTDSLLLARMSDGVV
LIIKTGLTARQMVKNALEQIESVKAKVLGAVLNAIKADKDSYYYYQYYYYYYGEDGARKKKRHNKKKRSGVYGRKPEIAP
SESQL
>gnl|bykdb|A0A1W9M770 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobulbaceae bacterium A2] (length=294 residues).
MFGSKNTTTAPNDAGAQGAPAGPRPLEQTHARQPVPPSFPSPHATTGGKQGREPRGENWDERLKVIHNDFNPLSEYFRTL
RTRILHPASGRPPRSLLITSATPGEGKSFVCANLGISIAQGLEQYALMVDCDLRRPALGQLFGLPSDHGLADHLARGTDL
ASLIQQTGVRKLTIIPAGQPPNNPSELLDSERMDGLVNELVDRYQDRLILLDSPPLQAAAETAILAQQVDGVVLVARWGM
GRREYIQSLVDIVGKEKIVGVVFNGVRTTAIDRKIFGYTDYQTNYYYSKKKKSA
>gnl|bykdb|A0A1W9M7R6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobulbaceae bacterium A2] (length=266 residues).
MPLRTPVPPSFSSPNPTTGGPQGNEQRPRNWDERLNIIQGDFNPLSEYFRTLRTRILHPASGPPPRSLLITSTTPAEGKS
FVCANLGISIAQGVEQYALMVDCDLRRPTLGQLFGLPCDHGLSDHLARGVDLASLIQKTEVRKLSIIPAGHPPDNPSELL
DSDRMTGLVDELVARYHDRLILLDSPPLQAAAETAILAQQVDGVVLVVRWGAGRREYIKTLIDIVGKEKIVGVVFNAVRT
TAIDRTLFGDTDYQSNSYYYKKNKPS
>gnl|bykdb|A0A1W9PMU6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Helicobacteraceae bacterium 4484_230] (length=329 residues).
MKNLLASCQPRSVSLPTLRENPKRAETAILSSSTVSKTRIIDEALLPTRPIKPKRVLIIIVGFVLGFIVGIALAFLRELL
DDTVKSAEEIERLTNIPLYGTIPLIKGKKFTSAFLESFRVLRTNLEFIPMGKRYQTIVVTSSVSGEGKTTITTNLGIILG
KGDKKVIILDLDLRRAQLSHHFGLSNRIGLSTLLSGKHSLDEVIQRTDEKGLSIIAAGPTPPNPSELIMSAKAEELVEKL
RKVYDYIIFDTPPAGLVTDAMILMNKADVSLMVVKANYSKKDFIKGLNRMIGDFNIKHVGIVINGVDLGGSYGHGYGYGG
YGSEKYYTD
>gnl|bykdb|A0A1W9U045 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobacteraceae bacterium 4572_187] (length=282 residues).
MGKIFDALEKANKENNVSASTEKASRFKVYDRKVMEKEASGAIKTVLGNKGIDKNMVSLLEPQSFEAEQFKHLRTNILFP
ISGKPPRLIMVTSALPDEGKSFVSANLAVSIAQNINEHVLLIDCDVRCPSIHKSFGFGDMPGLSEYLNKDTPLSSLLLKT
EINKLTILPGGIPPQNPAELMSSNQMAELLKELKSRYSDRYIIVDSPPPNLTSETNVIARQVDGILLVVKAGSTRREIVG
DLIEMMGKEKVLGVVMNWFDMSSATGYGHEKYPQHGKYYGKS
>gnl|bykdb|A0A1W9WUD9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobacteraceae bacterium 4572_88] (length=326 residues).
MKTGNIRVIDKAEIPTVPISPNKKRMVLISMILGIALGIGFAFVLEYLDNTIRFPEEISDYLGIPYMGLVPAFDTDEVLD
GMPVELIALHSPKAAASESFRGIRTSILFSSAKPGSQVILVTSAMPSEGKTLCSANIAIAMAQAGSRVLLLDCDMRCPTI
HKTFQIGRHVGLSSVMFGRSKLKDAIIPTQIPNLDVIPCGPIPPNPSEILGSKKMRSLIDELRRKYTKIIIDSSPISAVT
DSIVLTQISDSIVLVIRASSTPRQLVKNTVDQLKNINAYILGSVLNAVKPRGNSYYHYQYNYQYGHARNNGHKKKNRKSH
QRSWHF
>gnl|bykdb|A0A1X0YE57 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Geothermobacter sp. EPR-M] (length=269 residues).
MSRIDRAIEIAADIQARRVPESAGSRVAAERTADRVGCYPVVAPIQVESEWLVALHQPNGVVAEEYKKLMTQILQTMSEG
ACRNSLLITSSVTGEGKSLTAANLALSLARQLDHSVLLIDADLRRPHLHEVFGIRQSPGLVECLAGEADLAEAMVHTGLG
KLAILPAGTPSANPQELISSHQMKAFVEEIKQRYRDRYVVFDSPPVLPFADATILGPLVDGVLYVVREKVANIVEVREGL
EQLRGSQILGTVYNCAASLKRPGYGGYGY
>gnl|bykdb|A0A1X3IPU7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli E1114] (length=223 residues).
MDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRHGYSHNLFTVSN
AHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDHYDLVIVDTPPMLAVSDAAVVGRS
VGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGYSYSEKE
>gnl|bykdb|A0A1X4NLK2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Marivita geojedonensis] (length=379 residues).
MTEQPKFQRRKRRGANTAAEQAQPVAVNAPDSRVAELEALLAEKEALLQRQAELEAERLQEVARKKDAERAERLESERKL
AAELESRKQREAELEAERAREVRQEAKRQAAKTTEPKTPLVLATAPKPHVAPEPVFDPESVWHELDRFELDAKRLAQRNV
VTALRQDPAHTRFDILRTRMLQALSENGWKRVAITSPTKDCGKTFTTANLAISLSRQENCRAVVLDLDMRSPSLHKVFGV
TDTGSIGDMLRGEIAVEHHLQGFAPNSISAGSHVAFGFNGVVEPYAAELLQDPSTKTALHEIEDRFQPDVMLFDLPPALL
NDDVIAMRPHIDALLIVAAGGATKASEIKETERRLGEKIPLLGVILNKAEHTEQSDYAY
>gnl|bykdb|A0A1X4NWB5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Marivita cryptomonadis] (length=391 residues).
MTEQPKFQRRKRREEASADVQPKRTPERNDTPTLDEIDALIAEKEALLRQRAELEALRKKEAARDAERVRAAEEAEEQAR
KEKAARDAELKAQRAAEREARLEAELVAKREAELETQRKGDVEQTAKLTSPLVLTSQPDAAPGKTEVFDREAAWNAIDRF
PLDPQRLADRNVITALRQDPSHTRFDILRTRMLQALSENGWTRVAITSPTKDCGKTFTAANLAISLSRQENCRTVLLDLD
MRSPSLHKIFGVTDTGAVGDMLRGQIAPEVHLQGFAPNTISAGSHVAIGFNGIVEPYAAELLQDPKTQAVLDDIEAKFQP
SVMLFDLPPALLNDDVIAMLPHIDALLIVAAGGMTRAKEIKETERRLGDKVPLLGVVLNKAEHVETGDYPY
>gnl|bykdb|A0A1X6YIC0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Roseivivax jejudonensis] (length=367 residues).
MADRPKFRRRRGRTPERTEDDDLRPVPPLETRAERLERREAERRTDDRREFDRGETDRRTAERRAADPDPAPAVAKAPEA
ASPGAIETPAPSTADAAHAPAHATTRAVAHDAQDTARQTLPAADDPERLWASMPSFAVDDRALERNRIISASRSDPAHVS
FDVLRTRILRALSDRQWRRVAVTSPTPGCGKTFTLANLAISLSRQADLRSVVLDLDMRRPELHRVFGIKSPKSIGDMLRG
KTLPEQHLLRLGPNDFHAGRSIAFGFNGTPEPFAAELLQDPKTAIALDMIEARLKPDVMLFDLPPALSGDDVLALRPHFD
AVLLVVGGGVSAQSDVREAEQRLGADTPLLGVVLNRAEGINEKKYAY
>gnl|bykdb|A0A1X6Z7N7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Roseovarius gaetbuli] (length=395 residues).
MKLSRYEAYMRRRAARRDALESPHSHSPDQVDALSLDAEAATQEADEAPFALRPEMIAPPLDQEPLAPEADGQQLPEPEP
EPEPEPEPEPEPEPEPEPEPEPEPTDTDMLDIEDAPFVEEAREDESEVIVVPVPEVTLTNDPAEDAADEAPAPLPLLWPN
LRSVPLDARHLTRNRLISATREDPAHVAFDVLRTKLLAVLRAKGWHRVAITSPTPDCGKSFVAANLAISLSRQTSVHTVL
MDLDMRRPSLACTLGLSAPGPIASFLTGDTSLEQQFVRPAENALNIGENLAFGLNDRVETYAAELLQAPRTGEVLDNLYA
RLRPDVVLFDMPPALYYDDVLGFRPQFDGVLLVIGGGRSTAQEVRDVKRRFGAETPLLGVVMNRAEDGDIAKYGY
>gnl|bykdb|A0A1X7ACC1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Ruegeria meonggei] (length=273 residues).
MDRLQQAIQKARVERASRQQEPPDRTAPEPQPIPIQKDEVWSSLPEIELDQRTAARQRLISYSGGTEAAPYDMLRTKVLQ
QVTANGWRRVALTSPYSDSGKSTSTANLAFSLGRQAELRTVVLDFDLRRMGLAKILKQTGQYNMADVIQGTVPFHEHAVR
HGENVIFGLNHAPTRNPSEVLQGRQVIELLEQIETVYQPDVILFDTPPLMSSDDSHGFLKNVDCALLLVVAEKTTLDRID
LAERQLAELTSVMGIVLNKCRYSSGAFGYEYGY
>gnl|bykdb|A0A1Y1Q9C1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Thiothrix lacustris] (length=680 residues).
EGMQVVNFGTVSSASPDMGEQDPFFRTQYEQLKSRKLAAQVIDGLDLKTRLFERPAPFSVLSSFKVIIKGLIAPLLPAKI
ETVTEAADYTDLFSQHLYVEPIEKTHLVKVFYESPDPVLSADIVNALVNAFIKDNISSQSETDTYAKEFLEQEMEKARQR
LTLQEAKLIEYAKQNNILEVNNSQSSQERKLDELYSALGEAERARIQAESQMIQGRKRTNAHAVLNSPVVESLKQNLATL
EAEYREKLKLFKPAFPDMVSLQGRIDEVRGQLNREMSSLRQSLQTEDATIRQADYISARKLEDDLRAEVESYKGELVDLR
DRSIEYNALKREVETSRNLYDGLLQRMKEVSVASNVTSSNIRVVDAAAPDNEIFRPKKALNVILGGLVGLMLGIGAALLR
ETLNQGVTSVTELQALSGLPILGTIPHVRHLSESNLALATVRDAGSLLAESYRVMTANLRFVLPGGMAPRVTLITSVNPA
EGKSTSAVNIALSQAQQGLKVLLIDADLRRPSVHTKLGLPNARGLSNFLNGEVDIAGVTHPSREVKGLYLIMAGTLISDP
VRMVSSPAMAQLLNLATKHFDSIIIDGPPTAGFADAIYLSSMAEATVIVADEDHINRKRLITVIEQLRRVRQNVVGFLMV
KSQEEKLDSRYKDRYQTHLPSKPAAKTAKNKRKGLNLAQA
>gnl|bykdb|A0A1Y2R3U6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Hydrogenophaga sp. IBVHS1] (length=280 residues).
MERIKEAVEKAKSQRVGLQPPLHVAAVRTAAKPASEVVQESLPGTDADVHYRQTPVVELDPAHLESQRIVAHQKSHPVSW
AFDLLRTQVLQKMDENGWRTLAVTSPTMESGKTVVAINLAIGIAQQTNRTSLLVDFDLRRPRVASSLGLNGRISLNEVLT
GNARVEQAMVNPGIPRFVVLPTLQSMPNSAELLGSSRVAALMGELREHYSDRIVVVDLPPVLAVDDVLAILPRIDCVLMV
VGNGTSTRKEIDEAMSRLSKFQLVGVVLNKDDAPSRNAYY
>gnl|bykdb|A0A1Y5DXG5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Colwellia psychrerythraea] (length=552 residues).
GKVGEEVTNGTFTLTIKELVARAGTEFFVTRKDRLNTILDLQSSIGASEKGKDSGIVNLSFQHESPEYSQMVLNEITEIY
VRRNVDRNSAEAKKSLDFLAVQLPEIKKQLEVSEALFNDYQKNQKSVNISLETQGVLEQIVELDTKLQELDLERLAMSRK
FKRNHPNYQGIVEQISAVQKQRDALAQKIANLPETQQKLLGLTRDVEVGNEIYMMLLGKVQELDIVRAGTVGNVRIIDVA
EVNTTKPVKPKKALIVVMATMLGGMLAIAIVLVQKALHKGVEDPSEIEAIGMPVYASVPFSTHQDKLTGLTKALTKGRKR
KVHQHNSVLAVDNPADLSIEALRSLRTSLHFAMMEAKNNVIAISGPSPGVGKSFISANLGAVLAQSGQKVLVIDADMRKG
YLQKQFGLAWENGLSDYLSGQQTLEQVTKSTNVEGLNIITRGQVPPNPSELLIHSNFSDLIAEIKAKYDIIIIDTPPILA
VTDPAIVGGHAGSVLLVTRFGQNAIKEIDYARQRFEQNGIDVKGVVFNGVVKKASNAYGYYGYYNYEYKSDK
>gnl|bykdb|A0A1Y6DC43 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Methylomagnum ishizawai] (length=249 residues).
MHEITRIQPLGPIRYTRTKTVPVNYDALREHRIVMGTYNEPRADIFRILRTHILRQLRENGWNSLAIASATPAAGKTFVA
VNLAIAMALEANQSVLLVDADFRRPKVAEYLGMTVESGIVDHLESRVALENILVNPGFERLVVLPGREAREGCSELASSP
EMAELIGELKTRYPARMIIFDVPPLFVADDALSLIAQVDGAVLVVEDEENTPGEIQHALHILEQTNLLGLVLNKSRQPSP
RPQISYRDY
>gnl|bykdb|A0A212AR83 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Haematobacter missouriensis] (length=280 residues).
MERLQAAIEKARAQREETRPDTPPPPAFAAQGAQAYADADGTEAAWAALRPLDTTRPAYSRKSSLVAFQPGGVGGAYDIL
RTRLVQQAETNGWRRIAIVSAGAAAGKTTTAANLAFSLSRQSDYRSLVIDFDLRRVSLAKALDQEVPHTMEDVIEGRVPF
SEHALRYGTNVAFALNGKPVPQSAELLQSQRAKNAMAEIEATYKPDFILFDVPPLFTGDDSIGFLRNVDCALIVVAAEET
PMAQIDIAERQVAELTRVMGVVLNKCRMTSDDYSYDYSGY
>gnl|bykdb|A0A222E077 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Antarctobacter heliothermus] (length=459 residues).
MNMMDSPKFRRKRTSATAHPPAAAPASPYAAVKAASQEAAHLRVEADERARAEAETQRIAKAAERAKFEEKARRKAEFEE
RAQTEALRRVKAAREQRAADAMKAREDAERQESARQHREAEEARSRQEAAAKAAQDAEDHRQQVEKRAAEEAARREKAKR
DAEARDADARRTEEDARRKAQPPAPVLPLTDMIPVTRRAEPAPTTAPVTPTPKTIVDVEHAWSGLPELTVDKAHLARNRI
ITATREDPAHGAFDVLRTRLLQTLSENGWRRVAITSPGKDCGKTFTAANLAISLSRQENCRTLLMDLDMRRPSLHHVLGV
GSPGSVGDMLRGMIPPETHLHRMGRNPINAGRNIAFALNDRPEAYASELLQDPRSAETLRAIDEHYAPDVVLFDLPPALF
YDDVIAARPLFDGVLLVVGGGLTTESEISEVERRLGDSMPVLGMVLNKAEGTDISRYTY
>gnl|bykdb|A0A233IKJ2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio sp. V03_P4A6T147] (length=537 residues).
IGNVFMDSHIEDKLQVELKANSWLNNRMGDLREKLKESEVQLQTFLKSEGLVDIQGVESLASQELEELTSQLNKTRDRRV
AAETLYLVAQTYSRQDSDLSALASIPEISNHPTIRDVKLAEVQAERKVSELSKRYGDKHPKLKAAQAELASVKRNLNSEL
KQLLNGINNELQAAKQAESSLHRELEKRKSEFQSLSVKNARYSELKREVQTNRELFDLFLSRQKETSASSDFNATIARFT
DFANPPLAPSKPNRKLIVLLAFVASFGLACVVAFIADAVNDTFLDIKQVEKQLSLSLLGIIPAIKTRGPLTLKTYFDSKH
RELTEAIRTVRTGYLLANTNKEHHVVMVTSSLPEEGKTTSSINLAFSLAQMEKTLLIDCDLRKPSVAHRFGISGSQPGMS
NLLIGTHTIEECLYTDEESGLDVLTSGVVTDNPLELISSPKFASLLEELKTRYSRIVIDTPPCLAVSDAFMLSQYVDSTI
LVINAPQTRTKVARDVVGRLTQQGARIDGVILNKLNTKKASNYSGYHQYQSYYGPEK
>gnl|bykdb|A0A238IZI1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Boseongicola aestuarii] (length=277 residues).
MEKLQAALAKARAQRDGEPISRGGRPELSARAKSRRIAESEAKDSVWSAIPLFEPTARRMQQSRIFSADASNEGTHFDIL
RTKLLLEMRRNNWKRIAITSALAGSGKTTTACNLIAGFGRQPEVRCMLFDVDLRRPSVAKFFGATPESGLVDVFEGNVPF
AEQAVRIHPNTIMSMTNRPLRDPSQLLSKQQTAETLDEIQQTYQPDIMLFDLPPVLVSDETRAFLKLVDAALIVAASDTT
SIAQVDEVEREVSEYTNVAGVILNKCRFMDEGYGYSY
>gnl|bykdb|A0A238J8F6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Tropicibacter phthalicicus] (length=553 residues).
MNEMDNRKFRRKYKSVDATAEQAAEEVLRQEELRAAAAEAKAAAQKAALEAQRREVAKRAAAERARQQAEAEQRAREEAE
KTAAEAKRLAALEAQKMAAEEARQKAFAEERAREAERVKAAEQAEKDRQRVEAEKRRQAEIEAQRQAELAAREKAEAVRR
AEEARQIAEAEEARQKAEAEEARKKADAEKKRLAEEQAALRAEKEARQRAEAEKRAQEREAARKAEEQARREKARLEEAR
KEKERLAAEKAAAEQAKREAEAQRKAQEERAAAEAQRQAQEQARQEQERLAAEKAAQEQRDALAAQQAADAAKTPWDRVP
EFTLNAAHLARNRIITAEREDPAHTAFDVLRTRLLQALSDNGWSRVAITSPTKDCGKTFTAANLAISLSRQENCRTLLLD
CDMRRPSLHSVMGVQNPGSVGEMLRGNVAPEDHLMRLGQNAIHAGRNIAFGFNKAIEPYASELLQDPRTAETLDRIEAEL
EPDVMLFDLPPALYYDDVIAFRPLFDGVLLVVGGGTTTEKEIKEVERRLGETTPLLGMVLNKAENTEISKYRY
>gnl|bykdb|A0A238JQI6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Maliponia aquimaris] (length=515 residues).
MNMMDGPKFRRKHRSAAGKPRPAPESVPETLPETLPESVPKNLPEIAPETAPEPPVPDPEAGARRTAEAQARAEEKARRK
AEFERIAREEALRRVAAARARREAEARQKAEAEAAEKARTEAEDAARKAEEARLAEERRKAEDAARKAEEARLAEERRKV
EDAARKAEEARLAEERRKAEDAARKAQEARQAEERRKAEDAARKAQEARLAEERRKAEDAARKAQEARLADERRKAEAAR
KSETAAAATAAPYRLTGEDAVAPSPSPSPDAPPVDDTWAQLQEITVDAAHLRRNRIVTGDRDDPAHTVFDVLRTRLLQGL
HDNGWKRVAITSPGKDCGKTFTAANLAISLSRQENCRTLLMDFDMRRPNLHKILGIERPGSVGDMLRGQTAPEDHLRRMG
QNPVNAGRNIAFALNDTTEAYASELLQDPRTEETLQRIEQHLAPDVMLFDLPPALFYDDVIAFRPLFDGVLLVIGGGLTT
QKEIAEVERRLGDSTPLLGLVLNKAEGTELERYSY
>gnl|bykdb|A0A238KJM1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pelagimonas varians] (length=419 residues).
MMDDRKFRRKHRSPTETVSVLKSKRESEEEIQARLEAEREAELRRIALERIAARKEREAEKQIATERAQAEAEARKAEDD
TKRLTAEQARLTEEKQVAEAAAAELAEIEAKTRADADRRAEAANRAEVREATRLAEELPETQADELPLAEESRPTAEIPQ
RAQPEQLASPAIATEPNPSNPWDNLTGFTVDIRHLSRNRIVTAEREDPAHIAFDVLRTRLLQALSDNGWNRVAITSPTKD
CGKTFTAANLSISLSRQESIRTLLLDLDMRRPSLHRVIGVEKPGSMGEMLRGNIPPENHLMRLDGNPFNASQHIACGFNG
VIEPNASELLQDPRTAKTLDAIEEQYEPDVMLIDLPPALYYDDVIASRPLFDGVLMVIGGGTTTEKEVKEVERRLGESTP
LLGMVLNKAENTELDRYKY
>gnl|bykdb|A0A238KUF6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Confluentimicrobium lipolyticum] (length=272 residues).
MERLQAAIKQAREMREGTAGRRVRAAQGGFQSASLPTQDAWAALSPLEVKPPKGKRARLVSLEGGADAMPYDMLRTKVLQ
VLHENNWRRIAITSPTAGCGKTTTAANLAISLGRQVDMRTILMDMDMRRPSLKNVFDQTGAHSVPDILEGRVDFAQQARR
LGDNVAVSFNFKHYGDPAGLFLRHTTETIIDQIEATYRPGVMLFDMPPLMANDDTAAFLRNVDCAMIVAEAENTTAAQID
MCERELAAQTNVLGVVLNKCRFPDENYGYAYQ
>gnl|bykdb|A0A238LBD3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Flavimaricola marinus] (length=350 residues).
MNAKYSRRTGRPRLDASERARLLAEIAKLGAPATTELDAQSAALRAALSESVEPPADEPEAAQDAVTPTDREATAAAPIE
QPKAPAEPAEPAAKPAAQPAPPQRAPSPKALNAEWAGLPMLDVSPALLERNLVITAKRTDPAHGAFDVLRTRLVQALAEK
GWRRVAITSPTAGCGKSFTAINLAVTLSRYDQCRTILMDMDLRKPGLARYLGVRNAGSTGDYLRGLTDAPDYFTRLQGER
LNIGTNLALGLNGQVEDFAAELFQQPSTGEVLAEMEDMFAPEVVLFDLPPALAQDDVIAFRPHFDCLLMVVGGGITTAEE
VREAQRRIGEDKPLLGVVLNKAEVEGDYAY
>gnl|bykdb|A0A239E3Y2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Antarctobacter heliothermus] (length=497 residues).
MNMMDSPKFKRKRTSATAPHPAADAASPYAAVKAASQEAARLRAEAEAQRIAKAAEQAKSEEKARRKAEFEERAQVEALR
RVKAAREQRAADALKASEDAERQERERQHREAEEARTRQEATKAAQDAAEIRQQAEKRAAKEAARRARAERDAEDRAASA
LRDAEMAKAKRLADEHQRAAEAEAKRLAEAAQRKADAEARDAEVRRVEEDARRKAQQAPAPVLPLTDMIPVTRRAEPAPD
PAPAPVTPTAQPVADVETAWSVLPELTVEKAHLARNRIITATREDPAHGAFDVLRTRLLQALSENGWRRVAITSPGKDCG
KTFTAANLAISLSRQENCRTLLMDLDMRRPSLHRVLGVDSPGSVGDMLRGMIPPETHLHRMGRNPINAGRNIAFALNDRP
EAYASELLQDPRSAETLSAIEEQFAPDVVLFDLPPALFYDDVIAARPLFDGVLLVVGGGLTTESEISEVERRLGDSMPIL
GMVLNMAEGTDISRYTY
>gnl|bykdb|A0A239HD34 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Tropicimonas sediminicola] (length=306 residues).
MDRLHAAIEKARAEREKALAGQPSRPLSPPPLPTGATQDPLLGPAAAPQTPFPVSPPTDPAPAVGRGRPQVWQSLRPFDR
EARELKRNRLLALRGGKEAVPFDLLRTRMLHQLKQNGWRRVGIVSPTPECGKTTVAANLAFAFARQPDVTALLLDFDLRR
PRLAKMLGQSVEHGMADVLRGSVSFADHALRLSENVAIGMNVAPAVAPSELLQSERTVSALAQIEAEFAPDVVLFDLPPM
LSTDDNYGFLQRVDCVLLLAAAEQTTIDQIDVSLRQLNDLTTVLGVVLNKNRFASSTYGYNSDYYY
>gnl|bykdb|A0A243TPR1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Citrobacter freundii] (length=215 residues).
MEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRHGYSHNLFTVSNAHGLSEYL
AGKDELNKVIQHFGKGGFDVITRGQMPPNPSELLMRDRMRQLLEWANDHYDLVIVDTPPMLAVSDAAVVGRSVGTSLLVA
RFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGYSYSEKE
>gnl|bykdb|A0A246JVD8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingopyxis bauzanensis] (length=266 residues).
MADAELTTAINPEFVTLASLTEFTPPVTEIRKHRIIGFDNRDARARPFNLLRTSFAKKLKEDGHRLIGITSATPAAGKSF
MSMNLASSLARVVEEPIFLVDLDIRRASLADEIGLVPKHGIESYLEGTIDSLAGIGRRIDGTSLGIFPTIRRSRNTAELL
AGERFAQMITTLRDRSEASIVLFDLPPAFANDDAMISLAQLDGFVLVVDAGKTTRRHVQDVMAMLYPTPCIGTILNRYQG
GLGDSYGYGYGGPNYSKYYERAASDD
>gnl|bykdb|A0A257F1F4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhodobacteraceae bacterium PARR1] (length=279 residues).
MDRLSEAISKARAARGDSPAQAQSLPAVTTKAPVRRWHPEDITARWQALKQVSLSRRKLESSLIVAKDGGPHSAPFDMLR
TKVLHQMRTNGWRRIGITSPLMGCGKSTVAVNLAFSFARNPEIRTMLLDTDLRRPSIANMLGVTPSASFFSVLAGRVQFE
GCALAFGPNLCFATNGRPHRSPSELMQLSQVADELDRIDAEYDPDVMLFDLAPILQTDDALSVLQKLDAVVIVAAAEVTS
VKELDQCEADVAANTNVLGVVLNKARSVGQNYGYGYAPS
>gnl|bykdb|A0A257G674 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Novosphingobium sp. PASSN1] (length=626 residues).
DILKSRTLLERVAQKLRLIGNPRFYDAMGMRQPAGDLSRGELEDLTLQALEDARDVSMPRNSRLASVSFTSPQPELAARI
SNTLAAEFIQANLQRRFDSSAYARDFISGQLAEARAKLEKSERELNAYARQAGLIRDRNPSNTIDKGSTSGSVTTASLLQ
VNTAANQAQATRIAAQQRWNLVSRSDPLNSPDVLANPAISQLLSERARVQSELQKQRANHLEDYPAVAQLRAQVGVIDNQ
LQSVARSIRASVKQQFDAAVETEQNLKQQVAELKGSSLEEQDRLVQYNLLAREADTSRTVYEGLLQRYKELNAAAGINAS
NIAIIDSAIPPIRPSSPNLLRNILLALVVGVIGAAGFVYLRMQFDDSVRVPEDVEGKLNMPLLGVIPLAQELDVALALDD
PKSPISEGYNSLRSALLYSTASGLPKTILITSSQPSEGKSTTGMAIATGIARLGRSVVLLDVDLRRPALHRFLSGAAAEN
TEGVSSLLTSQSSIDQVLRDTEVETLKIITSGPIPPSPTELLSSNRMHMLLDELSARFDLVIVDSPPVLGLADAPLMAAL
VEGVVLVVQSDRSRRGSLKASLRRLRSMHTLVLGAVLTKFDATSTGNRYSEYYGYNYYQYSANADK
>gnl|bykdb|A0A257NG76 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Methylococcaceae bacterium NSO1] (length=496 residues).
GKKTGILELTMESTSQDSVLQTLNEIANIYVRQNVEQKSAEAQKTLEFLEKQLPQLKEQLEAATTALNDYRTRHGSIDLD
LETQSVLKGVVEIQTQITLLQQKRDELRQKFTESHPSVVAIDKQISRLQGQMNSNDKKIEVLPETQQVILRLARDVKVNT
ELYTALLNNTQTLRVSKAGTVGNVRIIDYAVLPTEPIKPKKALIVAVSLILGLILGIALVFIRKSLHRGVEDPDLIEKQL
NIPVYATIPHSAQQLKINAKLRKNQQSNELPILALENNEDLAIESLRSLRTTLHFAFLEAQNNIIMITGPSPGVGKSFVS
INLAAVLADAGKKILLIDGDLRKGLINRSLGVSRELGLSEFISNKITLDEAIHKIPMANFDFIATGSIPPNPSELLLHER
FNIFLESISKHYDHVIIDSPPILAVTDAAIIGRMASATLMVIRSGQHPMRELEQSTKRLLQAGVDIKGIVFNDVPESSSR
YGYGKYIYQYSYQKSN
>gnl|bykdb|A0A258GCD5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhodobacterales bacterium 32-67-9] (length=274 residues).
MEKLEAALAKAREMRKAALGAPETVREHVVQKDGRGAASWESLPEITVSAGTALRNRIATLSGGKDAAPFDMLRSRTIRQ
MKDKGWSRLAITSPGAACGKTTIAINLALSLSRQKDLKVMLIDLDLRRPALHKALGQTPAKSFHDVLDGNASFDDLAVRF
GSNLILGMNATACRHPAELLQSAGTREKLDEIERRWQPDIMIFDMSPMLASDDNVGFLGNVDCALLVAAAESTTLPNIDI
CEKELAQLTNVLGVVLNKCRYADDSVGYSYGTYG
>gnl|bykdb|A0A258TN88 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Hydrogenophilales bacterium 28-61-23] (length=273 residues).
MERIKQAVEKARRLQQGANASSTAPAARTRPVPAQFTDIESVDYRHTRVAPLDAAHLEQQRIVGHDKAHPASPAIDLLRT
QVLQKMEENGWRTLAITSPTPDAGKTTVAINLAMSIAHQTQKTAMLVDFDLRKPHVGKYLGLPEHLSLNEVLDGAASLPE
ALVNPDIPRLVILPTLRPVARPAEILSSAKISNLIAELRERYDSRIVIFDLPPLLNTDDAISVLPQIDCVLLVVGEGMST
KAEIEECKRHLPSKNLLGVVLNKAESITKPYAY
>gnl|bykdb|A0A258WKV0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Novosphingobium sp. 16-62-11] (length=375 residues).
GKIGLSGAARNQFITEVFRLRSIEASSAVDTLVEQDKRVRYNMLDREATALRAQLSSLLARYNEISAAANLNSGTSTKLD
AARVPGGPVSPSLPKNMLIGLLLGTAVAVGIALLREIFDDRIRSTDEVERKLGLPLLGFTPDVGDRDLAEEVSDPFSLLM
ESYSSIRSSVDFVVPGKHRVLQITSSEPSEGKSLTAATIARKYAQLGRRTLLIDADLRKPSLFALFGTKRPDVGFVEVLL
GDVKFEDALIKGTPENLDVLPVARSKINPVELLSSQVLIDFVERYREQYSLIIFDSVPVMGLADAPLLSRIADATIFIVE
ANRAHYGQAKTAIRRIASAGAKIAGVVLTKYRAGEAGQSYDYHYQYYAYGDRAKD
>gnl|bykdb|A0A259LQ70 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhodobacterales bacterium 34-62-10] (length=340 residues).
MAGGVGSSQVSIVDRAIVPPLPFEPNLPRSLIQALILSLAAGIGLAFGLSYIDDTIKTPEDVKQKLGLAAVGVIPKVKAS
KADSITDALADPRSPITEAFYSARTALEFTTSSGAPRSLVVTSSRPSEGKTSTIISLAMSFARSGRRVLILDGDLRKPSF
VARADASVGLSGLLTSDALLEDNVISSATENLFLLPSGVIPPNPAELLSSPRLPALIEEAAELFDIVLIDSPPLLGFADA
PLLGSVAEATILVIEAGTIRRPAAVRTLERLLESQSNVVGAVLTKFDARKSGYESSEYYYSYGKGAYAYGSRQAGKASGR
RKIRLFADGPGAGRTPIDHQ
>gnl|bykdb|A0A259LUN7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhodobacterales bacterium 34-62-10] (length=580 residues).
MEEKYNATRKATEWLQLRVSALQEEVEEKERRVETFRAETGLLEAQGTTLTEQQIAYLTSQRSELQIELDRARARYEAMR
RQIDSGAGVEGVSEVINSALINQLKSQRAEILRRVAELETRVGDRHPDLISARNEVADIDRQMMAEMNRIAANLESELRV
AESQINSIQGQIGQSSSQLRGNNINLVRLRELERDAETSRVMLEEFLARSKQTREQDSLITADSSVLSAASVPRAPAAPR
KLLNLIIGCALGVMFGCGLALLLEMLDSKISSTEDIENTLKTDAIGSVPLIRTAGLLGVGQMKPADFLIENPLSAYAESI
RYLRAAIAFSDIDSETKTVAITSSLPDEGKTSLTLALGRMSAMSGSRTLVIDGDFRRRQLTEMAGLKPEIGLVEHLFGAG
SLSDAIVKDSKTMLDLLPLSLDGHTPHDVFGTRAFDELLGRLRAMYDLILIDTGPLLLMAEARVVAGKTDKAILIVRWRN
TNRSAVRQSLNLLRNFKANLLGVTLNMVDLNRRRHHRDPGATYKAYRKYYQMESKPGLFGLGKSKPPKANTKGLRSAAAV
QVSPSKVSPASDNIDRISAE
>gnl|bykdb|A0A285D390 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhodobacter ovatus] (length=273 residues).
MEKLQKALQKARESREGQALDARPAVTAARAPVSTEGPWAELAPFTPDPAVLHRHRIFSYIAQKEAAPFDVLRTKVFLAM
RQNGWTRLAITSPEQGCGKSTVACNLAFGLSRQTQTRTMLLDLDMRRPGVAALLGCRPQHNMRDMLTGQVSPQDHMLCVN
GNLALAMSGGSTADPTDILTARQTGEVLDTLQARYAPHVMIFDLGPMLQTDDARAVLKYVDCALVLAKAEQTRASHLDTC
EREVGQLTNVLGVVLNDCRHVEAEADYYYQGEV
>gnl|bykdb|A0A2A5PQG0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella pneumoniae] (length=298 residues).
PKKSLVVIIGFILGLFIAVSAVLIQVFLRRGIESPEQLEEAGINVYASVPVSEWLTKNHNRNKNWRKETTKLLAVENPTD
LAVEAIRSLRTSLHFAMLEAKNKVLMISGASPNAGKTFVSTNLAATIASTGKKVLFIDADLRKGYVHKILGNTKQVGVSD
ILSGQCKIEDALTRASSGDFDYISRGKNPPNPAELLMHPTFEKLLKWADENYDLVIIDTPPILAVTDAAIIGRYAGTTLL
VARFESNTVKELAVSVSRFEQSGIVVKGCILNGVVKKASNYYGYGYGYYDYSYKNNQY
>gnl|bykdb|A0A2C8F781 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudodesulfovibrio profundus] (length=280 residues).
MSRIEEALKKASQMRNSTRRTETFDPPSEEAINRKLVESSVTAEAIERVKGQHLLVSMNDNVSPAAEEFRKLKQNLVRLS
KKNGFHNTVLVTSGTVAEGKSVTATNLAISLAHEFDHTVLLVDADIRRPSVNHLLNLENTYGLSDCLNDGTDISKALVPT
GIGKLTFLPAGTPTANPGELLSSKRMEMILREMKNRYSDRYVIIDSPPVLPFAETRILSRLVDSTILVVKEGRLSQYEVR
DTMEALSGSNIIGAVFSQASTGAMRSGYSSSYSYSYYHSY
>gnl|bykdb|A0A2D4UVV2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhodobacteraceae bacterium] (length=469 residues).
MVERRKFQRKKRPTAETDAPEPAEVTSAAPPAAAPTHRRKRRRTDAAQTPPTEAVTAERTRSESASDAQEAARVAPARRA
ERAREAMAQRKAEEARLAEEQRQAAAQREAERLRLEQTRAAEEAEAARRAEDAERARLADEARRQQEAEHRAQEQREAEA
RAAEAARKAEQLRLAEAAREAEIARATEKANRDAEAAASEARQIDEARQALRAQRAARRVAPADDADVDDRWARLGSFPV
DPAHLQRHRIVTALREDPAHAAFDVLRTRLLQALADNGWKRVAITSPTKDCGKTFTAANLAISLSRQQNCRTLLLDCDMR
RPSLHKVMGLRDPGSMGDMLRGGIPPEDHFQRIAENRIHAGDTIAFGFNGAVEPYASELLQSPETARTLQRIEDRFAPDV
MLFDLPPALYYDDVIAFRPLFDGVLLVVGGGLTTEKEVREVERRLGESTPLLGTVLNRAEGTSLKKYSY
>gnl|bykdb|A0A2D5J8T8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhodobacteraceae bacterium] (length=281 residues).
MERLQTAIQKARMQRAGSGPEQYAPAHAPSARAGLSDPRPRPGLEERWQALQPLELNKTKLVRNRIVALQADVSSAPFDV
MRTRLLQQARKNNWRRIAIVSAHEASGKTTVTTNLAFGLARHRGIRTVVVDLDLRRYGLSHLFDRATPPSVVDVLEERVP
FADVARRHGSSLAFCIGATPTPNAGEILLSDQTQTVLKTMEADYEPDVVLFDLPPLNVGDDTQGFLTRVDAALILAEAEK
STVAQIDVAERQVAELTNVMGIVLNKSRYVSDTYSQQEYYY
>gnl|bykdb|A0A2D5LFD8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Gammaproteobacteria bacterium] (length=834 residues).
MAAPIKLLVELLEKNMAPSKSPLDIEKKRDHATDQSSGNEGESLEGGASYSEFRQIIYRRKKLIAISAIAITSAITGQLI
FQRLFHPVYEGTFSLLIKDPINNSSSSNNSQSANTNFQNLALNSISNDLPTLISVMRSPLILSPIAESFDLSELQLAGRI
TITPVGEGRTGQGAGILNVKLKGKDPDNDKILLDQLADVYLEIAQRQRQQSLRDGLAFLDQQKPALEAKSTALLTELENF
RKQNLLIDASTEALKIEANLSSTEQSLLSLQNTRRNLEQVRKQVAAGNLNSFDFQGSIISGGGASTSGTTETAGSSLSGS
IGISGIDSXLEEELTTLKEALYEARSIYQPGSFAMKSLEQKKAALEPLLLASQLRALDTALQVNSNQINSTKLELKNLIQ
NFLRQPALMKGFEELQSRLXLVQGNLAALTSTQESFRLELAQNSVPWRLLSPPRMNPIPIEPSVKTGFLKAILIGVASGL
GIGVLRDRIDHVFHTPEEVDNDLKLPLLGHIPYLKLFQNIREEKRSLLSEXDANAMNSSPNYQAENKHNTSQQSYEHFFY
QEAFRNLFTSIRFLNNDQPIKTIALTSSVPAEGKSLVTILLAKTLSEMGQRVLLIDADLRKPQIHTRLGINNLMGLSNIL
ANNNENWQDALQSVPNYSNWFTITAGLRXPDXTQLLSSKRMHEFVENITESGKFDLILFDTSPILGLADTALVTEKCNGV
VLLVSLNRVDRSLPKQAANRIFSSGAELLGIVTNGFGASTPSNAFGHNRKYGFRKYSYGNYGYGAYDPTATYAYYANTED
ENAADQXNSVRNKRRNWLKSLSXQAERLMRWIDG
>gnl|bykdb|A0A2D7AVL1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Hyphomonas sp] (length=495 residues).
NSSIFSLDGETIVTLNKELATAESERIAAYQKYIEAENSPITLDVLDSPDLKKLREQRFQLDTEYQNKLEIYRPEYSEMT
ELKRRIELTDREIEAERTRIVDALETSFRAAEAKEASLRERIGELKTKLIELRTQSVXYGILERQVETNRSQYDALLTRL
KELTTAEGIGASQASVVDRAIAPTHPFQPSLGKHLLLATILSLAAGIGLAILWEYIDDTIRVPEQLISKLGLPIIGIVPV
ASKSSDLVQDMMKNPKDSLAEGYFSIRANLLFSTNSGAPRCLSLTSASQAEGKSTCAVGLGLAFSRSGQRALVIDADMRR
PSFVVDRNLSIGLSGLLASDADAMEHIIAGPTENLFLLPAGRIPPNPAELLSGHRLNEILEQLKQVFDIVIVDXPPVLGF
ADAPLLAAACDATVVVISSGKSRRITIRRSLDRLVSTHAQTVGAILTKFDARKVGYDYGYYYYNYGPGAYDYARPSARTE
RQSRKITLFKDQLDD
>gnl|bykdb|A0A2D8R8F8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Hahellaceae bacterium] (length=275 residues).
MEKFDNIITRLREQQNAPRRQHVPMDIDERYEPGVIEYTRTRCVDLDEGRLAKNRLVAHNKSDPMSAPYHILRAKVLQQM
RRNKWTTLGITAPTPEAGKSLTACNLAMSIAMQSSQTVLLVDMDLRKPTVAKYFGLAPEIGIHDYITGSAQIEDILIHPN
LERLVLLPGTKPILNSSEEISSSRVADLVQELKYRYQARYVIFDLPPILVSDDVLVFLPYIDCSLMVIEDGRNTREEIED
AVESIGSNPLLGTVLNKCEQTRNTYGYYYGQKESS
>gnl|bykdb|A0A2D9ABL7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Roseovarius sp] (length=258 residues).
MAPVPLEAAPDPIPAPTPLLWPALRRVVLDPKHLAKHRLISATREDPAHVAFDVLRTKLLAALRTHGWHRVAITSPTPDC
GKSFVAANLAISLSRQSSVRTVLMDMDLRRPSLAHTLGQPDPGRMAGFLSGDIPLQRFLTCPEDNALNIGQTLAMGLNDR
AEPYAAEILHAPETGEVLQDLYCRLAPDVVIFDMPPALYYDDVLGFRPQFDGVLIVVGGGRTTAQHIRDVKARFGTDTPL
LGVVMNRAEGESIAKYGY
>gnl|bykdb|A0A2D9YR88 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Maritimibacter sp] (length=273 residues).
MERLQAAIERAREQRDTRGATARPQPRGTVQDKSGADEAWAALPEIKLQRRQMLKNRIMTFRSSKDSTPYDILRTRLVQQ
AQANGWRRIAITSPHSACGKTTTCANLAFGLGRQTGMRSVVLDFDLRRSGLGRILGQKGEIPMEDVLSGRVPFKDVAMRH
GPNLAFGLGFGTSHRSAETLQSDQTRRVLEEIEAEYQPDLMLIDLPPMSASDDNFGFLNRIDAAIIVAEAEQTTMTQIDV
AERQVAELTNVAGVVLNKCRYVNGAYGYEDGYY
>gnl|bykdb|A0A2E0GW64 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Legionellales bacterium] (length=514 residues).
MLSGQLKVSDQGDQTQKNSYLRETGVVQASFTWGKPQQAQEILNAIINTTQEKDIQKKSQQAAQALQFINSQLPKVKTDL
NHSEKQLNDYRSQSNILDISAESKMMLTQLVKSQNDLEALKLEKTQLQQGFTEKHPIVIAINEKIHKQQAALSALESEAK
KLPHSDQKALSLMREVKVKETLYSNLLSKIQELSVLRAGTTGDVRILDYATLPLSPLPTHKSFIVLASMFAGFTLVAIGL
LASHLLLSGEMDPESIEELLGISVNAVIPFSREQQHSVKESEKNDTKIPLLRDIHSTDPAIESLRSLKTALQLHLTQASN
NVIAILGPSPSVGKSFISLNFASVLAESGQRILVIDTDIRKGRCHKFIEGSRSPGLSEYLQNKASAESIIRPLTNNCDLI
TAGHYPKNPTELLSSPRFNELIQQARTQYNLIVLDTSPIMAVTDALIVSKQAGTNFMLVGLGKNSRKELQATIKRCQHNQ
IPVNGLVCNYFSKKIQSYAYSKYGYYYYSYSDKK
>gnl|bykdb|A0A2E0Q2W0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Erythrobacteraceae bacterium] (length=497 residues).
MAEQRERLEXSEAALISXANEXGIVVLQRGASGDSEGGGQQTLVETRLSQLNEALAEATARRIEAEGASRAASVANAGAA
TIRSRIAXVEATLARLRTTLGPENSQVEASEAELRSLRSALSKESGITGAASDAQLRGARQVEAELQARFDRAKAEYLAQ
QNQGVQYGILDREVNTNRQLYDALLQRYKELDVVGGGRNNIALVERAEQPGGPYSPSLVRNLFLALLVALGLCGGLVFAR
EIFDDTVRDPSELRRRLGLPVLGLIPKFEADEVENQLGDTHSELSEAYASTRVAINFATKPDDKIILVTSTRPDEGKSLT
SLAIAYNFARLKKKVLLVDMDLRRKGISIRLNESKSTEGMSTYLAGQISSLPTVHKDEFGLDFVRAGTSTLNPADILSTS
QFQIVLDELRKHYDWIVLDAPPLLGLADTPQIADAVDAIVYVVQANGSTFRSVRQAVQRLRASHGKLLGAVVTKLDYRNE
SYAYGYKYGYGYDYKSE
>gnl|bykdb|A0A2E0UL88 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Ectothiorhodospiraceae bacterium] (length=545 residues).
SYQQTEGIVSLDQESEGLINQLSNFEAQREQAKIELQAARRVMEEYESKVASIEPTLSTKITETADPMIQQLAREKAQVD
LEIQKAEFGRDNALAARPELEEYSQKSLKDLRARSKELEMRINKLASDAMESGDLTTSPLQLSRDLRRSIVTQQIEIEAL
KAKIISLDETIQDFSKKFEDIPEQSIEFARLERERLSNEKLFMILDERYQEARINEQTTMGNVDVVDDATPPGRPISPDR
PKNMIIGVFFGLGLGFLLAFVARYLDSTIRNPEDVEKHGIPVLTFVPSFGNSDSMSREDSLIVQSSPQSPPSEAYRTMRT
AIENTLAMNGKSMVVLLSSPAPKEGKSTAIANLAVSAANLGKRVLLIDADLRRPVQHNIFELDREPGLSDCLTGGVPVNQ
AVKKTNIPRLHVVTSGHIPSHPSELLGSTQMEKFLNLIRQYYDFILLDSPPIIAMADTLVIAKHTDGVVLVVSADQTKTM
GLVKAKQLIEANNANFIGAVVNRFNANKIYYSYYRYYYQNYYYYSDDGTKKKKRKATADEKEKTS
>gnl|bykdb|A0A2E1D962 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Yangia sp] (length=356 residues).
MTERRRFRRRNRPLDDLPDENISPVEPLGTRAERLARRETKTSAVQAARRAEARQAEAAGRMAQATRQTGAEHRVETGRV
STEPARAEARRGQTAPRPAAPAVATRTAQSPTPLQQRGWHDLAEVSVDARHLERNRIVTAARQDPAHAAFDILRTKLLQG
LADHGWKRVAITSPTKDCGKTFTAANLAVSLSRHQNCRTLLLDCDLRRPTLHKIMGFRDPGSMGDMLRGLLPPERHLVRM
GENAIHAGHNIAFGFNGAVEPYASELLQTPRTAETLRQVETMLQPDVVLFDLPPALYFDDVMAFRPLFDGVLLVIGGGLT
TDKEVREVERLLGKNTPLLGMVLNKAEGTSLDKYTY
>gnl|bykdb|A0A2E1DQ13 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Roseovarius sp] (length=323 residues).
MAGDPAMKQAPEAAAEDVTLSRHEAYMRRRAARQAEAPETGDAAPADPEAALEPVLARPRGSSTIPEPEPEPSAATHAET
SIAGAWAALRETPLDARHLTRNRLISARREDPAHVAFDVLRTRLVATLRERGWHRVAITSATPGCGKSFVAANLAISLSR
KPGLRTVLMDTDLRRPSLAWLFGVKAPGTMARFLGGEVPPEAHLWRPAPNDLNIGRALALGLNDRAESYAAEILQSPAAA
GALARLQARLAPDVMLFDMPPALYHDDVLAFRPQFDGVLIVVAGGQSTAQEVRDLRDRLGTDTPLLGVVMNRAEGEDITR
YDY
>gnl|bykdb|A0A2E2BR79 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Halomonadaceae bacterium] (length=505 residues).
LSSRLSVSETGSGFVGNAGMLRLTLTGTDREEIRRLLDAISETFLMQNVERQSAQVDQSLAFISEQAPDLRTQLSSAEDK
LNEYRVKMDSVDLDSESQSVIAQLIDVEKKLSEVEFQEAEMAQRFTRNHPAYQALMRQKSFLRNERDRLNARVEKMPAAQ
QEVVRLTRDVEVTQAIYVNLLNRSQELNLAKAGTIGNVRIIDSAQVSPSPIAPKKGLVIMSATLLGATLSIGIVLLRAFI
NRGVEVPEQLESIGLPVYATVPLSDDQQKLVRKSRSHSRNGHVIKGILSMERPTDIAIEALRGLRTSLHFAMMESKNNCI
MVCGPSPEVGKSFVAMNLAAVCSQTGSRVLLIDADMRKGNIHKAFGEHSAEGLSDFLSGKVEWKTVVRDTSIEGLSYVAR
GLVPPNPSELLMQDRFGSFLADAGKEYDLIVIDTPPALAVTDSVIVGKQSGTSLMVARYRHNPPKEIKLALRRFETSGVE
IRGFILNALEGRTSANYGYYNYSYK
>gnl|bykdb|A0A2E2P4I0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudooceanicola sp] (length=286 residues).
MDRLQQAISKARKEREASGDVATSPAQSPRGVTAAQAVARQAVPPAGDVTARWAALNPLQVTSKTVRSNRLMAYTPGEAA
IPFDMLRTKILQQARKNKWRRIAIVSSDSGAGKSTLAANLGFSFGRMRDKRTIILDFDLRRFGLGPILGVKPVAGMAEVL
RGETSFADHALCHDGNVAYGLNRNRVQNPAELLQSPRTAEILNQIEQDYEPDLMFFDTPPLMVSDDSHGVLQSADCALLV
AAAEVTPMDRIDVAERQLSELTNVMGIVLNRCRYNAGAHSYEGEYY
>gnl|bykdb|A0A2E2T3V8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Thalassospira sp] (length=699 residues).
MTISDLVGILYRRRGVFAVSFVALLMMASVAISFFSPVYKSFASVGFVREEPATTQTDFPKAVWPNAAEFVETRMEMIIG
NETLSTVMSVLRGQGVSFSQEANVQGNFLRRIFGNDQGFIASDAKVSDEIDKDVEALRRRIDVERIGNSTVIQIGVTDDD
PERAYQIVSAVAESFVWLRNNELRRGMDNQLTVIQRQLDEARKRLETVEQRHADWEKSSGNIADRERELILERIYDLNAE
LDTAFQEREAARMLFEKRQAVKSSEELLALPDIAKDDQVRDLQVKYEVLQQNYAELEQRYQPAHPSMVRITGEIWSVQQT
LAKALERSARQIDFGNANAQARYELVLKQLVRWKKELVKKHEALAGQGVLERDVEEAKRTVELLGAREQEILSSIAELKP
DTLLLQLPSVPLYPEFPGKNDLWIAGVLVTLLVSVLIVILRDYFDQAIRSDEDLKRVFLLPVLGRVPLSRDDSQYLEIGE
TTEEALGHLIVLTEMMRTDPDPRQPDAGKAQVICVGSASPNEGKSRLSAQLALSYARRGLKTLLLDGDLRRPGHLSSIAG
IPDFSDVLIGEEDISVLVSKVTKVDRNLDYLGARDGLPGVLATQLIESRFGALTEIMRSSYDRIVIDTPPVLMVADSVTL
MRLADVRLMVVRNNFSRRPDVMRALDQFGIAECSPDGLVLMAADTSKTYGYRTDTVWGT
>gnl|bykdb|A0A2E3FCR1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhodobacteraceae bacterium] (length=295 residues).
MVNYVLRRNRRKEIEQEKPTERPVLMERVAQQAAQTDAQEDAVREALRADIPAQPDLWAELALIPVDGRQMDENLIITAT
RHDPAHATFDVLRTRLVQTLSEHGWRRVAITSPTSGCGKSFVAMNLAITLSRYDNCRTVLMDMDMRSPSLAHILGLEDVG
SLGDWLRGTRQTRQQFRRFADNTLKIGKTLAVALNDKVEPYAAELLQKPETKERLEQLDEQLSPDIVLFDLPPALAQDDV
MALRHMYDGVFIVAGGGQTXAAEIRETMRRLGDDVPLLGVILNKADGAPIEEYGY
>gnl|bykdb|A0A2E3P9W6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhodobacteraceae bacterium] (length=275 residues).
MERLQDAIHKARAQRSGSARPAHRPSGPAEAHQPSPGVEDRWAALKPLQFSKKKLLRNRIVALHADVSSAPFDVMRTRLL
QQTRKNGWKRIAIVSPHESSGKTTVTANLAFGLSRHRGIRSVVVDLDLRRYGLSHLFDVASTPSVLDVLDEQVPFAEAGF
RHGASLGFCLGPQVTQNAGEILVSDQTQRVLQGIEADFEPDVMLFDLPPLNVGDDTQGFLTRVDAALILAEAERSTVAQI
DVAERQVAELTNVMGIVLNKSRYVSGAYSSQEYYY
>gnl|bykdb|A0A2E3R6G0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfovibrio sp] (length=280 residues).
MSRIEEALKKASQMRNSTRRTETFDPPSEEAINRKLVESSVTAEAIERVKGQHLLVSMNDNVSPAAEEFRKLKQNLVRLS
KKNGFHNTVLVTSGTVAEGKSVTATNLAISLAHEFDHTVLLVDADIRRPSVNHLLNLENTYGLSDCLNDGTDISKALVPT
GIGKLTFLPAGTPTANPGELLSSKRMEMILREMKNRYSDRYVIIDSPPVLPFAETRILSRLVDSTILVVKEGRLSQYEVR
DTMEALSGSNIIGAVFSQASTGAMRSGYSSSYSYSYYHSY
>gnl|bykdb|A0A2E3UGD6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Confluentimicrobium sp] (length=274 residues).
MEKLQAALEQARRQRTESASERGPAKAALVRPLQQNVVEAWDALQPLSADPKLLQRNRVYTSLGNAHATPYDMLRTKMFQ
LMNANGWRRVAITSPSPGSGKTTTTANLASSFGRQVDLRSVVMDMDMRRPSLARVFGHSGTYSVFDVLEETVPFAEQALR
FGKNVALSMNTKTARDPSELFLRRRTAEIIDEIENTYQPGIMLFDMPPVLSNDDTRAFLDNVDCALIVAEAEQSTIKQID
LCERELAEQTNVLGIVLNKCRFSDDSYGYGYGLN
>gnl|bykdb|A0A2E5YSA4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Deltaproteobacteria bacterium] (length=335 residues).
MGSRSGCRFAREFQSGDEIESMGEIAEALRRADGANPIGQKERSAENLPRATPGPRDDRADAVGSADHPPHSPLPTGVTK
ETRIGRSIQSLRHERDDPAPPARISISNPQGNAAQTARRLAFRVRELADARGARSIVVTSAQQGDGKTTTACNLAIQLAG
LDQTLNVVLVDLDLRRPDIASALGVEIETPVDGVLRGDHSVSEAIIETDVTGLSLLALDRGVHDAERLLAHPNLPKMIRD
LESRFDLVLLDSPPLLAVTDAQLILRHAAAALFVARAGSTTVRAVRRTVELLPRKKILGSFLNSNPKAQRLTGYDHYGSP
PHDPIDPPADPNDDD
>gnl|bykdb|A0A2E9H5Z8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Deltaproteobacteria bacterium] (length=508 residues).
MGQSEEYILKSAEMQQFGAEERKAELENQIQQLLTLRDDELIDFAEGLKLPGSQVPFLRSRIQESQLNMEAMQASGLGRK
HPSMEMALIAQNKMQENLETAVTVLRDLLKTQLRLVNGQLVKIKERVEERRFDAVDKALQSQDYVEAKQDYETAKAMLSQ
MKLTNSARRIALKIPKNPITILEDPKLAKDPVYPKVTLFLSLGAAVGLIFGISIAFFLEYLDTSVKTLEDVERYLQIPVL
AVIPKDVGILHKQSGMSPDAEAYRILRTNIEFNRNNPEDNAITIVSGGAGEGKSTTLVNLAYVCAQGGYTTLMIDSDLRR
PTLHTFFDINNSVGLTNYLTTDLMLEDVILQTPVDNLYFLPSGILPADAAGILNSRRMSELVQDVKQRFDLVLVDSPPIL
GVSDASVLASEVDLTMIVVQHRKLPRNMLMRVKHSVENVGGQVIGVVLNNVDVRSDSQYQYYTSYYTYYAPSSDVDTIPS
PSRVAVSMGASPTATPSTPEEDDDGLSY
>gnl|bykdb|A0A2E9HXF7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mameliella sp] (length=486 residues).
MDSPKFRRKRTSATAHPPAADPASPYAAVKAASQEAARLRVEADERARAEAETQRIAKAAERAKFEEKARRKAEFEERAQ
TEALRRVKAAREQRAADAMKAREDAERQESARQHREAEEARSRQEAAAKAAQDAEDHRQQVEKRAAEEAARREKAKRDAE
ARAASALRAAETERIADEVREAEQRKADAEARDADARRTEEDARRKAQPPAPVLPLTDMIPVTRRAEPAPTSAPVTPTPK
TIVDVEHAWSGLPELTVDKAHLARNRIITATREDPAHGAFDVLRTRLLQTLSENGWRRVAITSPGKDCGKTFTAANLAIS
LSRQENCRTLLMDLDMRRPSLHHVLGVGSPGSVGDMLRGMISPETHLHRMGRNPINAGRNIAFALNDRPEAYASELLQDP
RSAETLRAIDEHYAPDVVLFDLPPALFYDDVIAARPLFDGVLLVVGGGLTTESEISEVERRLGDSMPVLGMVLNKAEGTD
ISRYTY
>gnl|bykdb|A0A2G2B1P9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Marinosulfonomonas sp] (length=275 residues).
MERLEAALEKARQDRQTAQIAAVADVEVVEPVVKPAPILDPWDTLKEVKLSPRVARNHRITSMTQGKDSGPYDLLRTRAL
KVMGDNGWSXLAVTSPNKXCGKTTVCVNLAFSLARQSDLRILVLDLDLRRPAMHKILTHRSEHXLHEVLQNMHPLESAFV
RIGKNLAFGLNNSAASNPSELLQSKLTRARLNEFKEVFKPDIMIFDMPPMLVSDENVGFLPFVDAGLLIGAADSTTIAQL
DICEKELSDLTNVLGIVLNKCRFTDSDAGYDYEYY
>gnl|bykdb|A0A2G2CXY6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingopyxis sp] (length=622 residues).
MGSWAARRYDPYEAGEVAEPWLGLDSFAWGGEELAIFQLEVPPGYLGKTLILTAQDAGTFTLHDQDGMLLIEGNTLEQID
RDGFKIQVQALVARPGTEFLVTKHRMLNSILAYQEELGASEKGKDSGIISLSMQHESPAQATRILDEVSRLYVLQNVARN
SAEAAQSLEFIREQLPVVRQELERYEQALNEYQISTQSVDITIETQAILDQIVELDTMISELNLRRAEMERRFTREHPNY
QAMLQQMQQLERQKAALEARVGDLPSTQQELLRLKRDVAVTTEIYTALLNSSQELDVLRAGTVGNVRIIDEAAANVEETV
KPKKSLIAMIATLLGGFVGVALVLLRHAMNRGVEDPDVIENLGLPVYAAVPFSKDQEVLEKHTKGRHRDAYSGSLLLAVS
NPADLSVESLRSLRTSLHFARLEAKNNILMISGPSPSVGKSFVSVNLAAIIAQAGQKVLLIDGDMRKGYLNKMFRMAPEN
GLSELLSARITSNDAIHSTEVENLFVVPRGQIPPNPSELLMHANFSSFLDNVKDEYDMIIIDTPPILAVTDAAIVGRHVG
MSLIVTRFGLNSAKEIEVTKRRFEQNDIQLKGAIFNAVEKKASAYGYGNYGYYNYEYKSDKK
>gnl|bykdb|A0A2G2DSM4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfotalea sp] (length=282 residues).
MGKFSTTLAKGEQQDSTTQKNDSDWLSPENVENRDKETADRPHPPTTPASSQWDSRLFKAINEDISIPEIFKVLRSRILH
PQNGEKAIKTIMVTSAVPKEGKSFITANLGISLAQGMDQHSLLVDCDLRRPSLAGLLGMQRATGLVDYLRDNTPLATLIN
KTIVNKLSLIASGKPPLNPAELLSSAKMKELTNELSQRYEDRIIIFDTPPILVAAETGVLARLVDRVILVVREGTSRKHE
IQKTIDTIGKEKIMGIVYNDQTSNIFDKSYSKKYNYYLHDAK
>gnl|bykdb|A0A2G2GD62 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Arcobacter sp] (length=768 residues).
MDSNITKNMEADEESFDIQQALYIIKKYNKSIAFIVVVFIIISGIMAYFKPSMYFSTAVVQISEKGRSGWNDPVLTALGL
GDSQGQNIDSIMSSGYLISKMLENLELGTRYYKEKNYRLVELYKKSPLVVNVTFMEYNLLEKKLKIRAIDGETYELSYKT
KIKINIDYFTRLLFGKQKVYIEYKGIHKFGEDVISKYFQLKVIKVRELNSLEYFFSYIDNRNMVGYIQNNLSTEQDAKYS
SNIFVRFDDTVALRAKDIVDGITTAYIQDSVDQKKSSTERSLAFIDKQLDNINKTLSKSEKVLQGFKQKNNLLSLDIKAA
MVSKNVEKIGTEISSLSSEESILENLKEYIDENDDLTGLTVQSLETTATNLNELIINYQTALTNRRSMLVSVTEFHPEVI
KLNEEVFNLRKNIQATVVLGIKTIKTRKEYLRRELKVRQASLTKLPEQERELGELTRNSSVNQEIYSFLLKRRVETAILN
SSTLSQARLMDPATLPMRPYAPKKMRMLLMGALLGLIIGVIIAFIRASINNVISNIEEIEKRSPIPIYGKIPYNKKKVQA
TSYEEAFRILRTNLEFINTDKPSKTVLVASSISGEGKSTTIKNMAVMLVKLNKKVIVLDLDLRRPSLHKYFKGITNDIGL
SMLLSGQNNLQECLQRTKDNIEIISAGPTPPNPSELIMSEEMDLLLKTLSKSYDYILIDTPPYSIVTDATILMKKVDIVL
FSIMADYSSRKCIPQLKEILKNYQIEFAGIIYHGIKLKRQEKHGYGYY
>gnl|bykdb|A0A2G2I5M1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Methylophaga sp] (length=277 residues).
MDRIQKALDKAKAKHSEQAIIDVPSTNEENAISSPIDPLKSPIDNISYQQTRVVETSRDHLESNRIIAGMYGNPQSTVFR
MLRTQVLQKMRANNWQTIAITSPTAGEGKSLVASNLAIAIAMELNQTVMLVDMDLRNPTLNKYFDLNAELGLKDYLEXNL
ELKDVLINPGIKRMVILPGKGRAEDSAELLSSPKMANLVAELKAQYDSRLIIFDVPPLLQTDDVLLSSKYFDCSLLVLED
GKNKESEITKALQMLENNNLIGSVLNKSNKPPTHQYY
>gnl|bykdb|A0A2G2M6F0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Methylophaga sp] (length=277 residues).
MDRIQKALDKAKARHSEQAAVGLSDAKKEKTISQLEDPLKSPIDNISYQQTRVVETSRFHLEKNRIIAGMYGNPQSTVFR
MLRTQVLQKMRANNWQTIAITSPTAGEGKSLVASNLAIAIAMELNQTVMLVDMDLRNPTLNTYFDLKAELGLKDYLEQNL
ELKDVLINPGIKRMVILPGKGRAEDSAELLSSPKMANLVEELKAQYDSRLIIFDVPPLLQTDDVLLSSQYFDCSLLVLED
GKNKASEITKSLQMLDSKRLIGTVLNKSDKPPTHQYY
>gnl|bykdb|A0A2G5KB39 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Amylibacter kogurei] (length=271 residues).
MERLQAAINKARAQRKTGVAATEHVQSKTTDKKLVENWERLAPVVMDPKQSAMNRLSSIGGGRDAAPYDMLRTRILQQAS
ANKWRRVAVVSPHSGCGKSTTCANLAFSFSRQRDLRTMVLDLDLRRVGLSRILGQPRNANMADVLQANTDFLDHGMVLNE
NVALGLNQTSVHDASEILQNMRTKSVLENIENQLRPDIVLFDMPPLMSTDDNYGFLPNVDCAILIAEAEKTTIAQIDVAE
RQLAELTNVMGVVLNKSRYHTGAYGYDYDYK
>gnl|bykdb|A0A2G6CSG7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Proteobacteria bacterium] (length=287 residues).
MGKIHDALEKAERSKELKVVPDIKPAPALRKPAASTVEVIPPAQVKSPSVQRRPETEYNRLDSKLVTYYDPGGVEAEIFK
ILRTNILFPKAGSPPRSIMVTSAIPGDGKSFVAANLSISIAQGIEEYVLLMDCDMRRSTIHSQFGFADNTPGLSDYLAKN
VPLKSLFKKTLIDKLTILPGGRTPSNPAELLSSTAMKALLKETTARYRDRYVIVDSPPPHLTAETTALAQYIDAIILVVR
YGATPKELVTSLLEKLGKEKVIGVVMNGCRIPVTERYGYGKYKKYKK
>gnl|bykdb|A0A2G6FCC5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobulbus propionicus] (length=286 residues).
MGETVGKVLRALSKAAESDKSQMLSDESTLQGLDKELFNEASNRQSDNQRTSSDLWDERFILASSTTGATAESIRTLRTR
ILYPVMGETPRTLLITSASPGEGKSFICANLALSLAQGVDDYCILVDCDLRRPTQHKLFGLKNERGLADHLQGGVPPEDL
ITHSGVKKLSILPAGPPPINPAELSGSGSMVHLVNELKSRYEDRFVLLDSPPLGAATETAVLAQHVDGVILVIRQGTARR
EHVKHLVDTIGREKILGVVFNAHEVSVLDTAVFGYTDYKAGYYYQK
>gnl|bykdb|A0A2G6M7F1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobulbus propionicus] (length=300 residues).
MGKVYKILNRAEQNRNFQGKEKAEATSSGDHQAADAVTSKLLASSGRKVSAGEEPRSKKRSTRSLSGRKWDDRLIFAATA
NAVVTENIRALRTRILHPSQGERPRSLLITSADAGEGKSFICANLAISMAQGVDTHSLLVDGDLRKPTQHRLFGLESDRG
LTDFLLDQVPLEHLIFPSGVDKLSILPAGPPPINPAELLGSGAMASLVEEVVLRYEDRLVLLDSPPLHAASETAVLAQQV
DAVILVVRYGRSRREHIKSMVEILGKDKILGIVFNAYESTVLDTKVFGFYDYQQKDYYSR
>gnl|bykdb|A0A2G6MSP7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobacterales bacterium] (length=297 residues).
MVLNLLIGLALGLVSGIGAAFIAEFFDNTIKNPDEMADRFGIPVLGLIPFDKEAEEDRKYMALKFHDDPRSPVAEAFRTT
MTSVRLSVADNPPKTILVTSILPGAGKSSSSSNACFSYLSEEERVLLIDVDLRKPSLHHVFSNGLRGKGLSSVLTGQAEL
SDVILHTGFSGLDYISSGPLPPNPAELLSSRKMRQLLQTVSEQYDRIILDGPPYQGFAEILVLANMVDGVILISVEGDTP
REGVKHFRRAITNVGGRILGTIINKSGRRSGFGSYGYGGYKYYAYNYTYGAGEEQEG
>gnl|bykdb|A0A2G6NB59 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Deltaproteobacteria bacterium] (length=287 residues).
MGKIHDALEKAERSKELKVVPDIKPAPALRKPAASTVEVIPPAQVKSPSVQRRPETEYNRLDSKLVTYYDPGGVEAEIFK
ILRTNILFPKAGSPPRSIMVTSAIPGDGKSFVAANLSISIAQGIEEYVLLMDCDMRRSTIHSQFGFADNTPGLSDYLAKN
VPLKSLFKKTLIDKLTILPGGRTPSNPAELLSSTAMKALLKETTARYRDRYVIVDSPPPHLTAETTALAQYIDAIILVVR
YGATPKELVTSLLEKLGKEKVIGVVMNGCRIPVTERYGYGKYKKYKK
>gnl|bykdb|A0A2G9XLE5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Syntrophobacteraceae bacterium CG23_combo_of_CG06-09_8_20_14_all_50_8] (length=264 residues).
SLFTQLEPKSHVAEAFRSLRTSLHFSAVNRDKKILLITSTFPKEGKTVISANLANILSQTGARVLIVDCDLRRSFLHEVF
GHSKSPGLTELLAGNTTFLEVRHNTGISGIDLISAGTTPPNPAELLGSEAMRRFLLTQRENYDHIVIDAPPVLAVTDAPV
LTAVADMVLVVMEVGRVPVKAAQHVRELLAAVQAPTTGLVINNRTSQAESYGYYGGRYYRYGNGYHYGYGYGYDYYSDEI
PMPTKQKPWRRKFFRKEKTEAGEN
>gnl|bykdb|A0A2G9ZR82 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobacterales bacterium CG23_combo_of_CG06-09_8_20_14_all_52_9] (length=439 residues).
THLKNEYAKLYAKYEEMSTTFHDAYPPVNALKSNMASISEQIKTEENKIFQSIASDYKTALKKLEALKERVELQKKLAME
LNERATQYKIMEREVETNKQIYNSLLERSKEIESMVGVSASNIHIVDRADLPVLPFKPKVTLNLLLAIVVGLMGGIGCAF
MVEYFTDTITNPDEISDRFQIPILGVVPLAKTLVEGSVKSTLTANPRAPISEALRTIKVSIQLSGTENRAKSFLVSSTSP
GEGKTTIAVNLALSFAGSGEQVLLVDTDLRKPRIHTVFSNGSSAPKHGLSSLLVGIAKTGIIRKSEYENLHYVPAGPIPP
NPVELLASRRFAEFMKVVKKHYDRVILDGPPHQGFADVLVLCQNVGGIVLVSSIGSTTRQALRHFKKGILNVNGWILGCV
INKVNLEKRYGYSSYYQYYQAYHYDYGDGKRKKRKILPW
>gnl|bykdb|A0A2H9EHM4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=230 residues).
KNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRHGYSH
NLFTVSNAHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQMPPNPSELLMRDRMRQLLEWANDHYDLVIVDTPPMLAVSD
AAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGYSYSEKE
>gnl|bykdb|A0A2I8SDU4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Citrobacter freundii complex sp. CFNIH3] (length=215 residues).
MEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRHGYSHNLFTVSNAHGLSEYL
AGKDELNKVIQHFGKGGFDVITRGQMPPNPSELLMRDRMRQLLEWANDHYDLVIVDTPPMLAVSDAAVVGRSVGTSLLVA
RFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGYSYSEKE
>gnl|bykdb|A0A2I8SU55 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=215 residues).
MEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRHGYSHNLFTVSNAHGLSEYL
AGKDELNKVIQHFGKGGFDVITRGQMPPNPSELLMRDRMRQLLEWANDHYDLVIVDTPPMLAVSDAAVVGRSVGTSLLVA
RFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGYSYSEKE
>gnl|bykdb|A0A2J4QEC3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella michiganensis] (length=339 residues).
AVYMQLLNRQQELSIAKSSAIGNVRIIDTAVTETKPVKPKKMLIVLAGIALGLMVSIGLVLLRVFLRQGIESPEQLEERG
INVYASIPVSEAFAKKAVQKQYWTKTPNSESHGFLAVENPADLAIEAIRGLRTSLHFAMMEARNNVLMISGASPNAGKTF
VSTNLAAVIAQTGKKVLLIDTDMRKGYTHKLFNLSNDNGLSDFLSGKTEMSKALKKVSPVDFDFISRGAVPPNPAELLMH
RRFGELISWASQNYDIVVLDTPPILAVTDAAIIGHYAGTTLLVARFEQNTAKELEVSFKRFEQSGVIAKGCILNGVIKKA
SSYYSYGYSNYGYSYTDDK
>gnl|bykdb|A0A2J4YQQ6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella michiganensis] (length=523 residues).
FTIGYLSRLKAITDLQENLIVADQGKDTGMLTLSLTGDNPALIERIINSITENYLAQNISRQAAQDAKSLEFLSKQLPQV
RSDLDQAEDKLNQYRRQSDSVDLSLEAKSVLDQIVNVDNQLNELTFRESEISQLYTKEHPTYKALMEKRKTLQDERGKLN
KRVSSMPETQQEILRLSRDVESGRAVYMQLLNRQQELNIAKSSAIGNVRIIDSAVTQPKPVKPKKILIILIGIIFGAMVS
AGLVLLRIFLRRGIETPEQLEELGINVYASIPVAESFTKNITQTKGWRKKTTEEIQGFLAVDNPADLAIEAIRGLRTSLH
FAMMEARNNILMISGASPNAGKTFVSSNLAAVIAQTGKKVLFIDTDMRKGYTHKLFGESNANGLSDILSGKIGVEKAIKT
ISSAGFDYISRGMVPPNPAELLMHRRFGELLSWASVNYDIVVLDTPPILAVTDAAVIGNYVGTTLLVARFELNTAKEIEV
SVKRFEQTGVVVKGCILNGVVKKASSYYGYGYNHYGYSYTDKN
>gnl|bykdb|A0A2J5PAJ7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella michiganensis] (length=308 residues).
TQPNPVKPKKVIILLVGFILGGMVSIGLVLLRVFLRQGIESPEQLEERGINVYASIPISEAFTKKAVQTYGLRKKQQDEY
QGFLAIENPADLAIEAMRGLRTSLHFAMMEARNNVLMISGASPNAGKTFVSTNLASVIGQTGKRVLLVDTDMRKGYTHKL
FNVSNENGLSDFLSGRTELSKVIKKVPQVGFDFISRGVAPPNPAELLMHRRFGELITWASSNYDIIILDTPPILAVTDAA
IIGNYAGTTLLVARFEQNTAKELEVSFKRFEQSGVLVKGCILNGVVKKASSYYGYGYSHYGYSYTDDK
>gnl|bykdb|A0A2J6J6K6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfuromonas sp] (length=269 residues).
MSRIEQALEKSSKLRERQGEVHPPLPVAPVLGTDPDMSRLQTDCPVQVDNPLLAALDENYTTVSEEYSKLRAMIVKLTKG
ETFKNTLMVSSTVSGEGKTLTALNLAIALAREYDHTVLLVDTDLRRPSVHTYLELEPEFGLIQCVKEGIPLDRALIKTGI
GKLVILPAGGTLPDPVEFLSSNRFKDLVSELKTRYLDRYVIFDTPPMLPYADAQVLNDSVDSSLFVVREKMVKLQPAKKI
IEGLRKTNLLGVVYNDAQSSSANSPYSYY
>gnl|bykdb|A0A2K2H9Q8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Geothermobacter sp. HR-1] (length=269 residues).
MSRIDRAIEIAADIQARRVPESAGSRVAAERTADRAGCYPAVAPIQVESEWLVALHQPNGVVAEEYKKLMTQILQTMSEG
ACRNSLLITSSVTGEGKSLTAANLALSLARQLDHSVLLIDADLRRPHLHEVFAIGQSPGLVECLAGEADLAEAMVHTGLG
KLAILPAGTSSTNPQELISSHQMRAFVEDVKQRYRDRYVVFDSPPVLPFADATILGPLVDGVLYVVREKVANIVEVREGL
EQLRGSYVLGTVYNCAASLKRPGYGSYGY
>gnl|bykdb|A0A2K4KWF7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas sp. DP16D-R1] (length=263 residues).
MEIIKPTGDKAEQPASSSLVTTSTGHSATLNALSYVQTKVVPLRADHLERNRIVAYNKNSSMGGAFDLLRTQVLKAMEEN
GWRTLAITSPTPDSGKTVLAINLAMSIAHHTTKTALLVDFDLRRPKVGACLGLPMEKSLNELLADEAELQDVLVNPTLPR
FVVLPTREPIPLSTEVLSSPAVSHLISDLRDRYNSRIVIFDLPPVLSSDDVITVLPKFDCVLLVVANGMNSKKEIEESLH
HLANANLIGTVLNKAEPQNRSYY
>gnl|bykdb|A0A2K8U7M6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Candidatus Thiodictyon syntrophicum] (length=566 residues).
MTPLGNSRLVSVAFDSPNPAEAAAVAQTLAENFVNSGLERRYEASVPARAFLDERLRAAQAALADAERRLAAYADEHRII
DLDGQRTLLLERLKALGRQETAAFAAQLAAQTEARQAGTDAAATDSPVIQRLQARKAELSADYQQQLKVFKPGYPKMQQL
RRALAELERQLRQEATAIGSAARAAAAARAHQEARLAERGDEVRAQLRDLQVFGGGYRVLEREVADHQERHDALLARMKS
LESAAGPGINPIAIVDRAQVPRAPYRPDLGKNLSLALALGLLGGVALALVREARDDRLRTAHEVQRHTGAPVLALIPQVG
RGRAAPANAGPALLTWRDPASPLAEAFRTLRTALVFATPAGAPRVMHFASAAPHEGKSSAACATAIAFAAAGSRVLLIDA
DLRRPCLHQVFGLSNAAGLSDGLTGTAAPLTQATAVDGLHVLTSGPPPTQPVERLAGARMGDLIADLGGQFDHLILDGPP
VMGLADALVLAHLADATLLVVTAGRTRTGALAETAQRLRSADANLLGTLLITPDDGVSRYGYGAAAPDSGRDAVPHRQAL
PPRRQG
>gnl|bykdb|A0A2K8WHP8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sagittula sp. P11] (length=278 residues).
MPPLSLTPEQRSHPAPAPGPAPAPAPAPRPEARRPQPDTAWLDLPVARFELGQLNHNRVVTADRLDPAHATFDVLRTRLM
HTLAERGWKRVAVTSPGKGCGKTFTVANLAISLSRQENTRTLVMDFDMRRPNLHRVLGVDSPGPIGDMLRGRIAPEDHLI
RLGENDFNAGHNIAFGLNTVTEPYASELLQDPRTRSTLERIEEELRPDVMLFDLPPALSFDDVIAFQPLFDGVLLVVGGG
LTTEREIKEVERRLGTETPLLGMILNKAEGVDVGRYAY
>gnl|bykdb|A0A2M7C324 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Gallionellales bacterium CG03_land_8_20_14_0_80_55_15] (length=390 residues).
MQVADVVSGFEREYEMARANESALAGSVAEAKQSIQGSNRKEYELSALERDVKTNQELYDVFMGELKGTAAVSGMQTVVA
RVVDPAIVNDTPIKPRKFLVVSTAFVLSLLLAIAIAFLMEYLDNSVRSAEDAERKLGLPLLAAVPMVELAGGISAGLLYR
DAPKSLFAEAIKTIRTGIVLSGIDHPKKTLVVTSSVPGEGKSTVAIDLALAHAQTKRVLLIDADMRRPSIAKVLGLNNTH
PGLSMLVLGMEKLENCVYKIEGSTLDVLTAGSIPPNPLELLLSEKFKALLVELGEKYDTIIIDSPPVQLVSDAVVLASMA
TGVIFVLKADATPFQLARRAIFTLQRGGAVMFGVVLNKANFRNEEYYGGYGKYNYHSYYGADEDKSASKA
>gnl|bykdb|A0A2M7JRZ7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Deltaproteobacteria bacterium CG_4_8_14_3_um_filter_45_9] (length=617 residues).
MTGLFTSSKKNAPSEKEISENKKDTALIDQFLSKLKVEPIRNSRLVKVHFDSNYPELSAKVPNTLAVTYIQQSVESRFIA
TEQVKEWLTKQLEDLKAKVERADEALQAFGSKHDIISLEEKENVTMQRLTELNEVLTKAESERMAKEALYRQTKDKHFDA
LPSILENKLVMDLKQAYIQLEAQYMKLSETFKPEYPEMVRLKNQMQSIQRRMDVETNKIIAGIKNDYESNLRRESLIRQA
FEQQKAKVMEMKEQGIQYNILKREADTNKELYKGLLQRMKEAGVSAGLTVSNIQVVYQAEIPTGSYKPNKKLNLLLAAVV
GLFLGIGLAFFFEYLDNTVKSPEDVEQLIRLPSFGMVPEISYERKKRLAKASYPVELVTHGHPKSILSEAYRNIRTSILL
SFSEKPPKKIVITSPNPSEGKTTTVINTAIALSQTGAQVLIIDGDMRHPRIHKIFNEENGAGLSNFLSGNSPLDSIIKKT
EVPNLYYIPSGPIPPNPSELIGSKLFKVMMDSLGKKFDHIVLDSPPALGFADSVILSTTVDGVILVVLGGKTPRETLQRA
KEVLHQVNAKILGVVINRVDIHRSGYGYYYYRYHYYYGKDGKKKELPYSSEGDSVST
>gnl|bykdb|A0A2M7JX59 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Deltaproteobacteria bacterium CG_4_8_14_3_um_filter_45_9] (length=294 residues).
MRSALCPMRGFVMSRVFRALEKAEEEKKQKEKEKPSLKVFEEKTVLKKEAPTLKFPKEKIGEIKALELPSKEEVPVLIAP
PDSFAAEEFRKLKTQIFQRLPNSPHSILIASATPQEGKTMVAVNLAMAISEEIHRKAILIDADLRKPGIHLEKNKSAKGL
SNYLSDGAPLSEILINSEVENLRIITAGSPTRKPSELIGSKRMGELMKSLSEQGENTYVIIDSSPIISTTEPTLLSKMVD
GIILVVMADRTPRESIQRSIKSIDRQKVIGVVLNQIDLKRSSYYSKYYNKYYRK
>gnl|bykdb|A0A2M7WWF7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Xanthomonadales bacterium CG_4_9_14_3_um_filter_62_6] (length=250 residues).
MVPRLKESADSDDAPIRYFAAHPQSSFAEAIRTIRTGVLLSVVDHEHKRLLITSSVPGEGKTTLSMNLAFSLGQMKKVLL
IDADMRRPTLHRGLPDQRQSPGLSEYITGEAKVSDCLRQLPDSNVYIMPSGLAPPNPLEILSSRKFADALESLSKAFDHV
IIDCAPACAVSDALVLSKLVNAVIYVVRSDSTQWQIARNGVKRLARIGAPVIGAVVNQVLPRKTGYAYGKYYYHGDGYYS
DYGYAKRKKS
>gnl|bykdb|A0A2M8B0G5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Deltaproteobacteria bacterium CG_4_9_14_3_um_filter_65_9] (length=244 residues).
MGGGRPGTESPSGRIGILNLRSIDPFYYEMVKGLRAKVEYKMDSLNLRVLAVTSAVAGEGKTLTATHLAANMASTGRKKV
LLMDLDLRKSGIARELGMSANPGLSEYLSGAVPVERIVRNSVVPGLSVIVGGKTVSSPADMLAGERFRSLLQGLRERFDL
IILDTPPVLPVPDAVTISEQVDAFILLFRFGYTPHQLFRQAIDELGERKIVGVVLNGEEKKPDKYYHKYYGKYYQVANTK
GKPA
>gnl|bykdb|A0A2M8J3R9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudooceanicola lipolyticus] (length=287 residues).
MDRLQQAISKARTQREDVETGAYRDPGAARTAPRTGRDRARRGAASATEVAANWSEFAQLELSDRTVERNRLIAYATGES
AIPFDMLRTKIIQQTRKNNWKRIALVSPESGSGKTTVTANLGFSFGRMRDRRTMIFDFDLRRMGLARLLEHKTAHSMADV
LERRVPFAEHGICHEGNVVFGLNRERVQNPSELLQSPVTMEVLDELEAMYQPDLMLFDTPPLMVSDDSQGFLQSVDCALL
IAAAEHTPMDRIDVAERQLSELTNVLGIVLNQCRYTGGAHGYENEYY
>gnl|bykdb|A0A2M9DPX7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfofaba hansenii] (length=313 residues).
MSKIIDAMKKAKMELDGNKKGGKICKTPDSPISEAVPKAVVGKGAGENAGQLSPVGGNCGGGALGAIETRSTGPRRGEPL
LAMDPNLVTLSKQKSVEAEQFRMLKTKLLFPARGTPPQSIMVTSALPGEGKTFVACNLAVTMAQSLDQYVLLMDCDMRFP
NVHSCFGFERPPGLCEYLNGTSPLSSFLLKTEVDKLTILPGGKPPENPSELLSSGLMADLFQEIKGRYRDRYIIVDSPPP
QFTAESRALARRVDGIVLVVKRGIAPREQVLQLLDILGKEKVLGVVFNYFYLEDMTGYRYAHYGRYGHGRSKG
>gnl|bykdb|A0A2N1WQN5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Gammaproteobacteria bacterium HGW-Gammaproteobacteria-9] (length=331 residues).
NKTQELDIIRAGTVGNVRIIDHAAADLENPVKPNKPLVVIVATLLGALLATAFVYVREALKRGVENPEDIERTGTPVYAS
IPFTEKQSALEKRLANFKRDKSTASYLLTINDPADLATEAMRSLRTSLHFAMIEAKNNVLMITGPSPAVGKSFVTTNLAA
VVAQSGKRVLLIDADMRKGYLHKVMRCDGDKGLSDILSGRITLFDAIQKTQLNNLHVITHGQLPPNPSELLMHENFSRFV
KEISHMYDLVIFDTPPILAVTDAALVGSQAGTTLMVTRYGLNGLKEIEAAKRRLEQNGLLVKGVIFNAVVRKASTYGEYG
YYQYEYASNSK
>gnl|bykdb|A0A2N1XK22 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Gammaproteobacteria bacterium HGW-Gammaproteobacteria-5] (length=234 residues).
KRDKSTASYLLTINDPADLATEAMRSLRTSLHFAMIEAKNNVLMITGPSPAVGKSFVTTNLAAVVAQSGKRVLLIDADMR
KGYLHKVMRCDGDKGLSDILSGRITLFDAIQKTQLNNLHVITHGQLPPNPSELLMHENFSRFVKEISHMYDLVIFDTPPI
LAVTDAALVGSQAGTTLMVTRYALNGVKEIEAAKRRLEQNGLIVKGVIFNAVVRKASTYGEYGYYQYEYASTSK
>gnl|bykdb|A0A2N2G716 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Deltaproteobacteria bacterium HGW-Deltaproteobacteria-23] (length=287 residues).
MSRRTQTQKVAAVDDKPEVVQESASAMTGISRFTDPLLKVGSSDNEPIAEEYRKLKAVIMQTARKQGMPYILLVASAVGD
EGKSVTAVNLALNIARDNDQHVVLVDADLRKPSLAKYLNLNGDTGLADFLRGSLSLKDSLVPVGVKKLLLMPAGKTLGNP
VELLSSERMKLLIEQLRCSVPPAFVIIDTSPLLLFAEGRVLSSLVDGVIFVVKAGGASKLHISEALSTLKDANVLGLVCN
QATDAITHRGYGYNYYSYYDHYRQGADQRKGGKPGVISRLFGQDGRR
>gnl|bykdb|A0A2N2GVE1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Deltaproteobacteria bacterium HGW-Deltaproteobacteria-22] (length=749 residues).
MAEPLGPFDAAPANNNAPAQTQVDWKRIFHIVRNYFWIVLLTCGVGVSLAFFVTKKQTPLYRTSCSVVISSQLPSYLGST
VKSNLAETSEDFWYEQRYLATQIEVIKSRNIALLAARRLENVDLHQLLGQPQFAHREPTEEELQRAAGVMRGMIQVIPVP
ESRLVNISAVSTMPLMAKKVADAITEAFIDDNLERRLSSTKSASTWLESQLLSLRKKLDEDEKRLYEFKLKNNILAVSLE
ARIQSTTGLILSRSNSVETLDGMARELRAKIQQVRRMRTTDPTLDPSADFLNKPAIVSLRSRYHSAQEKLKEVQVEVMER
HEEVIRQERILDVVRGQLTSELALSEDALVAEYQLKERNLQESRALMLQAQEEALALAALDIEHSKLLRERNETAKLYEL
VLSRLKETGLAEELKTNNIRLLDAAQIPLAPFKPVLWLNLALGLALGMFFGVAFLFLLFYLDNTIKSQEEAEQYLGSSLL
GYIPLLPFQSGGDPNELYIFKHPQSPIAESVRAMRTNILFMAPDRNLRTFSLTSASPLEGKTTLSTYLAISMAMGGEKTL
LVDADMRRPRLHKVFGLKPKFGLSSLIVKKSGYDESIVHSPVPNLDLLPCGPIPPNPSELLQSSNFKDVYAGLLERYDRI
IFDSPPVGLVTDPAIIGQIVDGIMVVMRYGKTTRHLLRNTSKILAGVKINILGGIMNYVDTHRWGDRPYYYRKGRGKRGG
YYAYYSHYGSDESENEEKSGEKPTPEEKN
>gnl|bykdb|A0A2N2H8D2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Deltaproteobacteria bacterium HGW-Deltaproteobacteria-21] (length=268 residues).
MGKISEALERHNKENSVKKSTVPPMFVSETLSGPEARLKPLGPLSGYDHRLVVLSDPHSLEAEQFRMLRAQILFPREGKV
PKTIMVTSSYPGEGKTYVSANLAASIAQGINEHVLLVDCDLRNPSIHKILGYSNNEGLHEYLTGEKQLPDLIIRSGIEKL
SLLCAGGPSRNSSELLSSAKMKTFIQEVRDRYHDRFVIIDATPTQVTSEPNVLANIVDGVVFVVMAERAPRASVRKSIDL
MGREKTLGVVFNGYSEEMKFHKKYCAQY
>gnl|bykdb|A0A2N2IB15 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Deltaproteobacteria bacterium HGW-Deltaproteobacteria-18] (length=266 residues).
MSRIEDALAKAAGMQAGFYSKGNMAAGPGIVRVPMGESTSVGGVRLAEETMVVINAPLSPMAEEYRKLKEALIKMTKRER
FDNLIAVTSSTAGEGKSMTSVNLAASLAGEYDHTVLLVDADLRRPAVHKYLGLGACKGLSDCMREGLDVGELLVKTGIGK
LSVLPAGTPTPNPVELFSSDAMRNLFREIKIRYGDRYIIVDTPPVLPFAETRSIASIVDGVILVVKEGMPSLDQIEEAIE
ALDQKVLGIVYNGAHLQSRSSYYYAE
>gnl|bykdb|A0A2N2INV3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Deltaproteobacteria bacterium HGW-Deltaproteobacteria-17] (length=747 residues).
MAEPLGPFDAAPASNNAPAQTQVDWKRIFHIVRNYFWIVLLTCGVGVSLAFFVTKKQTPLYRTSCSVVISSQLPSYLGST
VKSNLAETSEDFWYEQRYLATQIEVIKSRNIALLAARRLENAELHQLLGQPQFAHREPTEEELQRAAGVMRGMIQVIPVP
DSRLVNISAVSTNPLMAKKVADAVTEAFIDDNLERRLSSTKSASTWLESQLLSLRKKLDEDEKRLYDFKLKNNILAVSLE
ARIQSTTGLILSRSNAVETLDGMARELRAKIQQVRRMRTTDPTLDPSADFLNKPTIVSLRSRYHAAQEKLKEVQVEVMER
HEEVIRQERILDVVRGQLTSELALSEDALVAEYQLKERNLTESRALMLQAQEEALALAALDIEHSKLLRERNETAKLYEL
VLSRLKETGLAEELKTNNIRLLDAAQVPLAPFKPVLWLNLALGLALGLFFGVAFLFLLFYLDNTIKSQEEAEQYLGSSLL
GYIPLLPFQTGGDPNELYIFKHPQSPIAESVRAMRTNILFMAPDRNLRTFSLTSASPLEGKTTLSTYLAISMAMGGEKTL
LVDADMRRPRLHKVFGLKPKFGLSSLIVKKSGYDESIVHSPIPNLDLLPCGPIPPNPSELLQSGNFKDVYAGLLERYDRI
IFDSPPVGLVTDPAIIGQIVDGIMVVMRYGKTTRHLLRNTSKILAGVKINILGGIMNYVDTHRWGDRPYYYRKGRGKRGG
YYAYYSHYGSDESENEEKSGEKPTPEE
>gnl|bykdb|A0A2N2KC63 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Deltaproteobacteria bacterium HGW-Deltaproteobacteria-15] (length=268 residues).
MGKISEALERHNKENSVKKSTPPPMFVSETLSGPEARLKPLGPLSGYDHRLVVLSDPHSLEAEQFRMLRAQILFPREGKV
PKTIMVTSSYPGEGKTYVSANLAASIAQGINEHVLLVDCDLRNPSIHKILGYSNNEGLHEYLTGEKQLPDLIIRSGIEKL
SLLCAGGPSRNSSELLSSAKMKTFIQEVRDRYHDRFVIIDATPTQVTSEPNVLANIVDGVVFVVMAERAPRASVRKSIDL
MGREKTLGVVFNGYSEEMKFHKKYCAQY
>gnl|bykdb|A0A2N2KDY5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Deltaproteobacteria bacterium HGW-Deltaproteobacteria-12] (length=275 residues).
MNLKNYFPRTKKVEPREANASKNFMPLIMPADKEKIGWVSPVYSKSRAIKLDPDTLAKNRLVAMIPNSPEIDFYKVLRTR
ILRRTVDQGGHSLMITSALPGEGKTVTAINLALTFAKEYEQTVLLVDGDLRMQRIHELMGYESDKGLLDYLIDDCPVSDL
IVWPGIEKLSVISGGRTINESSESLTSPRMRELVADMKSRYPERYIFFDVPPVLAGADAMAFAPLVDWIIFVVHAGQTSM
QDVNRALQVLPQEKILGLVLNRQTTQLKAYPYRYG
>gnl|bykdb|A0A2N2KML4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Deltaproteobacteria bacterium HGW-Deltaproteobacteria-12] (length=301 residues).
MGKMYDALQKVEREKFTEQRDEAPKTSSEDIILDDKLVAYFQPSSMVAEQFRRLRTFIIKNKPDDQSPKTFLITSAMAGE
GKSLIAVNLAIIIATELHSHALLVDCDLRNPSLSRLFGLSEKKGLSAYLAGDAKIEDLLIKTTIDKLTFIPGGAQEENPV
ELVGSNKMKSLVQDLRSRYNDRFIIFDSSPVLATTEPSILNKMVDGIILVIKSGETPRESVVQAMKMLEKEKILGVVLND
LEFKTDAMIQRNFGTHKYYYDYRYAKTNPEPGAWGKVVALAGDMKILLRKLKPGKDKDIHT
>gnl|bykdb|A0A2N2KTJ4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Deltaproteobacteria bacterium HGW-Deltaproteobacteria-10] (length=300 residues).
MGKMFDVLQKLEREKTADQKKEEPAIVSDPDNQVLDNKIVSFFAPSSMVTEQFRRLRTHIIQPNQPNSPKTIVITSTLSG
EGKSLIAINLAIIIAVEMQSHALLVDCDIRNPSIARLFGLKDTKGLSNYLLGEAEIPDLLIKTSVDKLSLIAGGPLQENP
VELIGSERMKNLIQELKTRYKDRYIILDCSPLLATTEPTVLTEMADGILMVIKSGKTPRESVQQALRLLNKDKIMGVVLN
GMEYRTKALIQRHFGTNRYYHDYHYSKTHPEPDNWEKAALILKDIKMLLLKLIPHKKGER
>gnl|bykdb|A0A2N2LQX0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Deltaproteobacteria bacterium HGW-Deltaproteobacteria-1] (length=300 residues).
MGKMFDVLQKLEREKNIDQKKEQPAIVTDPDDQVLDNKIVSFFAPSSMVTEQFRRLRTHIIQPNQPNSPKTIVITSTLSG
EGKSLIAINLAIIIAVEMQSHALLVDCDIRNPSVARLFGLKDTKGLSNYLLGEAEIPDLLIKTSVDKLSIIAGGPIQENP
VELIGSERMKNLIQELKTRYKDRYIILDCSPLLATTEPTVLTEMADGILMVIKSGKTPRESIEQALKLLNKDKIMGIVLN
GMEYRTKALIQRHFGTNRYYHDYHYSKTHPEPDNWEKAALILKDIKMLLLKLIPHKKGEH
>gnl|bykdb|A0A2N2TRC8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Betaproteobacteria bacterium HGW-Betaproteobacteria-16] (length=281 residues).
MERIKLAIEKAKTGGQSALAVAIEPVGESNQVSETAAAPEVPHLSPASIQYQKTPVVRLDEKHLEQHRIVAHQKSHQASW
AFDVLRTQVLQQMEEKGWRTLAITSPTVESGKTMTAINLAISIAQQPDRTALLVDFDFRRPRVAASLGLHQNLSLNEVLE
DKADVAAALVNPGMERLVVLPTHRPIAKAAEVLSSSKVSHLIADLRDRYQDRTVIFDLPPMLVADDVMAVVPHMDCVLLV
IANGASSEKEIEECMMRLSKTNLLGVVLNKEESSSTQANYY
>gnl|bykdb|A0A2N3BB54 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Alphaproteobacteria bacterium HGW-Alphaproteobacteria-5] (length=266 residues).
MAEADPPPSNDIKMLTLDALPVFTPPVKAIRKHRIIGFDNRDSRARPFNLLRTSFVKKLKEDGHRLIGITSATPAAGKSF
LSMNLASSLARVTEEPVFLIDLDIRRASLAEEIGLVPEFGIESYLDGRCDDLAAIGHRIDGTRLGLFPTLRKSGNTAELL
AGERFSLMIETLRERSEASVVLFDLPPTFANDDAMISLEHLDGFVLVIDAGKTTRQHVHDVLDMLQPTPCIGSILNRYRG
GLGDSYGYGYGGPDYARYYDRAEPGT
>gnl|bykdb|A0A2N3BVE7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Alphaproteobacteria bacterium HGW-Alphaproteobacteria-6] (length=281 residues).
MEKLEAALNKAREMRQTALGAPQGPGGRPAPGAAAAVVAAVPDQFDWLALPAISVPVGKARRSRISVLFGGKESTPYDLL
RSRMVRTMKEKDWSRVAVTSPGAACGKTTVSLNLALSMARQKDLRIMLVDLDLRRPTLHKAIGHQPKHSFHEVLDGSVAF
ADQAVRIGDNLIVATNNSPARHPSELLQGAATRERLDEIEKLWKPDVMIFDTSPMLASDDNVGFLGNVDCALLIAAAEST
TLANIDLCEKDLAQLTNVIGVVLNKCRYADDTIGYDYGVYG
>gnl|bykdb|A0A2N3CNV1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Alphaproteobacteria bacterium HGW-Alphaproteobacteria-2] (length=284 residues).
MERLQEALARAREQRRHSERATPGQADAATPEKERPAPARQAPAGPRAQARWEDLAPLQIRPVALKRHRVLAHEGGRDAA
PYDLLRTKIMYQAKTNNWRRIAIVSPDPACGKTTTLANLAFSFERQRDMRVMIIDLDLRRPMLQAVLSQDCDHSMADVLE
RRLTFAEHGRRLGARVALGLNGSHAPKPAELLLSQQSREVLAQIEADYAPDLMLFDISPLSVSDDNIAFLQNVDCAVIVA
AAEETPVSRIDQAERQVAELTNVMGVVLNKCRYEDAADSHGYYY
>gnl|bykdb|A0A2N3D2J1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Alphaproteobacteria bacterium HGW-Alphaproteobacteria-16] (length=459 residues).
TAYANARSKRLEAEQRWQQARGSAIFSLPDVLNNGTIQQLTQRRAQLQAEYQEKGRLFRSDYPVMVQLAAQIAEVNRQID
REAGNVRSAIRTEFEVARDQEGALQQEVSALKSTTLDEQRRSIQYNILRREADTNRTLYDALLQRFKEISTIAGSQSNNI
TIVDPAVVPGSPTSPKPLINLLLASLLGLGLGVIIALARERFDDTIRTPADLSEKLGVPLIGTVPKITDSGPLLDVLRDV
RSELSEGYASVRTALQFSTAHGAPKSILVTSSRPSEGKTTTSFATALSFTRLGKRVLLVDSDLRNPSIHAAVDLKNTAGT
SDVLSGQSRPDEVVRETEFSNLSVITAGPIPPDPSMLLSGTAMASMIDTLAARFDIIIVDGPPVMGLADVPLISRAVDGV
MFVIESGKTRRGMSRASLDRLHAAQAPIIGALITKFDQRNAAYGTDYHGAYEYRYKARS
>gnl|bykdb|A0A2N3EZ05 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Alphaproteobacteria bacterium HGW-Alphaproteobacteria-1] (length=343 residues).
MRQAPEAEAEDATLSRHEAYMRRRAARLEAEAAAPDETEPEPEAALEKGLARRGDPVTLSEPEPEPEPEPEPEPEPEPEP
EPEPELSPEMEADAPPDSGARIAATWAALRPVPLDARHLTRNRLISASRDDPAHVAFDVLRTKLMGVLRKQGWSRVAITS
ATSGCGKSFVAANLAISLSRKAGLRTVLMDADLRRPSLARLFGVKEPGTMGRFLSGEIAPEDYLVRPAPNDLNIGEGLAL
GLNDRAESYAAEILQSPVAVDALAALGARLAPDVVIFDMPPALYHDDVLAFRPQFDGVLIVVAGGQSTTQELRDLKDRLG
SDTPLLGVIMNRAEGEDITRYEY
>gnl|bykdb|A0A2N6BEI9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Deltaproteobacteria bacterium] (length=285 residues).
MSRLEKAVEEALKRKGGVSVASTEDEEGTPLNSPPVETPGEGDAALLSGQTEPSLPPLRERINELVVRYREDNPKAAEEY
GKIKSRLMRIAERDSAIKRLLITSALKGEGKSLTTLNLAISLARSYEQNVLMLDTDLRNPSLHKYLGLDEGPGLIQCFRD
NLNVRDAIVETGISRLKFLPAGGTVSDPVELLSSSKPKEIFSQIQMADPGLFMLFDAPPILPFADVHSLLPEVGGVILVV
REGFPSRKHLTQALDALDEAHYRGVIFNGASTSYINKEDSYGYSY
>gnl|bykdb|A0A2N6BZD5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobulbaceae bacterium] (length=317 residues).
MARSIRVGKVFKALNKGASTDEADLPWDADSSHEPLAGDSSLPEAEPAGLTDHQAPPTPPLPPSQAIPPPFRENLDTGAM
VDNWNERLVAALGTASAPAEELRRLRTSILHPPAGKKPARTILVTSAMPEEGKTFICAGLAVTLAQGVKEHALLVDCDLR
RPLLGEMFGLANDQGLVDHLARGVDLGRLIRKVGHPKLSVIPSGPPPVNPAELLGSERLLTMINEVAERYADRYIIFDSP
PLLKAAETAILAKHLDGVVLVVREGGARREDIQQLVETIGPEKIIGVVFNAYQTNVLERKIYGSPSDYYSSHRQNNG
>gnl|bykdb|A0A2N6GLF5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sedimenticola sp] (length=638 residues).
MAEDVIAKLELTKHPEFQPEENKLISFDWKTWLKSYLPQQSGGAELDEAETFYDSVVEYYFERLKVTPVKNSQLVRVAFE
ANDRQLAADVANNLANIYIVNDLEARLSMTSKASDWLTQRIEDLGEKLKASEIALQSYREREKLIEVGGVSTLTAQQLQD
LGGQLVMAEQRRATAESSLRQINALKGQPVERLASIPAVLSDSLVSSLREAEAEAQRKVSSFSKRYGPKHPKMIEAQADL
TEARLNVQRQIESVIKGVEKEYQVARENEQSIKRSLGSAKGEMQQINRKSQELRVLEREVEANRQLYSQFLEKMKEAKET
TGLERVRARVSDPAVPAVKPIKPKKSLIVAIAGMLGLFLGVLLAFLQEHLDNTIKRASDLEEKLKLPLLGWLPHLKLKRK
DGESPLTFSREHTHSFYTESIRTLRTAILLSGLDDPYKVIVVTSSVPGEGKSTVSMNLADSLGELHKVLLVDADMRRPTV
AKTWGLSKDTFGLSEFVSGSAKISECVHQVEDGNIYVMPSGLIPPNPLELLSSKKFKEALDVLGKTFDHIIIDSAPTLAV
SDALVLSTHASGVIYVVKADSTPYPTAQDGLKRLRQSRAHIIGGVLNDVPQGKKDSYGRYGKYGDYGGYYGSYGYTSQ
>gnl|bykdb|A0A2N6VGL1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter ursingii] (length=227 residues).
IPILAVKHSDDVAIESLRSIRTAIHFALSGAKNNIIMISGPAPEVGKSFISTNLATIFAQGDKKVLLIDADLRRGYLHKY
FNLESQPGLTELLTDQASLTQIMHSTEVPNLSFISRGKSPSNPSELLSSQKFQTLLQELSQHYDHIILDTPPVLAVTDGI
IISQYTGVNLIVARHAKTQMKELELTLNRFEQAGTKVNGFILNDIQRSASGSYGYNYAYAYKAAKDD
>gnl|bykdb|A0A2N7XRV4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas sp. FW305-122] (length=262 residues).
MEIINSDTEKAEQQTSSKAMTPTAQSTSLNALSYVQTKVVPLRPGHLERNRIVAYNKNSNVGGAFDLLRTQVLKIMEENG
WRTLAITSPTPEAGKTVLAINLAMSIAHHTTKTALLVDFDLRRPKVGEYLGLPMDKSLNELLADEAELQEVLVNPTLPRF
VVLPTREPIPLSTEVLSSPAVSHLIADLRERYNSRIVIFDLPPLLSSDDVINVLPRFDCVLLVVANGLNSKKEIEESLHH
LGTANLIGTVLNKAEPENRSYY
>gnl|bykdb|A0A2N8BYF5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas sp. FW306-2-11AA] (length=268 residues).
MEIIKPDTENSEQQPSSSLVTMPKAMTVTGQSAGLNALSYVQTKVVPLRPDHLERNRIVAYNKNSNMGGAFDLLRTQVLK
VMEENGWRTLAITSPTPEAGKTVLAINLAMSIAHHTTKTALLVDFDLRRPMVGACLGLPMEKSLNELLDNEAELQEVLVN
PTLPRFVVLPTREPIPLSTEVLSSPTVSDLITDLRERYDSRIVIFDLPPLLSSDDAITVLPKFDCVLLVVANGMNSKKEI
EESLYHLGTANLIGTVLNKAERPSRSYY
>gnl|bykdb|A0A2R7SVD4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas sp. HMWF005] (length=544 residues).
AQDGVEVLVAQLAANPGTRFEVVRNPRIVTIQGYQDALDISEQGKESGIIRLALASADAAEAVKILNKIAALYVDQNVRR
TSAEAAQSLAFLQSQLPQVKRDLAKASDALNAYQTHGKTVNISLETQSVLGQSVALETRISELKMQQAEMDRKFTSQHPA
YRALMSQIGELTQQQKSLAGKVQDLPATQQELLNLTRDVEVASQIYTQLLNKSQELDIVRAGAVGNVRLVDTADVDLSSP
VKPKKALIVLIATLLGAFVGVALVLLRKSLSRGLEGPEAIEQLGLPVYASIPYSTLQQEEDGKKGRARDGVDKPAYLLAL
RNPTDLSIESIRSLRTCLHFAGLDSTNNRIMISGPSPQVGKTFVSSNLAAVMAQSGQRVVLVDADMRKGHLHKTLNTPIV
NGLSDLLVKRCSIEQAINKIEGANLHFISRGQVPPNPSELLMHANFRELLAQLSELYDVVIIDTPPLLAVTDAAIVGREA
GISLIVTRFGVNPAKEIELTIRRFAQNGIELKGAVFNGVEKRAASYYGNGGYGYYNYEYASDKS
>gnl|bykdb|A0A2R7TMW6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas sp. HMWF031] (length=266 residues).
MEIIKPASDKGESQASSSLVTTSSGQPAPAPTLNALSYVQTKVVPLRADHLERHRIVAYNKNSAMGGAFDLLRTQVLKAM
EENGWRTLAITSPTPDSGKTVLAINLAMSIAHHTTKTALLVDFDLRRPRVGACLGLPMEKSLNELLADEAELQEVLVNPT
LPRFVVLPTREPIPLSTEVLSSPAVSHLITDLRDRYNSRIVIFDLPPVLSSDDVITVLPKFDCVLLVVANGMNSKKEIEE
SLHHLGSANLIGTVLNKAEPQNRSYY
>gnl|bykdb|A0A2R8ATV5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Primorskyibacter insulae] (length=564 residues).
MSERRKFTRKKTQGAASSAALAPESRPVVSEEERREQIVAEKRRRAEESRQQRVAMRQAEAEARRQAEAEARRQAEEEEA
RQQAAAQAKADLQRRKAAAAARRRAEERRAAEEQARQAAEAAEERAQAKAAALARQKAEAIKRAKAEEAEEQARLKAEAA
KRAQAEEAARLQAEAKARAAEDARKQHEAEQAAREEAEAQARAKALADERAKIEAEAKAAEQTRQSQVARARTLKEEKAK
ALLVAAEKAEQDAAAEEDALNEAKERLIAARRRLKIAALTRKKLEAELQRTEAAISETEAEEPAAEPAPKLAAPAKVSAS
ADSEAAWEALRSFPVDEKHLERQRIITAARREPSHATFDVLRTRLLQALADKGWSRVAVTSPTKNCGKTFVAANLAISLS
RQENCRTMVFDFDLRKPSMAAVFGQSEPGSIGAMLRGETDFQDHLRCMGRNSIHAGRKLCFGLNDTQESYASELLADRST
ADLLNKIEGHYQPDVMLFDLPPALYFDDVLAMRNNFDAVLLVVGGGVTKPKEIKEVEQRLGPDVPLLGTVLNKAEGAEVE
RYTY
>gnl|bykdb|A0A2R8BKZ2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Defluviimonas aquaemixtae] (length=275 residues).
MEKLEAALAKAREMRKSALGPPDGTGDRVAMPRGAEPVIVWAALPEIALSPGKARSSRITALSGGKDATPYDMLRSRTIR
IMKDKGWSRLAITSPGAACGKTTIALNLALSLSRQKDLKVMLIDLDLRRPGLHRQLGQTPTHSFHDVLDGDVAFEQAAMR
IGDNLIIAMNKAASRHPAELLQSTATRTVLDEIERRWQPDIMLFDMSPMLASDDNVGFLGNVDCALLVAAAESTTLPNID
VCEKELAQLTNVLGLVLNKCRYADESVGYTYSSYA
>gnl|bykdb|A0A2S5ERE5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas sp. MWU12-2312b] (length=247 residues).
MTTSSGQPAPAPTLNALSYVQTKVVPLRADHLERHRIVAYNKNSPMGGAFDLLRTQVLKAMEENGWRTLAITSPTPDSGK
TVLAINLAMSIAHHTTKTALLVDFDLRRPRVGACLGLPMEKSLNELLADEAELQEVLVNPTLPRFVVLPTREPIPLSTEV
LSSPAVSHLITDLRDRYNSRIVIFDLPPVLSSDDVITVLPKFDCVLLVVANGMNSKKEIEESLHHLGSANLIGTVLNKAE
PQNRSYY
>gnl|bykdb|A0A2S5JE21 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Albidovulum inexpectatum] (length=277 residues).
MEKLEAALAKARQMRQQAMGTRRPVTPGEADKSRPESRADAWIDAFQEIVLDPARLERNRITALAGGREATPYDMLRSRS
LRFMREKEWNRLAITSPGAACGKTTIAVNLALSLARQKDLKVMLFDLDLRRPALHRVLGQAPSVSFHEVLTDRASFQDNG
RRIGDNLVVAMNAGPARMPAEILQAERTAEILDEIERRWQPDIMIFDTSPLLATDDNVGFLSNVDCALLVAAAEKTTLPN
IDICEKELAQLTNVLGVVLNKCRYPDTLAGYDYEYYG
>gnl|bykdb|A0A2S5LFJ9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Methylotenera sp] (length=287 residues).
MEKIKDALAKAKIENTESKSQFKAETKASSTLLQSGVVSQKEIKGFPNTENELGMINYLNTPVIKLDSAHLEKNRIVAQS
KSDVNSYSFDSLRTQILQKMEENNWRTIAVVSPTPQSGKTLVSINLAISIAQQPQKTAILVDFDLRRPKVAAYLGIHTEK
SMNDYLQDKAQLKDVMINPGIDRLVIVPTMKPVSKSAETLSSKKVTSLIADLRERYNSRIVIFDCPPVLNSDDAMVLLPQ
VDCVLLVIANGMSTQSEIEETLHHLPKENLLGIVLNKAEIESKAYYY
>gnl|bykdb|A0A2S5ZLM1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=233 residues).
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
LLIDADMRKPAMHQMFQVDNIFGLTNVLTNSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMKELLGQAYSMYDL
VIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
>gnl|bykdb|A0A2S6HE06 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Methylobacter tundripaludum] (length=251 residues).
MIRNTDKYPLDSIRYTKTHSVMIDPDVLRNNRVIMGLNNDPRADYFRVLRTTVLKQLRENNWNSFAITSATPEAGKSFIS
VNLAIAIAMEGNQSVLIVDADLRRPSVGQYLGLQCEFGLVDCLTSDVPLEDVLVNPGIERLVVLPGKISDNNSSELISSR
KMISLIQEIKSRYESRIIILDLPPLFAADDAMVLMPYADAALLVVEDGKNTSEELQHSMYILEQTNLLGLVLNKSRQPLP
IYQYDYQYTRD
>gnl|bykdb|A0A2S8S361 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Defluviimonas denitrificans] (length=275 residues).
MEKLEAALAKAREMRKSAVGGGDVVRSRTVAAAAPVATTGWEDLPEVTISPEMAMRNRITALQGGKNAAPYDMLRSRTIR
MMKDKGWTRLAVTSPEAGCGKSTVALNLAVSLGRQKDLKVMLLDLDLRRPSLHRTLGHTPEKSLHDYLAGEAEFEQTAVR
IGANCLVSLNATYSHRPAELLQSQAARDALDAAERRYKPDLILFDMSPMLASDDNLGFLGNVDCAILVAAAETTTLPNID
ICEKEIAQLTNVLGVVLNKCRYSDDTIGYDYGMYE
>gnl|bykdb|A0A2T0RFH0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudoruegeria haliotis] (length=275 residues).
MEKLQAALAKAREKRESLGVDTTRGVKSHRASTDHEIADRWSSIRRIDVSERKKERGRLVSLNSNKDAAAFDVLRTKVLK
ITAANGWRRIAVTSPAPGSGKTTTSINLAVSLSRQPDLRIMLMDLDMRRPALAKALGQREQHSVEDFLNGRADFPDIARR
LSSNLILAMNHKPYREASDLFLREQTAQALDRVEADYQPDYMVFDMPPMLVNDDTAAFLGNVDCVLMIAEAGVTTIDQID
ACERELASQTNVLGVVLNKCRPGRGSNGYYYDYGY
>gnl|bykdb|A0A2T0VBD8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Halomonas ventosae] (length=236 residues).
MKHRRERHGHEVVTGILAERAPADTAVEALRGLRTSLHFAMLEAGDNRLMITGPSPGIGKSFLSVNLATVCALGGQKVLV
VDADMRKGHLHHAFQGRSEGGLSELLSGKAAWADVVRDSGIENLSYVARGTAPPNPAELLMNAGFTAFLEQARREFDLVI
LDTPPVLAVTDAALVGTQCGTSLMVARFQLNPAKELQIATRRLETAGVTVKGAILNAMERKAATRYGYGYYSYAYR
>gnl|bykdb|A0A2T1JE00 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio sp. V02_P2A34T13] (length=521 residues).
ELKANSWLNNRMGDLREKLKESEVQLQTFLKSEGLVDIQGVESLASQELEELTSQLNKTRDRRVAAETLYLVAQTYSRQD
SDLSALASIPEISNHPTIRDVKLAEVQAERKVSELSKRYGDKHPKLKAAQAELASVKRNLNFELKQLLNGINNELQAAKQ
AESSLHRELEKRKSEFQSLSVKNARYSELKREVQTNRELFDLFLSRQKETSASSDFNATIARFTDFANPPLAPSKPNRKL
IVLLAFVASFGLACVVAFIADAVNDTFLDIKQVEKQLSLSLLGIIPAIKTRGPLTLKTYFDSKHRELTEAIRTVRTGYLL
ANTNKEHHVVMVTSSLPEEGKTTSSINLAFSLAQMEKTLLIDCDLRKPSVAHRFGISGSQPGMSNLLIGTHTIEECLYTD
EESGLDVLTSGVVTDNPLELISSPKFASLLEELKTRYSRIVIDTPPCLAVSDAFMLSQYVDSTILVINAPQTRTKVARDV
VGRLTQQGARIDGVILNKLNTKKASNYSGYHQYQSYYGPEK
>gnl|bykdb|A0A2T1MXF1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=437 residues).
DVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQLNELTFKEAEISKLYTKVHPAYRTLLEKRQALEEEKAKLNGRVT
AMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITEASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGV
LLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARDSVKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQ
AQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLLIDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAK
FDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVLIDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRF
EQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A2T4ZJZ6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Nitrosomonas sp. Nm141] (length=447 residues).
KEQMEASIVALNEYKNQKGSVNLDIETQNTLTGVVEMKTQITLLQQKRDELRQKFTESHPNVIAVDKQIARLQSQLQSHN
QMIKTLPATQQVILELSGDVKVSTNLYSTLLNNAQTLRVAKAGTVGDVRIIDHAVLPNNAIKPNKPLIIGVAFALGLFLG
VVAVFVRKSLLRGIEDPDLIEKQLHVPVYASIAHSKEQEILSKELSKTNQSIRNNRPVVLSLRNKEDAAIESIRSLRTTI
HFSLLEAQNNIIVITGPSPGVGKSFLAVNLAIVMADAGKKILLIDADLRKGAINKLFGINRENGLSNVILSDISVQDVTK
EIPLANIDFIPTGTIPPNPSELLLHERFGQLLDGLSKQYDLIIIDSPPILAVTDAAIISRLAGATLMVIKAGMHTKRELE
QSIRRFSQSGVSIKGIVFNDMPQSSSRYGYGYHYGRYVYQYSYQKSK
>gnl|bykdb|A0A2T5R3J5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Geobacter sp. DSM 2909] (length=278 residues).
MSRIEKALEKAVQMRQEKAPERAPEKREPDAPAPKVFEADQHPEITSPYLITVQEPGSPVSEEYRKLKSLIVRMTQDKFL
NTIMVTSTCKGEGKTITALNLAITLAQEYDHTVLLVDADLRAPSITRYLGIKAEAGLSDCLSNGRDIGSALVKTGIGKLV
LFPAGSTVSNPVEMLSSSRMKQLMQELKNRYRDRYIIFDTPPVLQFAEAHAIGSCVDGVVFVVGEGQAPVNDVKEAFRLL
KDCEMLGVVFNNVASARFTEGYNYRYSYKYYKKSSYGD
>gnl|bykdb|A0A2T6MY81 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][gamma proteobacterium symbiont of Ctena orbiculata] (length=271 residues).
MEKLKKALDRARDQKNATVTENRHKKTVSQSPESVDLTKITYTSTKSINIPAEFLREKRVYSGNKSDPIFDQYKVLRTHV
LQSLKSNQWNSLAITSPNENCGKTLTSINLAISIAREVNQSVLLVDLDLRRPSILPHFMDEKLPGISDFINEDKELSELL
INPGLERLVILPGNESLENSSEMLSSPRVVKLVDELKNRYPNRIVIFDMPPVLSCDDVIAFSPYVDALMLVIEEGVTRKD
ELKRAYELTSKFNIVGVVLNKSKETYLAYGY
>gnl|bykdb|A0A2T6NBQ8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][gamma proteobacterium symbiont of Ctena orbiculata] (length=273 residues).
MEKIKQALERARDAKTSTQHRGNYQKVVRKSPEPEFTSKITYTKTKSVEVSKNSLRNKRVIVGDTNDQISDQYKVLRTHV
LQRLKANKWNSLAITSPNEGCGKTLTSINLAISLAREINHSVLLVDLDLRRPSIQQYFFSDEQPGISEYLTEEVELSELL
FNPGIDRLVILPGNKPFSNSSEMLSSPRMVQLVEDIKSRYANRMVIFDMPPVLLSDDVIAFSPYIDVVMLVIEEGVTRKD
DLKRAFDLLGEDNLLGTVLNKSKGNELTYGSYY
>gnl|bykdb|A0A2U0NMP8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella pneumoniae] (length=600 residues).
GLARLFNKTKNTIQVHKLFISPNMYDDNFITLTVKNDHQYSISGENIDFDGEIGRLIDKNGIRIQVDSINAEPGTRFLLT
YTSRINAINYLRDSLLIADQGKDTGMLTISLLGSDPDLIKRVIDSISDNYLEQNIARQAAQDAKSLDFLNQQLPKVRTEL
NESEDKLNAYRRQKDSVDLSLEAKSVLDQIVNVDNQLNELTFKESEISQLYTQEHPTYKALMEKRKILQDERAKLNKRVS
TMPETQQEVLRLSRDVESGRAVYMQLLNRQQELNIAKSSAIGNVRIIDNAVTQPKPVKPKKLIIIAIGLISGFAISLGVV
FLRTFLRRGIESPEQLEDLGITVYASIPVAEVLSNRAKQPSKIRFKKEEDANYTYLATSHPTDLAIEAIRGLRTSLHFAM
MEARNNILMISGASPNAGKTFVSSNLGGVIAQTGKKILFIDADLRKGYTHKIFNESNENGLSEYLSGKIKLEDTIKHLGS
EGFDFISRGMAPPNPAELLMHRRFGELIKWVSQAYDMVIIDTPPILAVTDAAIIGNYVGTTLLVARFEQNTTKELEVSVK
RFEQSGVAIKGCILNGVVKKASSYYGYGYAHYGYSYKDEK
>gnl|bykdb|A0A2U2CM86 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Maritimibacter sp. 55A14] (length=292 residues).
MDRLQMALEKARAKREQAGAPGPETRPFGDGSKPSAVEPAKPEPPREKQATPVEMPEVWKVLAPLHINEKEMIQNRLVSL
QGGPEAAPYDMLRTKIAQQARVRGWRRIALVSPHSACGKSTTAANLGFSFGRQEDKRTMVLDFDLRRMGLARILAQRCQN
SMGDVLTRRVSFQAHALRHGHNVIFGLNCSEVSNPSEILQSRQADEVLSEIEDTYEPDFVFFDTPPLMASDDSHGFLKNV
DCALLIAAAEQTTMDEIDVAERQLAELTNVMGIVLNKCRYTSGAHGYEYGYY
>gnl|bykdb|A0A2U8H9H9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Yangia pacifica] (length=363 residues).
MVERRKFQRRKRVDETPEDPPIFPLERRADRLARREAEREAEDARTEQGRADQMRTDQIRVAQIQTEQHRAEVETARRQP
AATRARTVTPLPAPEPLAPRAEAADPAPAPRRPITRRATPQAGALWDRLPVLEIDSVHLERNRIITASREDPAHAAFDVL
RTRLTQALAENGWTRVGITSPSKGCGKTFTAANLAISMSRQEGLRALLMDLDLRNPSLHKVMGMRAPGAMGALLRGVIPP
EAHLLRMGENHIHAGHNIAFGFNEVIEPYAAELLNAPATAEVITSIEARLQPDVMLFDLPPALYYDDVLAFRPQIDGVLM
VVGGGLTTEREIREVERRLGADTPLLGMVLNKAEGTNLKKYQY
>gnl|bykdb|A0A2U9NDY5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas sp. R2A2] (length=540 residues).
MEGQGGKGQSAERQAHPGTEGGRRRKRPQTTAREDQDRRKGGEAGKDAGSSDMAREEPDPQLASRVRDESSRRDGNQNSQ
RSAAEAAQRLDGLRAQRPQVRKELEKAEAALHDYQTSAKAVDSSSETKGVRDQSVQRETQLAERARKRVEDDRRYTREHP
TYRTLMTQMNELQAQKAQLLKKVDALPMTQQELLRRKRDMEVTTQTYTLLMNQAQEQDILRAGTIGNVRIIDNAYSMIEK
PSKPVRPLVVALALFVGLLVSAAVILLRQAFYRGVESPDVIEKLGVPVYAGLPYSASQEQLNRRRKTRDGKTRLLSISEP
TDLAVESLRSLRTSLKFAMLEARNKVLMITSPTPSVGKSFVSSNLAAVIAQTGQRVLLIDGDMRRGYLHTLFGMTPRNGL
SDALAGGLDLATIINRTELKNLHFISAGFSAPNPSELLMHENFSRLLKEAEKLYDFIIIDTPPVLAVTDAVLVAQQAGTN
LLVARFGLSTGSQIDASKRRLAQNGVLLKGVILNAVKRKASTSPYDSGAYGYYTYTTQKA
>gnl|bykdb|A0A2V2BX84 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=263 residues).
MPKKSKKDLSRKLIQNLDIEPGLRFRIEEAYKSIRTNIAFSVMKEGCKRVVVTSSLASEGKTTTTINLAISFAQAGQRVL
LIDADLRKPKVHQYFSMPNSPGLTNYLGASVQRGGSLNVSSVIHNVDCDNLSVICSGSIPPNPSEILGSEAMNKFLDEVS
KMYDYIIIDTPPILVVSDALPIIKSSDGVVLVVRQNSSTHPEIQKALSSLEFIDAKLLGFIVNFAESEGKTYYKYGKKSY
RYGYGGYSGYSYGYGYSPNDKRR
>gnl|bykdb|A0A2V2C254 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=239 residues).
MFKNKNKEVSNSFKREDAKKKLGNDSPFVVKEAYNSIRTNLLFTQKGEKCPVFVVTSPTANNGKTINSVNLAISYAQMGK
KTLIIDSDMRNPTIHRMFNIPLKDGLSEILAGITDSISVTSTNIENLSVLPAGQIPPNPAELLGSDRMNKLLDFVREHFD
CVFIDSPPINIVTDATIFASNVTGYILIIKSGVTDKEDVKYSVSILEQVNAKILGCILNDVPLKEGKYYSKYKNYSNYK
>gnl|bykdb|A0A2W4RFS2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Candidatus Methyloumidiphilus alinensis] (length=257 residues).
MSQETDQQPLSLIQYTHTKVTRTTPDILRQRRTIMGLKNDPHIDIFRQLRTKVLKKLRENKWNSLAITSASADAGKSFLT
ANLAIALAMEVNQTVLVVDADLRNPNVGWYFGLDIEKGLLDYLNEDIPLSSILINPGFQRLVILPGKGFTTHSSELLSSP
KMVTLVNELKYKYDSRIILFDTPPLLASDDTLLFMPNFDAALLIVEDGKTTAQDIRRSLQILEETELMGIVLNKSRERMG
DAYYAAYSQPVAEPVDV
>gnl|bykdb|A0A2W5J775 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Stenotrophomonas maltophilia] (length=241 residues).
NQAKDSVRGKFRQDGNLHLLAVKDPADLAIEALRSLRTSLHFARLEAKNNIVLISGASPNAGKTFVSTNLATVVAQSGQR
VLIIDADMRKGTMHRAFGVTQTPGLSEVIVGAAQISDAIRSFGPVDGLDFIARGEVPPNPSELLMHPNMTRLLEEVSSRY
DLVIVDTPPILAVTDAAILAAQAGTSLLVARFGLNQQKEIALARKRFEQNGAVIRGAIFNAVQKRATGYYSYGYYEYKST
E
>gnl|bykdb|A0A2W6S588 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp] (length=703 residues).
MNQEQDGSATQDLAGIVSRFRRHLPIGFAIIVLMMVLAYGATKMMTPKYSASAQLSYSPQQALSRDGQPAPPTQTTDAAR
DAAIESQLQIATSLPVAIRALQDPEVAKNPTILARAKAFDPSGKSSDAMAAALLSGVSAARVGTTALFSIGYSDGDPLAA
ARIANVVAGAYLAVQAQQKLGQGSATSNQLKGQVEKLRQQALEADAAVAAYRLKHNILTDPNATLPDNELSNIGVQLSDA
RGAAAQAETRSAASGSTVISGGVDTTALSTLREQRAEASRDLAGLTSRYGDRNPQVIDARQKVADLDTAIGREMASMSRS
ARAESAAAAARSASLQASLAQAQSKLAGAVNASVQLAELQRRADNAHTLYTNLLTASGQQNANSALIQPDAQMVTPAVVP
LAPTSPRMLINLLVGFVAGLAIAVAVAYLRERWSQTINTIDDVQRLLGVEFLTTIPTLQSSIDKPKTRDPAEAVILHPLS
SYAEAFRSLAQTLIFDARKAEAEGGRVIGVGSALPREGKTTTTISIARVLAMAATKVVLIDSDLRRRSVTETLAPETQKG
WIDVLNGTATLSEVMIEDQTGAIILPLAPGSERAQRVFDSGKFEEMLAHLREHFEVVVIDTAPVLALVDTRAMMPHLDSF
VLLAHWRTTPVKAIRAALHQLDTVGAAVAGVAMTMVNLKTQAQSGYGDASYYYSEMKDYYVSS
>gnl|bykdb|A0A2W7MAV4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas sp. 478] (length=262 residues).
MEMFNPDTEKTEQQTSSKAMTPTAQSTGLNALSYVQTKVVPLRPDHLERNRIVAYNKNSRMSGAFDLLRTQVLKIMEENG
WRTLAITSPTPEAGKTVLAINLAMSIAHHTTKTALLVDFDLRRPKVGEYLGLPMDKSLNELLADEAELQEVLVNPTLPRF
VVLPTREPIPLSTEVLSSPAVSYLIADLRERYNSRIVIFDLPPLLSSDDVINVLPRFDCVLLVVANGLNSRKEIEESLHH
LGTANLIGTVLNKAEPENRSYY
>gnl|bykdb|A0A2X1JB05 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=513 residues).
MQETFTVSERSKESGMLELTMTGDDPQLITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVY
RQQRDSVDLNLEAKAVLEQIVNVDNQLNELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVL
RLSRDVEAGRAVYLQLLNRQQELSISKSSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGV
EAPEQLEEHGISVYATIPMSEWLDKRTRLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNI
LMITGATPDGGKTFVSSTLAAVIAQSDQKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVIT
RGQVPPNPSELLMRDRMRQLLEWANDHYDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGV
NIKGAILNGVIKRASTAYSYGYNYYGYSYSEKE
>gnl|bykdb|A0A2X1JBG5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Edwardsiella tarda] (length=414 residues).
MVGLEKQLNELTFREAELQQLYTRQHPAYIALLEKRQTLLNTKNAINKSIKRLPKTQQEILRLTRDVQVDQEIFVQLLNK
QQELSVMKAGTISNVRIIDEAAVATQAVKPKKALIVILATLLGAMLSVGLILVRAAFHRGIESPEQLEEIGLSVYATIPY
SGEQSGIEQKQKKHKRIMPLNESLLAVRNPADLAMEALRSLRTSLHFAMMETPNNTVMISGPGPNLGKTFVSTNFAATLA
MGGKKVLLIDADMRKGYIHKVMGRSLDSGLSDYLSGQSELSQTINQTGFDGLDFICRGSTPPNPSELLMHPRFQALLDWA
NQHYDFVIIDSPPILAVTDAAIIGQHAGTSLLVARFAKTAVKEVEVAVRRFEQNGVVIKGILLNAVEKKASSYYGNYSNG
YYHYGYSNKGGKSS
>gnl|bykdb|A0A2X3K9R3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=421 residues).
MDLPLEAKAVLDSMVNIDAQLNELTFKEAEISKLFTKAHPAYRTLLEKRQALEDEKSKLNGRVTAMPKTQQEIVRLTRDV
ESGQQVYMQLLNKQQELKITEASTVGDVRIVDPAIAQPGVLKPKTALIILGSIILCLMLSVVGVLLRSLFNRGIESPLAL
EEHGISVYASIPLSEWQKARDNVQTIKGVKRYKQSQLLAVGNPTDLAIEAVRSLRTSLHFAMMQARNNVLMLTGVSPSIG
KTFVCANLAAVISQTNKRVLLIDCDMRKGYTHELLGTNNVNGLSEILIGKGDISSSAKPTSIPHFDLIPRGQVPPNPSEL
LMSERFGELIAWASSHYDLVLIDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIQVKGVILNSIF
RRASGYQDYGYYEYEYTSDAK
>gnl|bykdb|A0A2X3M011 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=192 residues).
MITGATPNSGKTFVSSTLAAVIAQSDQKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITR
GQVPPNPSELLMRDRMRQLLDWANDHYDLVIVDTPPMLAVSDAAVVGRSVAPACWLRVFGLNTAKEVSLSMQRLEQAGVN
IKGAILNGVIKRASTAYSYGYNYYGYSYSEKE
>gnl|bykdb|A0A2X5NHJ9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Tatumella ptyseos] (length=409 residues).
MNVDNQLNQLTFREAEVSQLFTKDHPTYKALLEKRKVLQQEKAKLNQQVSGMPATQQEVLRLSRNVESGQAVYMQLLNRQ
QELNIAKNSAIGNVRIIDSAITEPKPVKPKKSLILLIGIVLGGVISVGLVLLRVFLRRGIESPEQLEELGINVYASVPVS
EWMARQTPKRSLKVKGKKQENTSFLAVDNPADLAIEAVRSLRTSLHFAMMEAGNNVLMISGASPNAGKTFVTTNLAAVIA
QSGQKVLFIDADMRKGYAHQIFHHSTEHGLSDILSGKSTVQQGIKPVAAAGFDFLSRGTNPPNPAELLMHSRFQQLIEWA
SQNYDLVLVDTPPILAVTDAAIIGRYAGTTLLVARFEQNTAKEMEVSVRRFEQSGIEIKGCILNGVIKKASSYYGYGYSH
YGYSYDDKK
>gnl|bykdb|A0A2Z3IKG4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Microvirga sp. 17 mud 1-3] (length=267 residues).
MERIQSTLEKLEREIALVAYRDNGMPPLPPSQASDPVWKKLPQVRLDRKHTAQSRIVTIDRFDAASFRFDILRTKVLKVL
RQNNWTSVAITSPTPGCGKTVLAVNLAFSFANLKDCRTVLVDLDLRRPQVGNVLGLEKKHSMERFLRGDSSIEESFTRCG
ENIAVGTNEYPASCAAELLQDPRTAPAIRSLKEKLKPDVMIFDLPPMLINDDVLAFLPNVDCVILVAAAETSTFSEVDAC
ERNLARESQVLGVVLNKCRYSPERYGY
>gnl|bykdb|A0A2Z5SSF4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Geobacter sulfurreducens] (length=310 residues).
MSRIEQALEKAAMLRGTTTDRGPAVAPRQMEDVQPRERAELPPLPAEPLEGIRHDNPLLATLNDPHSYVSEEYRKLKSAI
VAGTSVGEFRNTIMITSTLGGEGKSITALNLAITLAQEYDNTVLLIDADLRKPMTAQYLGIPGERGLSEYLSVGAHLPEL
LVRTGIGRLSILPAGKPAANPVELLSSQRMKDLLDEIRHRYPDRYVIIDAPPALPFAEVRSLSNLVDSIVFVVREGQSSL
ANIDEAIGALNRKKILGIVFNEASAVGISSKYGYGYGYGGYGQSAESAEARSKAEKTGKLSRILGKRGSK
>gnl|bykdb|A0A316GHM6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Silicimonas algicola] (length=277 residues).
MEKLQAALARAREKREGGTDRPLRTTDVTARNRARRAAKDGAIGERWASIGMFEASPKRMHDSRIYSSEASVEAQHFDIL
RTKLFLEMRRNDWTRIAITSATAGCGKTTTACNLIAGMGRQPETRGMLFDMDFRRPAVAKFFGAAPGSSLEDVFLGNVDF
ADQAMRLDENTSVSVTTRIVADPARVILRSQTSEILDQIQADYRPDLMLFDMPPVLVSDETRGFLKLVDAVLIVAAADMT
TVAQVDEVEREVAQYSNVAGIVLNKCRFMDEGYGYSY
>gnl|bykdb|A0A316KRG4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Marivita sp. XM-24bin2] (length=368 residues).
MTEQPKFQRRKRRGADAPVDTPDHRPSNAQKPDFAGDRASKPEPAAPAPRKSKIKAIKKHPAPKAAAPVSAKRISADSDS
RPEPARDHDTPVPGQPVKPRTVEVSKPPLILERRPEPKVQSQPVFDPETAWYSIDRFPLDPQRLAARNVITALREDPSHS
RFDILRTRMLQALSENGWRRVAITSPTKDCGKTFTAANLAVSLSRHETCRTVLLDLDMRSPSLHNVFGVSDTGAIGDMLR
GKISPEAHLQGFAPNTISAGSHVAVGFNGIVEPYASELLQDPSTEAVLDEIEAAFQPDVMLFDLPPALLNDDVIAMRPHV
DALLIVAAGGITRAKDIKETERRLGENMPLLGVVLNKAEHIETSEYSY
>gnl|bykdb|A0A318CT66 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Deltaproteobacteria bacterium] (length=275 residues).
MSKLEKAMERAKQARGIETSPAGAATIPTPVNKGRRLEPIDPVYTQTRVYPFDKALLEKHGVLTTAFNPIIVEQYNLLRA
RVMEAMTSNGYNSILVTSPEPEEGKTLTAVNLAISIARESNRTVLLIDTDMRQTSVHRYLGLPGGTGLYEYITKGTPLSE
LLINPGLPRLTVLPAGMPADYPADLLSGPAMQEFVRDVKGRYPDRYIIFDSPPILAYADGLYLARYADTVLMVARSGSTK
EDNLRQALESLGDRPLLGTVLNRVPKGQGPAYSYY
>gnl|bykdb|A0A318D3U4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Deltaproteobacteria bacterium] (length=304 residues).
MGKIADALDKARREPARKMDQLRPSGETGSREQKQARVQHEVSPKPVPDTITSKTDVQTGEGAGFVSKALQGPVDPKLVV
FHEPESPAAERFKVLRSQILYPKDGKDCRVILVTSAMEAAGKTMVACNLAVSIAQGVDPYALLIDTDIRKATVHRMLGFE
PAEGLSEYLQTDKPLSKYLIRTPMMKLTVLPAGRSVGNPAELLTSAKMRLLFDEARERYPDRFIIVDSPPVNLAAETSSL
SQNVDAVVFVVRSGYSSQDLIEEAIAKVGEDKVLGIVFNCFESPPWKYSYYKKKYPYYSSNKQA
>gnl|bykdb|A0A318DSU0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Dyella sp. AtDHG13] (length=378 residues).
MSQIGQLQAQKGDIDKQVGDLPDTQQELLRLTRDVEVTNATYTSLLNQAQQLDIARAGTVGNVRVIDKAAVDISKPAKPK
KVLAVLGSTFFGGFLAVAFVLVRQMLHRGVEDPSVIEELGLSVYASIPSSAAEKKNFRHGRRTRLPEKPMLLANEAPVDL
AIEALRSLRTSLHFARIEAKNNVLMITGVSPGAGKTFIASNLAAVIAKGDQRVLLIDGDMRKGALHTVIGGSPERGLSEV
ISGQLSLEDVVRPVQNVDGLHFIARGTVPPNPSELLMHRRLDELLEILRPQYDLLIIDTPPILAVTDAAVLGRHAGMNFL
VVRFGLNQVREVALAKQRFDQNDVKIKGVVFNAVERRSTGYSSYAYHEYGSDPVEGGH
>gnl|bykdb|A0A318KWA2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Halomonas sp. LBP4] (length=557 residues).
MDGETPRALGEARVGELARFAEGDIELRVAALEAPAEAEFTLVKHRRASAIRDLGDRLSVAEVGVGRGTSTGMLRLTLTG
PDRDEIRRSLDAVAETFLTQNVRRQSAEIEQSLAFLEEQAPELRTQLRAAEDSLNEYRAAQHSVDLTSEAQAAIEQFVAL
DSQLNELEFREAELAQRYTPNHPAYQSLLRQKRHLEAERAALNARVDDLPEAQQEVVRRTRDVEVTQAIYVNVLNRLQEL
QVARAGTIGNVRIIDDAEVGAAPIEPRKPRIVMLATLLGGMLAMSGVAVRGLLNRGVEVPEQLEEAGLPVYATVPLSDEQ
KKLVRRVKHRRERQAREVVSDVLAERAPTDTASEALRGLRTSLHFAMLEGRDNRLMITGPGPGVGKSFIAVNLGAICAQA
GQRVLLVDADMRKGHLHHAFGGRSDSGLSELLGGRQGLDEVIRHSRIDGLDYVARGMVPPNPSELLMTAGFSRFLDAGGE
RYDLVIVDTPPVLAVTDAAVIGAQCATTLLVARFQVNPLREVQLAVRRLETAGVTVKGAILNAMVRKAATRYGYGYY
>gnl|bykdb|A0A327LYE6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhodobacteraceae bacterium AsT-22] (length=300 residues).
MPDISTDMASTDDDDVARPPGPEDAASTQTSPEPPRARDQEDQGATSPDATPEPPAPGRSWPQLASIPVDAGHLERNLII
TATRHDPAHGAFDVLRTRLVNTLAEHGWTRVAITSPTRDCGKTFTAVNLAISLSRYETHRTILMDLDMRNPSVATVLGVD
DPGSMGDFLQGRTGVTDLFRRVGRNALNIGTNLAVAMNDRVEPYAAEVLRGPETKLALARMVDELDPDIVLFDLPPALAF
DDVIAFKDQFDGILMIVGGGQTKPDEVHEAMRRLGEDVPLLGVVLNQAEGDDALGYSYGY
>gnl|bykdb|A0A327YI48 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Salipiger aestuarii] (length=357 residues).
MTDDRKFRRRNPLSAEIAAGEQAAKLARAEDARRMAAAEEQSRIAAAQEAERQHKLTAERQAEADRRAAAERQGEVERLA
EVERRAKAEQQAEAEHQAQAERQAGADRQAKDDASPDMVWSRLPVFSVNARHLDRNRIVTAGRQDPAHAAFDVLRTRLLQ
ALSENGWRRVAITSPTKDCGKTFTAANLAISLSRHQNCRALLIDCDLRRPTLHKVMGADNPGSMGDVLRGRLSAEAHFQR
MGDNDIHAGPNVAFGFNGVVEPYASELLQSPETAQTLQTIERRLAPDVILFDLPPALFSDDVIAFRPLFDGVLLVVGGGL
TTDKEIREVERRLGENTPLLGTVLNRAEGTQLSKYSY
>gnl|bykdb|A0A328C2K5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Bradymonadales bacterium B210] (length=738 residues).
MSDQYGFQEPRSQSAPEERGESLGALIGRYWVLFRRFYWVLILTSIACVAAAYFWTDRQPRIYQATSKLIFHESRPNVFG
KQFERVELVDPGGRWQFEQFWNTQKEVLGSKWFARRVVEREGLLDAPGFLPASAQQLDEDERMKRAVNTLQSVAVYSLQR
DSRVGLIQVRYEDPELAARIADGISETYVEYIREFQTGGLRQLANWFDDYVSTKREELDQASSELQKYQRDNNILSHSFE
DRREMAAEGLASVSEQHREVQARLFAEEALLNQLENMESSGEDLRALGDLVDSPALKRGLDRESELLERRAELTTRYLDE
YPEVRAVDEQLAVVRQSIDEEIGRIRSAVANRAAVTRRNTESLQDEIERHKAEIAELNQIGFRYTEMRDSTETLRLHYES
VLGRTNELDLNALYESEIIQVLENADVPSSPISPQVPLNLAVGLLLGLFVGGSIMVLIDALDTTVKTEDHVTKYTSRPIL
GMLPAVNASAVKGVEKFGVSALDTLTHTAPRSSFAEAIKTLRTNLMFMAPDNPPHVLLMTSPGPGEGKTLTSVNMAIALA
QSGQRTLVIDSDMRRPRVHKALGMDNKVGLSEAIAGERPFTECVRPTGIENLEVMTCGPVPPNPSELLQTERFRKLVRDL
RDNYDRVIFDSPPLAAVSDALVLSHSADVVLLILKFGQTRQELLRRSIEQLESIGAPFGGTVLNDIDENAGYGYAYYYRY
RYDEPGDAPSKKGGKMAS
>gnl|bykdb|A0A328FD76 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobacter hydrogenophilus] (length=284 residues).
MGKIFRALEKAGNKLTPGEKSASSDDTAMVSDDSDTQVSELSETTVQPFSIHANPDLVTAATPHSPVSEQFRLLKNNILF
PEKGNPPKTIMVTSASPNEGKSFVAANLAVSIAQSIDEYVLLMDCDLRSPTIHTFFGYEGKEQGLSDYLSNKIPLSSVLK
KTSINKLTILTAGQIPSNPSELLSSDQMRRLLHEVKLRYNDRYIIIDTPPPYMTSKANVMARFVDGIILIIRQGKTRTKE
VTDILDIYGREKILGVVTNFSKKKLGYGYGYNKIGHGYGYHQQQ
>gnl|bykdb|A0A334Z204 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter baumannii] (length=236 residues).
MNILKKKKSIPILAVKSSDDIAIESLRSIRTAIHFALTSAKNNIIMIAGPSPEVGKSFISTNLATIFAQGNKRVLLIDAD
MRRGYMHKYFDVDVKPGLSELLSGQADLTQVLHKTQVANLDVITRGKSPTNPSEMLSSTQFKDLLEKFQTQYDHIIIDTP
PVLAVTDGIIISQYTGVNLIVARYAKSHMKELELTVNRFEQAGVKVNGFILNDIQRSGGGGYGYNYAYAYKAQKED
>gnl|bykdb|A0A336JDN2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella pneumoniae] (length=215 residues).
MEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRHGYSHNLFTVSNAHGLSEYL
AGKDELNKVIQHFGKGGFDVITRGQMPPNPSELLMRDRMRQLLEWANDHYDLVIVDTPPMLAVSDAAVVGRSVGTSLLVA
RFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGYSYSEKE
>gnl|bykdb|A0A345BWI6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Ruegeria sp. NKC1-1] (length=230 residues).
MFKKQPRQISKRRSLITRENPRSPISEQFRTIRTNIQYAAVDQTMQVIMTTSSGPAEGKTTINANLAETIGQQGEKVLLV
DADMRKPAVHYMFYLANHTGLSNVVTKQRDFSEVVQSTSNESLDVLTCGPIPPNPSELLGSQAMKHFIEGARTHYDYIII
DTPPVLAVTDAQIVAGVSDGVILIVDSGHTEKEEARKATDLLGQSNAKMLGAVLNRQAHKKSNYMYYYGG
>gnl|bykdb|A0A348SRI7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Cobetia sp] (length=222 residues).
MLATSQPSDISIEALRSLRTSLHFALLDNRRKSVMFTGPSPGIGKSFVSLNLAAVSAEAGQRVLLIDADMRRGHLHHAFQ
RTSEQGGLSDVLSGASPLDSVLYHSRIDNLDFLGRGVAPPNPSELLMQPNFAELLEQLGERYDLIIIDTPPVLAVTEALI
IGRHVGASLMVARFGMNQVRELEHARKKLENNGIHVKGAILNAIEPQAGDKHGYGYYNYSYA
>gnl|bykdb|A0A348UX90 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobacter sp] (length=284 residues).
MGKIFKALEKAGNNVTPEKESELRDNTALVCDDPDNQVYKQSDEVTQSGSSRTYPALVTASDPHSPVSEQFRLLKNNILF
PEKGTPPKTIMVTSASPHEGKSFVAANLAVSIAQSIDEYVLLMDCDLRSPTIHTSFGYSGKEQGLSDYLSKNVPLSSVLK
KSSVNKLTILPAGQIPPNPSELLSSDQMRRLLHEVKLRYNDRYIIIDTSPPYITSETNAIARFVDGIILVIRHGKTRIKE
VLDILDIYGREKVLGVVTNFSKKTIGYGYGYHKSGYGYGYHQQR
>gnl|bykdb|A0A350A102 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas sp] (length=267 residues).
RGVESPDVIEKLGVPVYAGLPYSPSQEQLNRRRKARDGKTRLLSLTEPTDLAVESLRSLRTSLKFAMLEARNKVLMITSP
TPAVGKSFVSSNLAAVIAQTGQRVLLIDADMRRGYLHTLFGMAPRNGLSDALASCLSLAEITNRTEVKNLHFISAGFSAP
NPSELLMHENFSRLLKEAERLYDFIVIDTPPVLAVTDAVLVAQQAGTNLLVARFGLSTSSQIDASKRRLAQNGVLLKGVI
LNAVKRKASTSPYDSGAYGYYTYTQQA
>gnl|bykdb|A0A350DWX8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Brevundimonas sp] (length=589 residues).
ATQQAARRRKMITGLISSNLGVSPERGSRLVRITFSSPSAAVSARMANAIAENFIEANLARKFDASLYVREFLEEQIAET
KARLEDTERQLVAYAGDQEIITLSDAETGAGRSLVSTSLGTLNEALSEARVDRIAAEERWRQAQNAPLTSIPEVMASTTY
QTLMQQRIQLESQYEEKAAVFQDDYPELVELRARIDELDAQIRTAATSIRDGIRAQYQIALNQERALQNQVNGLKGEVLD
LGDRSVQYNILVRELDTSRQLYDGLLQRYKEIGVTGGVTSNNISLVDRATPPGGPSSPNLPLNLMLALTMGLTLGIIGAF
LIEALDDRLTSPDDVESKLGIPALGVIPMLERGKDPNEALRDIRSPFSEAYYSLRTALQFSTSHGAPRSLLVTSARPGEG
KSTTAFATALNLSRVGRRVLLVDGDLRNPSMHRVLEIENSQGMSNFLSGAAELTGVVRKTPYSTLDFIPCGPLPPNPAEL
WGGSRLQALLDQAFAVYDHVVIDGPPVLGFADAPVLSSSVEGTLFVLESRITGRRQARGALRRLSMGRGRVLGAVLTKFQ
AHRTRHEGYDYAYDYHYGAEAEGKPGRKA
>gnl|bykdb|A0A350L5D2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas sp] (length=267 residues).
RGVESPDVIEKLGVPVYAGLPYSPSQEQLNRRRKARDGKTRLLSLTEPTDLAVESLRSLRTSLKFAMLEARNKVLMITSP
TPAVGKSFVSSNLAAVIAQTGQRVLLIDADMRRGYLHTLFGMAPRNGLSDALASGLSLAEITNRTEVKNLHFISAGFSAP
NPSELLMHENFSRLLKEAERLYDFIVIDTPPVLAVTDAVLVAQQAGTNLLVARFGLSTSSQIDASKRRLAQNGVLLKGVI
LNAVKRKASTSPYDSGAYGYYTYTQQA
>gnl|bykdb|A0A351B422 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobacterales bacterium] (length=302 residues).
MSFIDKALERAQAARQKDKPKVEEDIKAPWAENSRKPLPVAGSVGYAGPVKDICYTTTKTYPVDMKLLAKNYIIVGDEFP
DITEEYKLLRTHIIHKTKKNNYNTIMFTSPQLNEGKTLTTLNIAISIAQEIDKTVLLVDTDLRNPTIHRYLGLSPRRGLV
DYLKDGIPIPELLIHPEGIDKLVVLPAGRATGDAAELIKSPQMVDLVQELKHCYEDRYVLFDLPPLLSYADALAFAPLMD
CIVMVVEAGRTRCDQIEQGIEMLKDFNLLGLVLNKVKKKDQGSYYDYYQSREPKKSKFRIFG
>gnl|bykdb|A0A351CXR4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Gammaproteobacteria bacterium] (length=617 residues).
MLGYNSSLNNTPMYQSSLTLMVTENMPNMAMVGQGYVDPMSMLSLWSGGTLDTRIIQSRAITTKAAQALNLTEKEFNLPA
PATPFADLTNDISQMLLGRKLIDTPQNEQPKLAFANTRQASAFIQAALTVEVESHDGVLDLGFTSPNADLSADVLNVLAE
TYIDHKRSSKTNRVSEASEWLNAQMTEIKVDLKLAENALQDYRTEQGETTTRSLESSTENRLVQLSEALQLAKEDYARLA
QRYGPRHPKMIEAESEIQRTQASLKMGGGQAVSDREKEFELARLEKDVENARTLHDMFLRRYQEANVSTDTGMVDVQIIE
AALPANGPIWANQSNTAAWGFIGLIFGTLIVGLRFQFDNTFKSHHEIEQKLGLPVLSILPRIPDLERKAIEIEKLYLVDQ
GSVYAEAINRIRSSLQYTNAGEPASTIQLTSSLEGEGKSTLAFNLALAMARMGRKTLIIDCDMRRPRLHRLTDTKQDPGL
SDLLEGNVKAREAVRSYPSASNFYIMTAGTRTEQPLELLSSQRFERLLKNLSQTFDHIIIDSPPILPIADALEIGRHMDA
VLLVIEAEKTTTDIAKDAMSLLSEAGIQPAGAILSKLGARSSAYYYPQKYYRSYYES
>gnl|bykdb|A0A351Z4H9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Syntrophus sp.] (length=306 residues).
MGXKGVPKDNVFDRQEAQPEQYQESERATYKDAPKDNIFDKQKVQPSKPAPKDIALDDRLVSYFDPSSMVAEQFKRLRTY
VIKPGTENSPKTILVTSTMEGEGKSMIAINLAITIAVDLNSNALIVDCDLRNPSLSRWFGFREQRGLSNYLLGEAQLPEL
LVKTSVDKLTILPGGTVRDNPVELIGSKKMKSLVADLKMRYDDRYIILDSSPLLATTEPRVLSDMADGILFVIKSADTPR
ESVQQALKLIDKKCIIGVVLNQVEFKTEALIRRYFGTDRYSDYRYSAKQSEPSSSRQSASRTRIRK
>gnl|bykdb|A0A351Z9A2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Syntrophus sp.] (length=300 residues).
MPVIAAQKGNPGNPERKPEEDLVTISSPKSTASESYRGIRTSLLFSAADAAPRTILVTSAAPSEGKTITSANLAVAMAQA
GNRVLLIDCDMRRPKLHRVFGVPRDRGVSNILVGNCSIEDAIIHTTIPGIDIVPSGPVPPNPSEMLGSQLMTKLLADVRD
RYERIIIDSPPLTAVTDAVIMSRRVDGVVLVIRAGETHREIIKNGIGLLRAANAHTLGAVLNGVEMGRDSYYYYQYYYYY
YGEDGERQKKIHRKKRARSRYYASDQSEGTGREEGSGGPENKGFNAPSSSEVVPARRVGF
>gnl|bykdb|A0A352B502 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Proteobacteria bacterium] (length=295 residues).
MSKIEEALEKATRERQGGGHEAGGVPQRSSVREAHTAVVAEVAVVNPDPLHLAENRVVVASGPSLGASDAYRQLRATLML
AADHQRLAFVVTSPLQGDGKSITTLNLGYAIAQELQLDAVVVDTDLRRPVLAKFLGIEGQRGVSDYLNDPSVTLDDVVVR
LAGGPLWVSAGTVRLHNTSELLGSRRMEQFCGELRHRFPTAILLFDSPPILPAPDAMTLVQWLDGGIIVVSAGKTSRRAL
SDAVRQFGANRIAGVVVNRSDRSSYGYGYGYRYYYGGYGYGGEGAPTAETGEKDG
>gnl|bykdb|A0A352G2C2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas sp] (length=499 residues).
RGKQSGIVNVTLEDPNPEHAIRVLEEVASRYVDQNVARNAAEATQSLEFLNEQVPAVRKKLEAAQTALNKYQTGSGSVDI
TAETQSVLDRIVDLEKQISEQNLKRTEMERRFTRQHPNFQALMNQINQLQMQKEELEKQIGTLPSTQQELLRLTRDVEVS
SETYSMLLNKTQELDIIRAGTVGNVRIIDHAAADLENPVKPNKPLVVIVATLLGALLATAFVYVREALKRGVENPEDIER
TGTPVYASIPFTDKQAALEKRLANFKRDKSTASYLLTINDPADLATEAMRSLRTSLHFAMIEAKNNVLMITGPSPAVGKS
FVTTNLAAVVAQSGKRVLLIDADMRKGYLHKVMRCDGDKGLSDILSGRITLFDAIQKTQLNNLHVITHGQLPPNPSELLM
HENFSRFVKEISNMYDLVIFDTPPILAVTDAALVGSQAGTTLMVTRYALNGVKEIEAAKRRLEQNGLIVKGVIFNAVVRK
ASTYGEYGYYQYEYASTSK
>gnl|bykdb|A0A352MMI7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia sp] (length=396 residues).
FKEAEISKLYTKAHPAYRTLLEKRRALEDEKDRLSGRVSAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITEASTV
GDVRIVDPAIDQPGVLKPKKALIILGSIILGLMLSIVGVLLRSLFNRGIESPQVLEENGISVYASIPLSEWQKARDSVNT
HKGTKRFKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQASNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLMIDCD
MRKGYTHELLGTDNVNGLSDILAGKGDFSTCVKPTAITHFDLVPRGQVPPNPSELLMSERFAQLIAWASSQYDLVLIDTP
PILAVTDAAVVGRHAGTTLMVARYAVNTLKEVETSLSRFAQNGIQVKGVILNSIFRRATGYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A352Q5C1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Porticoccaceae bacterium] (length=304 residues).
MRVIDHAVIPDRPIKPKSMLIIALSIVAGAVCGVILSFCHKLIKGGIEDPDELEQKFDIPVYASVMHSENQKQISRKKIS
DPLLAKNLDDPAIECMRSLRTTLHFKLESASNNIIMICGASPGIGKSFLAANLSGILAENGKKVLLIDADLRRGSLHATF
NLAKYGGLSDLVTGRSELSGVIKDTSFDAVKVITAGEYPNNPSELLLHKNVTKVMAAAAKDFDYLVIDTPPILAVSDAAI
IGRYAATVLMVLKSNNHTVREIQQSVKKFEQAGVNIDGFVLNDVKSFAAKYGYGGYVYHYDYHG
>gnl|bykdb|A0A353EH49 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Gammaproteobacteria bacterium] (length=636 residues).
MMARKFERSQAGVAEPLLGFDAYAWGGEILEVAKLEVPDFLKGNALRLVVEHDSEYTLYDGDEYLLKGRVGQDAVISLKD
VKKYNRYYDQQYVLAREQEFSPYLKINIEYLKARVGTEFTLEKQHVYKSAEVLNGKLQVSESGKQSGMLTLAFTSIHQHQ
VADVLNQIVNSYVDQNLERSAAEARLSLEFLERQLPPLKEQLDAAENAYNKYRVQHGSIDLGAETTGLLTEMSHLGAAIL
ELEQERKELRNLYKPEHSVIKALDEKIQLLKIEQRKLEIDADVLPNVQKDILRLKRDVEMNTILYSKLLNTTQELKVAQA
GDIGYVRVVDYAFMPEEPFKPNKFLLDAVGAMGGMMLGVFFTLFRHGLRNKVDNPEEIEQTLGLPVYASVLHSEEQANDN
RKLLGRKKGMNILAQTHPESLTVECLRSLRTTLYFSMQGARNKIILTAGPSPNIGKTFTSINLGAVLAETDKKVLVIDAD
LRRGTLHQYIKRSREHGLSDLLLDDSHDLTTFIKNTTVPNLDVITSGQIPANPAELLMHSRFKQLLNVLSEQYDIIILDA
PPILAVTDSMIIAQHAGVNLMVAKFNAHQMHELEAAKKQFETTGLKINGVIFNDVTRTANRHGYGQYVYRYDYTHE
>gnl|bykdb|A0A353MI14 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Geobacter sp] (length=284 residues).
MSRIEMAMEKAARLREEGKGAQPAAPEQPNQPASNRPVPGAVHTAPPVAARALAPKNPFLVNLLEPHSVAAEEYRKLKSA
LVKLTEGETFKNTIMVSSAVSGEGKSLTALNLALCLAQGLDHTVLLIDADLRRPSLHRYLDLEQGPGLAEVLMDEAEIGE
TLVATGLGKLSVIRAGRQVDNPTELFSSLKMKGLVEELKLRYPDRYVIFDTPPLLPFAESRSLARLVDGVLFVVMERLAS
QAEVKDALDAIKGSALLGVVYNAACVNSADEHYYYYRNKGGANG
>gnl|bykdb|A0A353QLL3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Deltaproteobacteria bacterium] (length=271 residues).
MSRIDQAIEKAARLREQRSPEKAHKEPPAGRPVAETPSTPARVVDVSCVSPFIVALNDQGSAVAEEYRKLKSIIVGLTTG
AEEFRNTILVTSSIGSEGKSITSLNLAVTLSRDYDFTVLLIDTDLRRPSLNKYLNLEGEPGITDCLLDGLDLSKALIRTN
LGKLSFLPAGRKIDNPAELLSSQKMKDFIAGVKQRYPDRYVIIDAPPILPFAESLSLSASVDGVLFVVRERAASVKHVGE
ALNLLRGSNLLGIVYNGAETEMSQHYSYYNY
>gnl|bykdb|A0A354EF47 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobulbaceae bacterium] (length=295 residues).
MAVGKVSRALNKAESGFTPDDSPLLTSDNEDAVSVSVTAEPIERKSPASEPALHPQPAGSIENWDERLLSATESLSGIAE
SFRKLRTLILHPENDKPARSIMILSAEPQEGKSFVCANLGVSIANDVGRKALLIDCDLRRPTLHNLFGLKCAKGLVDHLK
GREEDVSSLIFATGLPNLSIMPAGLPPDNPSELISSKRMSRLIKELTNGYDDRLILLDSPPFQAASEAVILSQLAEKIIL
VVRWGKAGREVIKKMAETVGPGKIVGVVFNAFEMNILDKKMQGVGYHNYYSESYY
>gnl|bykdb|A0A354EI73 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobulbaceae bacterium] (length=251 residues).
MLGLIPFSDNDQSDDRELAFKFYNDPKSPLAEAIRTTMFSIELSSSETPPRTIMLTSVLPNVGKSTLSCNFCLSLLTSKA
KVLLIDTDLRKPTLHEIFAIKDNTRGLSSFLAGTLTLQEVLRKTQFENLFFIPSGPIPPNPAELLASSRMRNFIATAAKN
FDYIIIDTPPFHGFAEILILSNMVDGVILVGELNNTPREGVEYFRKAVTNVGGRILGVLVNKAGKGGKGYRYYGSYKYQN
YYTYGYGPQEK
>gnl|bykdb|A0A354VPS3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Erythrobacter sp] (length=263 residues).
EQLDEAIADPSEVEHRLGLPLLGSVPKVDDGGTPRDALLDRKSELVDAYIAVQTNLAFTTERGVPRSFSVTSTRPAEGKS
TTSLALATMLARSGKRVILIDGDMRSPSVHHLGNVGHDHGVSNFLAGDDNYESSIFHMDDLNLDAMSAGPIPPNAAELLT
GARMRQLIDRLHENYDHVVVDSPPVMGLADAPLIAGHVDGVIYAVESHGIRSSQVKTALSRLAAVRTRICGAVLTKFEAR
KAHYGYGYEYGYGYGRDVETETA
>gnl|bykdb|A0A355QPE4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Citreicella sp] (length=372 residues).
MTMSERRPFRRRNRPEDTPAPAPAPRPDPQAEALAKAQAEAEAQAEVQREAEAAAEDQRRRAEAAGDQARRQAEAAAQAQ
ADAEAEEQRRQAEAAARTRAKAAAEARAAREAENARAQVEADAASAPIPATDQRWSALTPFPVDLAHLDRHRIVTARRED
PAHTAFDILRTKLVQTLAERGWSRVAITSPTKDCGKTFTAANLAISLSRQEALRTVLLDCDLRRPSLHKVMGVKTPGSMG
DMLRGRVPAEQHLLRMGPNSFHAGPNLAFGFNQIPESYPAELLQDPGTATALAALQERLKPDVMLFDLPPALYFDDVMAF
RAQFDGVLLVIGGGLSTEKEIREVERRLGDQTPLLGMILNKAEGTNLGKYSY
>gnl|bykdb|A0A355TB56 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhodospirillaceae bacterium] (length=315 residues).
SEQQDMQLPDTRIIARADVPVVPAFPQTWLFVLVGLILGGVLGLLAAYLAEFFDRGFRTAPQLEEGTGIPVIGQVPSLKT
ISDRPPEDYVVDKPLSAYSESLRTVRTAIHFSNVDNPPKTVMVTSSGPGEGKTTFCLSLARSLATSGNKILLIDADLRRP
RIARLLEIAANGKDLSAILTGKYNFEDVVRQDQLVAGLDIIPAFGRAPNAQDLLGSKQMKKLVKELSKKYDLVLIDTPPI
LAVTDAAMVARVVDTSLFLVKWASTSRETVTQALRQLRGLDCRVAGAVLNQVNLNELASYGDGYYNHRYHEYYAD
>gnl|bykdb|A0A356GQV1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Deltaproteobacteria bacterium] (length=215 residues).
MIKGLRAKVEYKMDTLNLRVLAVSSSVAGEGKTLTATHLAANMASTGRKKVLLIDLDLRKPSVAGELGMAADSGMSEFLS
GSVPKEKIIRNSVVPGLSVIVGGKTIPSPADMLAGEKFRFLLREMREQFDVVILDTPPILPVPDAVTISEQVDAFILLFR
FNHTPHHLFRQAIDDLGEGKIVGVVLNGEEKKPDKYYHKYYGKYYQVAHAEGKRS
>gnl|bykdb|A0A357RN98 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Citreicella sp] (length=372 residues).
MTMSERRPFRRRNRPEDTPAPAPAPRPDPQAEALAKAQAEAEAQAEAQREAEAAAEDQRRRAEAAGDQARRQAEAAAQAQ
ADAEAEEQRRQAEAAARTRAKAAAEARAAREAENARAQVEADAASAPIPATDQRWSALTPFPVDLAHLDRHRIVTARRED
PAHTAFDILRTKLVQTLAERGWSRVAITSPTKDCGKTFTAANLAISLSRQEALRTVLLDCDLRRPSLHKVMGVKTPGSMG
DMLRGRVPAEQHLLRMGPNSFHAGPNLAFGFNHIPESYPAELLQDPGTATALAALQERLKPDVMLFDLPPALYFDDVMAF
RAQFDGVLLVIGGGLSTEKEIREVERRLGDQTPLLGMILNKAEGTNLGKYSY
>gnl|bykdb|A0A357Z0N5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobacter sp] (length=284 residues).
MGKIFKALEKAGNNVTAEKESELRDNTALVCDNPDSQVYKQSDEVTQSGSRRTDPALVTASDPHSPVSEQFRLLKNNILF
PEKGTPPKTIMVTSASPHEGKSFVAANLAVSIAQSIDEYVLLMDCDLRSPTIHTSFGYSGKEQGLSDYLTNKIPLSSVLK
KSSVNKLTILPAGQIPPNPSELLSSDQMRRLLHEVKLRYNDRYIIIDTSPPYITSETNAIARFVDGIILVIRHGKTRIKE
VLDILDIYGREKVLGVVTNFSKKTIGYGYGYHKSGYGYGYQQQR
>gnl|bykdb|A0A358L616 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Erwinia citreus] (length=487 residues).
DPELISQVLDRVMSNYLMQNVERKSAEAQKSLEFLQHQLPQVRGKLDEAEDKLNTYRRNNESVDMSLEAKSALDSSVSVQ
SQLNELTFREAEVSQLFTKDHPTYRALLEKRKTLEDEQKKLNHKIGQMPQTQQEILRLTRDVQAGQEIYMQLLNRQQELS
ISKASTVGDVRIIDHAETASKPVAPKKILIMLASLIAGLVLSVGIILLKAMFHHGITAPDQLEEAGMNVYASVPLSEWQR
KKDVEALNKRGVKVDPHNSLLALGNPTDLSIEAIRSLRSSLHFAMMEARNNVLMITGASPGIGKTFISANLATLVAKAGQ
KVLFIDGDMRRGYTHELLGAANKSGLSTILSGKTAFTEDLIQRGDYGFDFIPRGQVPPNPSELLMHNRMNELLEWANKHY
DLVLIDTPPVLAVTDATIIGKMAGTALMVARFETNTLKEVEFSYKRFAQNGIDIKGVILNAVVRKAANAYGYGYDYYDYS
YKGNAKS
>gnl|bykdb|A0A363TNU9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Deltaproteobacteria bacterium] (length=244 residues).
MKISFSRQNGNTRREDGSPPIVRAGKQDPIYLEQIKAMGAKFEYKIELLKMKVVAVTSAVAGEGKTTSCAQLAMNLVMAG
RKKVLLIDADLRKSDLARGMNLPAVPGLSEFLHGTVAVKDIVRNSFLPGLYIIPAGTRVEEPANLLAGEKFRAFLGEVRG
HFDIVLLDTPPILPVADTLSLRDQVDAFLFLYRAGFTPFPLMRQAAEEVGEEKVLGVILNGVAPQKQKYYSRYYGKYYHK
PSGK
>gnl|bykdb|A0A365PWR2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas zhaodongensis] (length=517 residues).
MTKEPRLAALLRLQNQLQIDEVEEGSGIFVLSITDADPERAVNILAEVMKAYVAQNIERAAADASSGLEFLTTELPAMRA
KLEQSELALNRFQTQAGSVDISLEIEGYLNQLVALDSKISALRLQQTELASRFTSEHPAYQTLVNQIESLTLEQQSLARK
IGTLPETQQELVRLSRDVKVNNEIYLLMLNRAQELEVMRNGIAGNVHVLDQPVADTISPAWPNRKLVVLGGLVGGFGLAL
AIVFIRRKLFPSIESIDEIERLGLPVLAAIPMFSAKQLDGVVGDGAPAKQPAVLMRANDPYTEALRSLRTCLRLSLPNRR
NNLIMLSGPSPAVGKSFISLNFAVLAARAGQRVLLIDADMRRGHLHEALALSEENGFAEVLQNQSSVTAAIRPTAVENLS
FLPRGKPPLWPAELLLDPILENVLQRVGELFDLVVIDTPPLLAVSDALIIGQHTGINLMVLRFDFTAAREVELVLRRFEQ
NNTELHGAIFNSVEERTSTRYGYSKSCYRLDYRTVHS
>gnl|bykdb|A0A367UAB4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Thalassospira xianhensis MCCC 1A02616] (length=699 residues).
MTISDLVGILYRRRGVFAVSFVALLMMASVAISFFSPVYKSFASVGFVREEPATTQTDFPKAVWPNAAEFVETRMEMIVG
NETLSTVMSILRGQGIIFSQEANARGNFLRRIFGNDQGFIASDAKVSDEIDKDVEALRRRIDVERIGNSTVIQIGVTDDD
PERAYQIVSAVAESFVWLRNNELRRGMDNQLTVIQRQLDEARKRLETVEQRHADWEKSSGNIADRERELILERIYDLNAE
LDTAFQEKEAARMLFEKRQAVKSSEELLALPDIAKDDQVRDLQVKYEVLQQNYAELEQRYQPAHPSMVRISGEIWSVQQT
LAKALERSARQIDFGNANAQARYELVLKQLVRWKKELVKKHEALAGQGVLERDVEEAKRTVELLGAREQELLSSIAELKP
DTLLLQLPSVPLYPEFPRKNDLWIAGVLVALLVSVLIVILRDYFDQAIRSDEDLKRVFLLPVLGRVPLSRDDSQHLEIGE
TTEEALGHLIVLTEMMRTEPDPRQLDAGKAQVICVGSASPNEGKSRLSAQLALSYARRGFKTLLLDGDLRRPGHLSSIAG
IPDLSDVLIGEEDISVLVSKVTKVDRNLDYLGARDGLPGVLATQLIESRFGALTEIMRSSYDRIVIDTPPVLMVADSVTL
MRLADVRLMVVRNNFSRRPDVMRALDQFGIAECSPDGLVLMAADTPKTYGYRTDTVWGT
>gnl|bykdb|A0A369PF62 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter sp. RIT592] (length=238 residues).
MINITAFNDPKSPIAEAYRSIRTNIQFSKIDNEMKTIVVTSSKQDEGKTTVTSNLAVSFASLEGKRVLLIDADLRNPSVH
KMFTKTNALGLTDVLTGKKELKQCVQNTELENLQIITAGTIPPNPAEILESKKMREFINGLRDCYDYIFIDTPPIGIIMD
AGVLANYSDGTILVVGSKDVETERAKIAKERLEKVKANVIGAVLNKYIEKNGSYGYYSYYYEQSDGSRVSKNKKKKHK
>gnl|bykdb|A0A369R0Q9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhodovulum sp. 12E13] (length=314 residues).
MERLKAALDKARETRAATAAPAPASGARPEPAANPARRGAGQAGAVAGAVRGPQAAGSGAAPSTGPSTGSSGAVEAAWAD
IQKSEIDTRRLVKRRLISFGRQAEATAFDVLRTKVLQLTGANGWKRVAITSPLPGSGKTTTSINLAVALARQVDLRIILI
DLDMRRPAVARSLGISGKTGVAPVLEGRESFGRQARRLGDNLAVAMNFAALRDPSDLFLRARTSEVLDEIEATYRPDLIL
FDMPPLLVNDDASAFLRNVDCALMVAEAGATTISQVDVCEKELAEQTNVLGVVLNKCRFFSDGYYRYYYAYGDD
>gnl|bykdb|A0A370WFN4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Hafnia paralvei] (length=193 residues).
MISGISPGAGKTFICSNLAAVIAQTPKKVLLIDADMRRGYLHELFGQEERCGLADILKGTSSFEHAVISSPDRRLDYLSR
GHIPAHPAELLLSQGFRELLDTASSRYDLVIIDTPPMMSVTDAAIVGRHADTIMMVVRFGVNTVKEAEVCIRRFKQNGIE
VSGCILNGVKKSKSSEYGYGYSAYGPSYSKKEA
>gnl|bykdb|A0A370WI76 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Hafnia paralvei] (length=205 residues).
SLHFAMMQASNNVLMMTGVSPSIGKTFVCANLAAVISQTGKRVLLIDCDMRKGYTHELLGTGNDNGLSEVLVGKCEIAGC
TKHTSITNFDLVTRGQVPPNPSELLMSDRFAELVKWASSQYDLVLIDTPPILAVTDAGIVGRHAGTTLMVARYAVNTLKE
VETSLSRFEQNGIHVKGVILNSIFRRATGYQDYGYYEYEYKSDSK
>gnl|bykdb|A0A372IH36 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhodobacteraceae bacterium W635] (length=307 residues).
MSSNSRDTGPDGGLSDRDRQRRALERRLREALMQPAEADDAAPAPDDAPPAPADAATAPRPQADPAIWGRLPRIPVEPRR
LDRNLVITASRHDPAHAAFDVLRTRIVRAMRDNGWHRVGITSAGEGNGKSFTAINLAISLSRLSELRTVLMDMDLRRPGL
AKILGLRDMPATADYLRGEVGTEAYFSTFAPNSFHIGERLAIGVNGRTDAYAAELFQTEETGTRLAAMQAELATDLVLFD
LPPALAMDDVLAFREHLDCVLLVVGGGETRARELREVQRRLGDDLPILGVVMNKAEVEDDPGYSYGR
>gnl|bykdb|A0A376D8L7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=200 residues).
MMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLLIDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTS
IAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVLIDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSL
SRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A376KYN0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=413 residues).
MNVDNQLNELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQ
QELSISKSSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEHGISVYATIPMS
EWLDKRTRLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLA
AVIAQSDQKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQL
LEWANDHYDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSY
GYNYYGYSYSEKE
>gnl|bykdb|A0A376LLF8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=191 residues).
MMTGVSPSIGKTFVCANLAAVISQTNKRVLLIDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPR
GQVPPNPSELLMSERFAELVNWASKNYDLVLIDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIP
VKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A376QQZ0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=445 residues).
MVRQKKCSGIRRSYLDEYLPKVKTKLDNYENQLNNFRKKNESIDLSLEAKSALDSALQVEEKLNELTFKEVEIQQLYTRN
HPAYQSLLDKRQQLLREKEKISKAIQKLPNTQQQIVRLTRDVESEQAIYNQLVAKQQELSVLNSGITADVRIIDSAESQP
NAVAPKKSLILVLATILGFIVGCAYVIAREFFNNKIKGTEDIDALGINVYATIPFSNGEKKLIAAGNKRPLALENPADTA
VEAIRSLRTSVYFSVMNQGNNLVMISSASPGVGKSFVTSNMAVVLANAGKKVLLIDTDLRKGRIHKAFGLSNKAGLSEYL
AQQDITQPAIHRGVIENLDVICRGKNVTHSSELLMGERFKHLLDTVKGQYDIVVIDTTPILAITDSAIIGKYVGTSLLIA
YYGVNTVKDIELSLKRFKQNDIEITGVILNGIDAKSDDYNYVYEY
>gnl|bykdb|A0A376RML0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=513 residues).
MQETFTVSERSKESGMLELTMTGDDPQLITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVY
RQQRDSVDLNLEAKAVLEQIVNVDNQLNELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVL
RLSRDVEAGRAVYLQLLNRQQELSISKSSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGV
EAPEQLEEHGISVYATIPMSEWLDKRTRLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNI
LMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVIT
RGQVPPNPSELLMRDRMRQLLEWANDHYDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGV
NIKGAILNGVIKRASTAYSYGYNYYGYSYSEKE
>gnl|bykdb|A0A376RY66 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=438 residues).
MDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQLNELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKAKLNGRV
TAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITEASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVG
VLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARDSVKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMM
QAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLLIDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIA
KFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVLIDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSR
FEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A376SB61 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=254 residues).
MPASPLSEWQKARDSVKTIKGVKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCAN
LAAVISQTNKRVLLIDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFA
ELVSWASKNYDLVLIDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQ
DYGYYEYEYKSDAK
>gnl|bykdb|A0A376UBS1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=215 residues).
MEAVRALRTSLHFAMMETENNILMITGATPNSGKTFVSSTLAAVIAQSDQKVLFIDADLRRGYSHNLFTVSNEHGLSEYL
AGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLDWANDHYDLVIVDTPPMLAVSDAAVVGRSVGTSLLVA
RFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGYSYSEKE
>gnl|bykdb|A0A377E5P7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=493 residues).
MTGDDPQLITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSVDLNLEAKAVLEQI
VNVDNQLNELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQ
QELSISKSSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEHGINVYATIPMS
EWLDKRTRLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLA
AVIAQSDQKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQL
LEWANDHYDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSY
GYNYYGYSYSEKE
>gnl|bykdb|A0A377K431 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=408 residues).
MVNIDAQLNELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKAKLNGRVTAMPKPSRKLCVLTRDVESGQQVYMQLLNK
EQELKITEASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPL
SEWQKARDSVKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVIS
QTNKRVLLIDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVKWA
SKNYDLVLIDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYE
YEYKSDAK
>gnl|bykdb|A0A377LY04 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Enterobacter cloacae] (length=485 residues).
MKIKIKSAKFSTALPATTLSRTSNASRLKRRKAWPSSPDSSRKYAHVWDDAENKLNAFRQDKDSVDLPLEAKSVLDSMVN
IDAQLNELTFKEAEISKLYTKRHPAYRTLLEKRRTLEEEKAKLNDRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQE
LKITEASTVGDVRIVDPAITQPGVLKPKKALIILGSIILGLMLSIVGVLLRSLFNRGIESPQVLEENGINVYASIPLSEW
QKSHDRVKSVKGVKRYKQSQLLAVGNPTDLAIEAVRSLRTSLHFAMMQAKNNVLMLTGVSPSIGKTFVCANLAAVVSQTN
KRVLLIDCDMRKGYTHELLGTNNVNGLSEILLGKGEISQSAKPTSIPKFDLIPRGQVPPNPSELLMSDRFAELVEWASKN
YDLVLIDTPPILAVTDAAVVGRLAGTTLMVARYAVNTLKEVETSLSRFEQNGIEVKGVILNSIFRRATGYQDYGYYEYEY
KSDSK
>gnl|bykdb|A0A377N8F8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Ewingella americana] (length=408 residues).
MAVTTQLNGLRFEEAELSKRYTSAHPIYRALDEKRKTLLANKAALELKINAMPKTQQNILRLTRDVQTAQEMHSLLISKQ
REMEIKKVSTVGNVHIIDPAQTLPSPVGPNKPLMLVLMLLCSSFLALGVVLLRNALKRSISSSHELEKLGLKVFCSLPHS
KYQSNTKRFSIKKDLPRKQSLLALQKPDDLAIEAIRSLRTGLYFLLKEANNKILMVVGPTSGVGKSFVISNLAVVLVQSN
LRVLLVDCDMRKGCLHQDFKLKQHHGLSELLAGKKKIEDCLYKTGLANLDLIPRGIAPSNPSELLLTPHFAELCGWATKN
YDVVLFDTPPILAVSDAAIVSKYAGTSLMVARFEVTSSKEIELAMQRFEQQGHRISGVVLNSVERRVAQYFQHGHFENYQ
YQSDANLA
>gnl|bykdb|A0A377V641 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella pneumoniae] (length=468 residues).
MAQNISRQAAQDEKSLEFLNKQLPMVRSDLDSAEDKLNDFRKRNDSVDLSLEAKSVLDQIVNVDNQLNELTFRESEISQL
YTKEHPTYKALMEKRKTLQDERGKLNKRVATMPETQQEILRLSRDVESGRAVYMQLLNRQQELNIAKSSAIGNVRIIDSA
VTQHKPVKPNKIIVVLAGLFIGLVISVSLVLVRILLRKGIETPEQLEELGINVYASIPVSESNPKNVIAKRLNKRDDSRP
KVLLATENPADLAIEAIRGLRTSLHFAMLEARNNLLMISGASPNAGKTFVSSNLSSVISQTGKKVIFIDADLRKGYTHKL
FNIKNTNGLSDYLSGRVALDKIINNLQTEGFDYISRGSVPPNPAELLMHNRLAELLEWANKSYDIVILDTPPILAVADAA
IIGNYVGTTLLVARFEENTPKEIDISVKRFQNSGVNIKGCILNGVVKKASNKYGYGYNYYDYSYSDKK
>gnl|bykdb|A0A377ZC40 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella pneumoniae subsp. ozaenae] (length=263 residues).
MPNNLKKMVLNVYASIPLSDWQLKNVNNSRKKDKKKFDVLIKENGADLAIEAIRGVLTRLYFAMLEAKNNILMISGPSPE
IGKTFVSTNLAGVVAQAGQKVLLIDADMRRGYMHHYFGGLPNNGLSEILTGRVDYEKAVVHTDIAGLDYIGRGEIPPNPA
ELLMGSRIEKFLEWASGKYDLVFVDTPPILAVTDAAIIGRHVGTTLLVARFEKNTVKEIDVAKNRLEHSGVIVKGVILNA
VTRKASNKYGEYAYYEYEYKSKE
>gnl|bykdb|A0A377ZDH2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella pneumoniae subsp. ozaenae] (length=310 residues).
MVTYVSWILPLRSLVRLNRKKTIIVLIATLLGGLFSTGFVLLKTMLHRGIESPEQLEQLGINVYACIPLSELQHKSDRET
MLSGKRSSNRSSTLLAVGNLSDLAIEAVRSLRTRLHFALLEAKNNVLMISGPSPSIGKTLVSINLAAVIAQAGRRILVVD
ADMRKGHAHSLLNCELGLGLSDVLSGQASPQQAIKQTSIENLSFISRGKIPSNPSELLMHNRLTEFLEWAGKEYDIVLVD
TPPILAVTDAVIVARNVGTTLLVARYGVNSLKEIEVSIRHFEQNGIEIQGIILNAVENKSGNVYYAYEYK
>gnl|bykdb|A0A377ZDN3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella pneumoniae subsp. pneumoniae] (length=288 residues).
MASISIVLLRMLLRRGIESPEQLEEVGINVYASIPVSDTLSNYNQKKGIRIRADKLEHKSFLAIDNPADIAIETIRGLRT
SLHFAMMEARNNILMISGASPNAGKTFVSTNLAAVIAQTGKKVLFIDTDMRKGYVHKLFNSTNENGLSDILSGGINITDA
IKRMSGGGFDYITRGTVHPNPAELLMHPRFGELLKWGGENYDLVIIDTPPILAVTDAAIIGNYSGTTLLVARFEKNTTKE
IEISIRRFEQSGVKVKGCILNGVVKKSSSYYGYGYNHYGYSYESSSDK
>gnl|bykdb|A0A378APS2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella pneumoniae] (length=219 residues).
MAVEAIRSLRTSLHFAMMEAKNNVLMISGASPNAGKTFISSNLAATIALTGKKVLFIDADLRKGYVYKMFGRKQDKGLSE
ILAGQVAAETVIEKVTGGEFDYIGRGQIPPNPAELLMHPRFEKLLKWATQVYDLIIIDTPPILAVTDAAIIGRYAGTSLL
VARFEENTAKEIEVSMKRFEQSGVIVKGCILNGVVKKASSYYGYGYNHYGYSYSDKKHD
>gnl|bykdb|A0A378BPJ7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella pneumoniae] (length=335 residues).
MQLLNRQQELNIAKSSAIGNVRIIDDAITQPKPVKPKKVLVVIIGLVLGFMISVGLVLIRVFLRRGIESPEQLEEIGISV
YASIPVSESFTKKINNSNKVKNVKAAEYQGFLALDNPADIALEAIRGLRTSLHFAMMDAKNDILMISGASPNAGKTFVST
NLAAVTAQTNKKVLFIDADMRKGYTHKLFNVNNDNGLSDYLSGRVDTEKCIKAISAGFDFISRGAVPPNPAELLMNSRLE
KLLDWAKDNYELVIVDTPPILAVTDAAIIGRHVGTTLLVDRFELNTPKEIEVSLRRFDNSGVHINGCILNGVMKKASSYY
GYGYNHYGYSYSDKD
>gnl|bykdb|A0A378G3G7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella pneumoniae] (length=414 residues).
MEAKSLLDTMVQLDAQINQLTFSEAEVSKLYTKEHPTYRALLEKRKTLEEEKNNLKKKINNLPETQQEVLRLTRDVQVGQ
DVYLQLLNKEQELSIAKASTVGNVRIIDNAVTQPDPIKPKKLLVIVVLTVFGTMLSLMYVIVKVAFNKGVQSAEQLEENG
LNVYASIPLSDCQLKNVNNSRKKDKKKFDVLIKENGADLAIEAIRGLRTRLYFAMLEAKNNILMISGPSPEIGKTFVSTN
LAGVVAQAGQKVLLIDADMRRGYIYRYFDGLPNNGLSEILTGRVDYEKAVVHTDIAGLDYIGCGEIPPNPAELLMGSRIE
KFLEWASGKYDLVLVDTPPILAVTDAAIIGPHVGTTLLVARFEKNTVKEIDVAKNRLEHSGVIVKGVILNGVTRKASNKY
GEHAYYEYEYKSKE
>gnl|bykdb|A0A379B9V4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pasteurella multocida] (length=607 residues).
MRLKKLDLTTQVEPIYPVPILGKLFASATGYSPQITISHFTPLNEAANTLILEIGEQRDSYTLFLEKTTEPLLTGKVGEK
YDTDLIQFSLSQINAKPKQRFLINKLPELTVISALQEQLSVHEIGKQTGIINIAIQGKDKKHIQDIVSSIAESYLLQNVA
RNSAEASKSLEFLNQQLPDVRQKLSDSENRLNEFRLKNESVDLSLEAKATLDTIIQIEADLSELSIQESEISRKFTLKHP
SYVALIDKRNVLNAEKERLNKQLEKLPNTQKEMIRFTRDLEVNQHIYIQLLNKMQELDVVKASTIGNVRILDHAQVFPNP
VAPKKALVIILAFLLGGLLSSFLVLFRNYFQRGIESTADVDKTGLPTYAAIPHSEQQPAISRKHVHKGKYRLLSESHPED
NAIEAIRSLRTSLHFAMLEAPNNLVMISGTLPSVGKSFISSNLANVLAKTGKRVLLIDADLRRSYLRPFLGIAKKQGLSE
AIAQNIPFEDIVHQYAEFAIITKGNTPPNPSELFYTARFQQLLEWASSHYDLVVIDTPPILPVTDAAIIGRYVGTTLLVG
LFGKTTVKEIEIAKTRFAQAGVPVKGFILNGTKRKALSYYDYYNYRS
>gnl|bykdb|A0A379GWF0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Providencia stuartii] (length=275 residues).
MVLATILGFIVGCAYVIAREFFNNKIKGTEDIDALGVNVYATIPFSTHEKKLIAAGNKRPLALENPADTAVEAIRSLRTS
VYFSVMNQGNNLVMISSASPGVGKSFVTSNMAVVLANAGKKVLLIDTDLRKGRIHKAFGLSNKAGLSEYLAQQDITQPAI
HRGVIENLDVICRGKNVTHSSELLMGERFKHLLDTVKGQYDIVVIDTAPILAITDSAIIGKYVGTSLLIAYYGVNTVKDI
ELSLKRFKQNDIEITGVILNGIDAKSDDYNYVYEY
>gnl|bykdb|A0A379TA56 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Salmonella enterica subsp. arizonae] (length=356 residues).
MPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITEASTVGDVRIVDPAITQPGVLKPKKALIILGSIILGLLLSVIGVL
LRSLFNRGIESPQALEEHGSASMPVFRCRNGKKRAIASKPLKGLSATSRASCWRWATRPIWRLRRFVACAPSLHFAMMQA
QNNVLMLTGISPSIGKTFVCANLAAVISQTHKRVLLIDCDMRKGYTHELLGTNNVDGLSDILAGKGEMTSCAKSTAIPNF
DLIPRGQVPPNPSELLMSERFGELIAWASSRYDLVLIDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFE
QNGIQVKGVILNSIFRRATGYQDYGYYEYEYQSDAK
>gnl|bykdb|A0A379W6R2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Salmonella enterica I] (length=284 residues).
MLSIVGVLLRSLFNRGIESPQALEEHGISVYASIPLSEWQKARDSVKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTS
LHFAMMQAQNNVLMLTGVSPSIGKTFVCANLAAVISQTHKRVLLIDCDMRKGYTHELLGTNNVDGLSDILAGKGEIASCA
KPTAIANFDLIPRGQVPPNPSELLMSERFGELIAWASSRYDLVLIDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEV
ETSLSRFDQNGIQVKGVILNSIFRRATGYQDYGYYEYEYQSDSK
>gnl|bykdb|A0A380AQW6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Serratia quinivorans] (length=414 residues).
MLDTQVQLEGQLNELTFKEAEISKLYTRVHPAYRALLEKRATLEAEKARLGKQVQSLPKTQQEILRLTRDVQVDQQVYMQ
LMNKQQELSISKAGTVGNIRIIDEAETGLRPVQPQKAMIVLFALLMGGVLSASVVVLRAALHRGIGDTDTLEKRGISVYA
TVPLSPWQQKRNRAQQQLLTKHGSGKLPILAQEEPEDLSVEAIRSLRTSLHFAMMEAKNNILMVSGASPASGKSFTSTNL
AVVIAQAGQRVLLIDADMRKGFLHRWLNNSAKAGLSDMLSGLIAPDQAVKKTDIANLDFVPRGQVPPNPSELLMHQRFAD
FLRWAGQNYDLVLIDTPPVLAVTDAAIVGHHAGTALMVVRFEVNTVRQIETSIRRFEQNGVTIKGVILNGMVKKTATDAG
YYAFAYPSHQEKVQ
>gnl|bykdb|A0A380B3D7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Shigella flexneri] (length=258 residues).
MSGDSGGQSKRTRLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFV
SSTLAAVIAQSDQKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRD
RMRQLLEWANDHYDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRAS
TAYSYGYNYYGYSYSEKE
>gnl|bykdb|A0A383M853 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter baumannii] (length=356 residues).
MQQEILRLTRDVQVDQQVYMQLMNKQQELSISKAGTVGNVRIIDEAETAIRPIQPQKMLIVLLALLLGAGGAAAVVLLRA
AFHRGINDIDTLEKRGINVYATVPLSPWQVKRNREQRHLLPKSGGRRLPILAVAEPTDLSVEAIRSLRTSLHFAMLEAKN
NILMVSGASPESGKSFTSTNLAVVVAQAGQRVLLIDADMRKGFLHRWLAEDGHRGLSDMLVGDVMAEQAVRKTAIANLDF
VPRGQVPPNPSELLMHRRFADFLRWAGQNYDLVLIDTPPILAVTDAAIVGHHAGTSLLVVRFEVNTVKQIETSMRRFEQN
GVAIKGVILNGMVKKSAADAGYYAFAYPSHQEEKVP
>gnl|bykdb|A0A399I453 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Geobacter sp] (length=283 residues).
MSRIEKALEKAAQLRNTTTTVVEQITNYPENSNYSSQTVSRTLDIKPSSRLLTTIIDPHSPVSEQYRKLKTHLVKLTQKD
GFQNILMVTSTVSREGKSITALNLAISLAQEFDHTVLLVDADLRRPSIHQYLEFEPEIGLSDCLLDGIDIGEAIVRTGIG
KLSVIPAGKEVPNPLELFSSKKMQDLVKEMKHRYHDRYVIFDTPPLLPFAETRSLGHLVDGIVFVVKEGEASQADIREAI
DAVKGCRILGVVLNESSDSVDDNRYGEYSYYMNYAKDKAAASS
>gnl|bykdb|A0A3A0FJZ4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Proteobacteria bacterium] (length=623 residues).
MSDAPAPGFDLRDAVLCLRRRAGWLALALALGVAGGVAAHRLLPPRYVGESTLLVESSWVRDGFIDTPVASSLRSQVQTL
RHRLTSDRALAGIVAALGDAPLAALPAAGREGALRKHLELEVVDGASPEAAVVRIAFRSPDRALALGVVRASAEQLIAER
EAERASQAQATEALLASQLRDLQAELASQARELDEIELARSGAALGASGDGGEVHTLRSSALASIQELQSQLSRAEAVYT
RRHPSVKQLRAELARRRAQLVAPAATAAGVAAVSDEPSARYRSLLRAYDTNVQSYARLLGRQIEAAMGRRLEQSGAALEL
RVLREPFVTPFPSPAHLPLFAGAGGAAGLALGAAALLALALRRPSFESVERLAASSGLPVVAAIPLLGAARARGERAAPP
AGLLVDVAPQSIAAEQYRGFLPYLPSAGEGALVLVTSAERGEGKSLTAVNLAASAALDAGRRVLLVDADLRCPTQHRLLR
AERAPGLCEAVENGTPLAEMARPTRVANLFAVGAGRRCENPLRVLEDERFAALLGAARSAFDLVLVDAPPLLPVVDARLL
ARRATMIVFVVRADRTPRAVVLRTLGELDAPVGIVLNGIGASAYRRYYRSEPYGAAYPVQSGA
>gnl|bykdb|A0A3A0FQ32 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Proteobacteria bacterium] (length=282 residues).
MGKVYEALQRAEAERGRRGAGAVPGVTAPAAQPIARAPGGAPAGRLARLRSWVVRQIRPVEVEDANAYNKRRISLLQPDS
FVAEQFRTLRARLDALASERPIRTIAVTSAMPNEGKTTAALNLALVSSMSLGRRVLLVDCDLRRPKIQAALGLRPECGLA
EVLTDAGTLERAVIKVEGTSLSVLPVRATPSNPSELLASDRMRSLVEELARSYDQVIFDTPPTLALPDAKTMSELTDGLV
FVVRANETPRDDVAAALDILDRRRVLGVVLNGVEAEPERYGY
>gnl|bykdb|A0A3A0FZC0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Proteobacteria bacterium] (length=668 residues).
MLEQPEIKSALFDTANQGFFGQLFGGDSESKQESDKLDQLAGYKSTVRQIKVYLSTIEIKPVRRTSLVTVEATVSDPRLA
ALIANRHSESYIDWVRQNRIDQQARGLTFLRAQADELREKVADLERELADYAEANSIVAVNKDENITAQKMSQLNRLLTD
ATAKRIEAENLYKEAEAALSNPSAGFDDPSTQHMRGELAKLEAEYQQLSAKFTSSYPRMVQLKAQISGLKQSIEGQRRQV
VTGLKAKMLAAQQEEKNLHEELEQQKSQAFELSKRQVQFNVLNRELTSSRELLQNVLRQIKETSLAVESNASNVSIVDYA
VTPIEPSFPRKKLILLLGMIVGVGLGVGVALLFNYMDSSIRTPEDVMHLLKLPSLGVVPSFELEALGPPGSAPGAGSAAE
SNGASWKGSKDGGVGQAIVPLAQAVSDLPIVFVNNPRSLASEAYRTIRTGILLSQAGEPPRTMLVSSAQSAEGKTTTSIN
LAASLASAGGRVILVDADLRRPSVEKHLNMQRTDLGLVDVITGQRTLEEVIIPDVIKRVSVIPSGKIPPNPAELLGSRDM
LEIIGQLARMYDYVLIDSPPVLPVTDSVILSRFVDGVVLVVRGATTPRKVVADAKRRLQSVGARFLGVILNDVNVSGGDY
YYYNRYYYSYYTEDNQKRAKRPKQAAAG
>gnl|bykdb|A0A3A3BFE8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter sp. JS678] (length=478 residues).
EHITKVLNAILVTYGDQNVERRSAESAQTLKFLDEQLPDLKKQLDDAERQFNKFRQQYNTVDVTKESELYLTQSITLETK
KAELEQKQAEMAAKYTAEHPAMREINGQLTAVNKQISELNSTLKQLPDIQRQYLQLYREVEVKTQLYTALLNSYQQLRIA
KAGEIGNVRIVDTAIEPVEPIKPKKLQVLLLSLFLGGFIGTLIALVRNILRTGIKDSNQIENELDLPVYATVPRSPIQES
RIKILKKKKSIPILAVKNSDDIAIESLRSIRTAIHFALTNAKNNIIMIAGPSPEVGKSFISTNLATIFAQGDKRVLLIDA
DMRRGYMHKYFDVDVKPGLSELLSGQADLQKVLHKTPVANLDVITRGKSPTNPSEILSSNQFKELLEQLQSQYDHIIIDT
PPVLAVTDGIIISQYTGVNLIVARYAKSQMKELELTLNRFEQAGVKVNGFILNDIQRASAGYGYGYNYAYAYKAQKED
>gnl|bykdb|A0A3A3H6D9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium sp. DCY119] (length=266 residues).
MEHIHAALQKAKQQRGSDPANDQTTTTVARMGSDMLWASLPSLKPDPKHLAKTRLVTINRSDLAHTQFDMLRTKVLQYLR
QNNWTSVAITSPTPACGKTVVGLNLAFSMAHHKECRTVLIDLDLRRPQVSKVLGIKEPPSIESFLRGRSEVEDVFIRYGD
NIAIGANGRPVRFAAELLQSPEAAQALKSLKQKLKPDVLIFDLPPMLANDDVMAFLPNVDCVILVAAAEASTFSEVDICE
RDLSEKSKVLGVVLNKCRYAPEKYGY
>gnl|bykdb|A0A3A4NIE9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Deltaproteobacteria bacterium] (length=257 residues).
MGGDDPMKIPFLDTLLKENTKRPEHESGPLFSTGEEDLIFREHFKGLRSKLEYKAEILGWKVIGVTSSIAGEGKTLICVK
VAVSLALTKRKKVLLVDADIRKGDLSKGVGIPVEPGLTDYLVGNTDIRKVLRNSKVPGLDTISSGTSVPAPADLLAGDGF
RIFIKEARERYDIVLLDTPPVLPVADTMSIREQVDGFLFVYRVGFTPITMFQQASEEIGEKKILGVVLNGVEPKSDRYYG
RYYGHYYTSGKTTEALR
>gnl|bykdb|A0A3A4NUI9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Deltaproteobacteria bacterium] (length=252 residues).
MIQFPFFKRNGRPHVKRGPYDIFAVGKEDPLFLEKFKGLRAIVEQKVDLHQMKLLGITSSIAGEGKTLCCAHLGRSLANT
GRKKVLLVDADIRKSELTRGMGARRTPGLTECLLGGATLQQVIHPTRIPNLSLIASGIEVSSPADLLAGDPFKSFLREVR
GRFDAILLDTPPVLPVADTPTIRDLADGFLFVYRAGFTPYTLLRQAMEELGEKHVLGAVLNGVEAASPGYYQKYYGSYYQ
LRAKSDGIPEKK
>gnl|bykdb|A0A3A4S038 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobacteraceae bacterium] (length=277 residues).
MGKVFDALEKSNQKISIEPLASDERKNQDRDDSAQVEGRSQSNTARFDKSLVTILEPHSFESEQFKILRANILFPTSGKP
PRMIMVTSAVPGEGKSFVASNLAISIAQNIDEHVLLMDCDLRLPSIHNRFHFESKTGLSDYLTGDVPLSSLLVKVGVDKL
SILPGGKPPANPAELLSSEKMTQLLEEVKLRYEDRYIIIDSAPPQLTAESSALARQVDGIVLVINYGKTKRELISDLIEI
LGKEKIIGIVFNRFNLRSSTYYGYGKYSHYGKYYGTK
>gnl|bykdb|A0A3A4XVN3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobacteraceae bacterium] (length=284 residues).
MRMKIEKAVDKMKMQWRKADKTEPAVQKKNFRYDSSIKQWKPPVYSRSRSVELDQTAVIANRCVCLLPNSPELDCYKVLR
TQIIHRTKAKGWNTIMITSIRPGEGKTLTSINLALTFAKTYNHTVLLVDCDLRQQNVYRYLNLESKMGLVDYLAHGMDLK
DLIIWPKIDQFTLISGGPTIHESAELLGSPQMKALVAEMKNRYQDRYILLDAPPILAGADALILMPLVDGIVIVVESGKT
SLKEIGEGLELLPKEKILGFLMNKHTSANDTYYEYYGASAHQPV
>gnl|bykdb|A0A3A4ZYW4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobacteraceae bacterium] (length=268 residues).
MGKISEALERHNKENSVKKSGSPSMFVSQTLSGPETALKSLGPLSGYDHRLVVLSDPNSLEAEQFKMLRAQILFPKEGKV
PRTIMVTSSYPGEGKTYVSANLAASIAQGINEHVLLIDCDLRNPSIHKILGYSNNEGLHEYLTGEKQLNDLIIRSGIEKL
SLLCAGGPSKNASELLSSAKMKTFIQEVRDRYHDRFVVIDATPTQVTSEPNVLANIVDGIVFVVMAERAPRASVRKSIDL
MGREKTLGVVFNGYSEDMKFHRKYCSQY
>gnl|bykdb|A0A3A6P8F8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfurivibrio sp] (length=289 residues).
MGKVAEALSKAGADIKRVTEGIDGNNQGNTALSEGKNDKAGKKIKSPRSFSSYVVGNGWDERLVAAIENYPGVAESFRRL
RAKILHPAEGKPARSILVTSASPGEGKSFVCANLGVIMAHGVDQHALLVDCDLRRPSLAQFFGIESAGAGLVDHLRDGTD
ISSLIVKTGIDRLSLIPAGAPPDNPSELLASQGMSNLIKEVVDRYDDRFIILDSPPAQAASETAVLAQHVDKVVLVVRWG
GSGREQVKKLVEQIGSEKILGVVFNAFEMNIIDKRLQDEGYYKYYSDEY
>gnl|bykdb|A0A3B7DTA4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Novosphingobium sp. THN1] (length=338 residues).
MLKRVAETNRSSYDALLERYNQLTATAGASANNVSVVDVAEVPSEPTSPSFPKNIAIALLLGMGTAAAFVFLKDHFDDTI
RSPLDVEGKLGVPMLGLIPHVGSDAEGAALDQVRTDPKLPISEAYVSLVTNLTYATADGIPSSIAITSSQASEGKSTTAN
AIAIDLARLGRRVLLIDADMRRPTLHRIKKIKLQSGLSDVLSGNTQLADVVQQDGEEAGLSFVLAGPRPPEASILLGSGR
LNALIQEARGLAEVVIVDCPPMLGLSDTASIAAHVEAVLMVVDSSQGHRGAVKSALRRLSLVNARIIGAVLTKFDPKAAN
SKYGYYGYNYYSYGQDEA
>gnl|bykdb|A0A3B8SQ27 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas sp] (length=290 residues).
MLGGLVVGFGLALAIVFIRRKLFPSIESIDEIERLGLPVLAAVPMFSAKQLEGVLGDGAPAKQPAVLMGANDPCTEALRS
LRTCLRLSLPNRRNNLIMLSGPSPAVGKSFISLNFAVLAARAGQRVLLIDADMRRGHLHEALALSEENGFAEVLQNQSSV
TAAIRPTAVENLSFLPRGKPPLWPAELLLEPILENVLQRVGELFDLVVIDTPPLLAVSDALIIGQHAGINLMVLRFDFTA
AREVELVLRRFEQNNTELHGAIFNSVEERTSTRYGYSKSCYRLDYRTVHS
>gnl|bykdb|A0A3B8T2U6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Glaciecola sp] (length=604 residues).
KKLVKTAIPLFPDPQEVVLTDTEKQQNRLDFAIAKLQANIDIKPVFHTHVVEIEFVSEDPLLAATISDTVANVYIENYLE
AKLEMTAKATTWLNTSLAGLKNNLIKSEQALNAFYEKEKLVNIDGVIGLASEELQRYTALFVDAQNNLARVRSIFEQVNG
QESKQDLASLQEVQNHPTVQNVKKQQLNAQSRVSELAKVYGPRHPKMIAANAELESIDDSLARQVRALVDGIYQEYQAAE
SKVNSLKVEVESAKQNYRKLSNLENQHLALQREVEINNQLYSSFFTRLKETNEIGGFERANARILDAAKPALVPFKPRKA
MLILLAFVASLLLAISAAIIKDTLNRGIRSVEDVERKLNQRMLGLLPLEKVKRKSSLPVRHFFADEHHVFSEAIRTLRTS
LQFTNLEKSSQTMLVTSSVPKEGKSTVAINLGFAFSQLAMVLLIDADMRRPSIGKQFNLAGFQPGLSNLIAKTHELSECL
CIDEESGLHILPAGTIPPNPQELLSSERFTRIMSVLKQKYQYIIIDSAPTQAVSDAMVLAKTADSIVYVVKANDTDEGLI
NNGISRFLMNGKRVDGVVLNQVDIHRADKYGEFAGYYDRYDYQS
>gnl|bykdb|A0A3B9KZE9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Hyphomonas atlantica] (length=431 residues).
YQNKLEIYRPEYSEMTELKRRIELTDREIEAERTRIVDALETSFRAAEAKEASLRERIGELKTKLIELRTQSVQYGILER
QVETNRSQYDALLTRLKELTTAEGIGASQASVVDRAIAPTHPFQPSLGKHLLLATILSLAAGIGLAILWEYIDDTIRVPE
QLISKLGLPIIGIVPVASKSSDLVQDMMKNPKDSLAEGYFSIRANLLFSTNSGAPRCLSLTSASQAEGKSTCAVGLGLAF
SRSGQRALVIDADMRRPSFVVDRNLSIGLSGLLASDADAMEHIIAGPTENLFLLPAGRIPPNPAELLSGHRLNEILEQLK
QVFDIVIVDCPPVLGFADAPLLAAACDATVVVISSGKSRRITIRRSLDRLVSTHAQTVGAILTKFDARKVGYDYGYYYYN
YGPGAYDYARPSARTERQSRKITLFKDQLDD
>gnl|bykdb|A0A3C0L0A8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Gammaproteobacteria bacterium] (length=236 residues).
FRIRLRFLMMNAKNNLAMISSGSPGVGKSFVCANLATVAAKSGQRVLVVDGDLRSGRLHRSFGVNPHNGLAEVLAGTIGI
NDAISTTMVDNLHFMPSGEMPINPSELLAGPALSKLTRWLSAVYDMVIFDTPPILEVTDAAIIGRHCGTKMMIARFEQCT
IREITAAKSRFNLNGVDIDGIVFNAVRKKAENYYHDEKLLHGNYYQAPTRLQTSVPIDPTIVSTEELESLGILRRK
>gnl|bykdb|A0A3C0PWB6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas sp] (length=508 residues).
ALDYQDRLKVGEAGKDSGIIYMSLEDPDPQLASRVLDEISRLYVSQNIQRSSAEAAQRLDFLRSQLPQVRKELEKAEAAL
HDYQTSSKSVDISIETKGVLDQIVQLETQLSELTLKRVDYDRLYTREHPTYRTLMSQMNELQAQKAQLLKKVDALPMTQQ
ELLRLKRDMEVTTQTYTLLMNQAQEQDVLRAGTIGNVRIIDNAYSMTEKPSKPVRPLVVALAIFLGLLVSAAVILLRQAF
YRGVESPDVIEKLGVPVYAGLPYSPSQEQLNRRRKARDGKTRLLSLTEPTDLAVESLRSLRTSLKFAMLEARNKVLMITS
PTPAVGKSFVSSNLAAVIAQTGQRVLLIDADMRRGYLHTLFGMAPRNGLSDALASGLSLAEITNRTEVKNLHFISAGFSA
PNPSELLMHENFSRLLKEAERLYDFIVIDTPPVLAVTDAVLVAQQAGTNLLVARFGLSTSSQIDASKRRLAQNGVLLKGV
ILNAVKRKASTSPYDSGAYGYYTYTQQA
>gnl|bykdb|A0A3C0PZN1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas sp] (length=451 residues).
FLNEQVPAVRRNLEAAQTALNKYQTGSRSVDITAETQSVLDRIVDLEKQISEQNLKRTEMERRFTRQHPNFQALMNQINQ
LQMQKDQLEKQIDTLPSTQQELLRLTRDVEVSSETYSMLLNKTQELDIIRAGTVGNVRIIDHAAADLENPVKPNKPLVVI
VATLLGALLATAFVYVREALKRGVENPEDIERTGTPVYASIPFTEKQATLEKRLANFKRDKSTASYLLTINDPADLATEA
MRSLRTSLHFAMIEAKNNVLMITGPSPAVGKSFVTTNLAAVVAQSGKRVLLIDADMRKGYLHKVMRCDGDKGLSDILSGR
ITLFDAIQKTQLNNLHVITHGQLPPNPSELLMHENFSRFVKEISHMYDLVIFDTPPILAVTDAALVGSQAGTTLMVTRYG
LNGLKEIEAAKRRLEQNGLLVKGVIFNAVVRKASTYGEYGYYQYEYASTNK
>gnl|bykdb|A0A3C1S9Y1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobacteraceae bacterium] (length=640 residues).
MPGTEDNMFSNLREWFKEKRQSWKDQMDSLLSSDKNKGNTVPKSDDPSQDSPLVSAFITRIKVSPIRNSRLVDVTAEAKN
PALAARMANEVVKVYIDQNMETKLAAAKDAVRWLTERIEDERKKVETAENALLQYKQEQGIITGFSNDAEKITAEKLAKL
NNQVVEFESKRVETETRYQQALALEKTPDLLDSIPEVLSNDIIKEIKKMEVNLYNKMSELSKKYGSNHPQMVAIQSELAE
LHQRKATEGKRIVSSLRNEYRMAVAKEDSLKKSFEEQKGESLNMNKKAIQYGVLYRQAESSKHMYELLIKRFKETSLTEE
MKTGNIRVIDRAEIPNTPVSPNKSRNILLAVVVGLTMGIGLAFGLEYMDNSVKLPDEIKQYLGIPYLGPIPAYDANEQKY
GAVRELITLHSPKSTPSESFRGIRTAVMFSSADVRPQVILVTSARPAEGKTLCAVNIAVAMAQSGSKTLVIDCDMRRPRV
HKIFETGENKGLSAVLVGTCELDEAILPTGIENVSVIPSGAIPPNPSELLGSKRMDTIIQELRKSYDRIIIDSPPITAVT
DSVVVSSLVDGVIIVIRTAETPKQVVYNAMMSLKAANARILGAVLNAVNIGKDSYYYYHNYYYYYGTGGKSKKQQLKEAA
>gnl|bykdb|A0A3C2BN18 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Enterobacteriaceae bacterium] (length=214 residues).
IEAVRSLRTSLHFAMMQASNNVLMLTGVSPSIGKTFVCANLAAVISQTHKRVLLIDCDMRKGYTHELLGTSNVNGLSDVL
AGQGDIAACARPTSVAGFDLVPRGQVPPNPSELLMSERFGALIAWASKNYDIVLIDTPPILAVTDAAIAGRHAGTTLMVA
RYAVNTLKEVETSLSRFEQNGIAVKGVILNSIFRRATGYQDYGYYEYEYQSDTK
>gnl|bykdb|A0A3C2DSE7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas sp] (length=422 residues).
QADRAHARSRVEELSRRYGDRYPAMQSARSDLNAATASLRQQVEQVVASIERSYQLAVANENSLRASFNDNKEQIQDISR
KEFKVRDLQREVEANRALYDTFMTRLQETTATSDLSSTNARIVDEAIPPAQASEPNTRLFMVVALFLALVAGIAQAIIRE
ILDNTFKSSDEVETKLNLPVMGIVPQVPRNLRKQVSHLFQRNEEKRFCEAIRTIRTNITLTEGNQPRQVLVVTSTAPGEG
KSSVSANLAFAMAQLNRVLLIDADLRRATLDQTFEFAPGTPGLANLIGGNAKLDDCIRSVGNVDMISAGTVPSNPLELLS
SPRFAKLLEAVKGRYDRIIIDSPPSQAVSDAAVLSILADAVIYVIKSESTLIPHAQKGVAQLLQSNAPVAGVVLNHVDVE
KAKRNGQFRGYYDHYGYSEQTV
>gnl|bykdb|A0A3D0KAC8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas sp] (length=450 residues).
LNEQVPAVRRNLEAAQTALNKYQTGSRSVDITAETQSVLDRIVDLEKQISEQNLKRTEMERRFTRQHPNFQALMNQINQL
QMQKDQLEKQIDTLPSTQQELLRLTRDVEVSSETYSMLLNKTQELDIIRAGTVGNVRIIDHAAADLENPVKPNKPLVVIV
ATLLGALLATAFVYVREALKRGVENPEDIERTGTPVYASIPFTEKQATLEKRLANFKRDKSTASYLLTINDPADLATEAM
RSLRTSLHFAMIEAKNNVLMITGPSPAVGKSFVTTNLAAVVAQSGKRVLLIDADMRKGYLHKVMRCDGDKGLSDILSGRI
TLFDAIQKTQLNNLHVITHGQLPPNPSELLMHENFSRFVKEISHMYDLVIFDTPPILAVTDAALVGSQAGTTLMVTRYGL
NGLKEIEAAKRRLEQNGLLVKGVIFNAVVRKASTYGEYGYYQYEYASTNK
>gnl|bykdb|A0A3D1BYV9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Shigella sp] (length=256 residues).
SVYASIPLSEWQKARDSVKTIKGVKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMIQAQNNVLMMTGVSPSIGKTFVC
ANLAAVISQTNKRVLLIDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSER
FAELVNWASKNYDLVLIDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASA
YQDYGYYEYEYKSDAK
>gnl|bykdb|A0A3D2M6Y9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas sp] (length=323 residues).
QDILRAGTIGNVRIIDNAYAVVEKPAKPIKPLVVLVAIFVGLLVSAMVILLRQVFYRGVESPETIEHLGIPVYAALPFSA
KQEHLYRLRKIRDGRSKLLGIADPADLAIESLRSLRTSLKFAMLEARNQVLVITSPTPSVGKSFVSSNLASVIAQAGQRV
LLIDADMRRGYLAGVFGMAPRNGLSDALAGGLHLAAVVNKTDQPNLHFVASGCSAPNPSELLMHDNFARLLKEAEREYDF
VIIDTPPVLAVTDAVLVAQLAGTCLLVGRYGLSTASQVEASKRRLAQNGVLLKGAILNGVKRRASSTAYETGAYGYYSYS
QKA
>gnl|bykdb|A0A3D2Y902 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas sp] (length=354 residues).
TQQELLRLTRDVEVSSETYSMLLNKTQELDIIRAGTVGNVRIIDHAAADLENPVKPNKPLVVIVATLLGALLATAFVYVR
EALKRGVENPEDIERTGTPVYASIPFTEKQATLEKRLANFKRDKSTASYLLTINDPADLATEAMRSLRTSLHFAMIEAKN
NVLMITGPSPAVGKSFVTTNLAAVVAQSGKRVLLIDADMRKGYLHKVMRCDGDKGLSDILSGRITLFDAIQKTQLNNLHV
ITHGQLPPNPSELLMHENFSRFVKEISHMYDLVIFDTPPILAVTDAALVGSQAGTTLMVTRYGLNGLKEIEAAKRRLEQN
GLLVKGVIFNAVVRKASTYGEYGYYQYEYASTNK
>gnl|bykdb|A0A3D2YAZ2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas sp] (length=211 residues).
RSLRTSLKFAMLEARNKVLMITSPTPSVGKSFVSSNLAAVIAQTGQRVLLIDADMRRGYLHTLFGMAPRHGLSDALASGL
NLAEITNRTEQKNLHFISAGFSAPNPSELLMHDNFSRLLREAEKLYDFIIIDTPPVLAVTDAVLVAQQSGTNLLVARFGL
STSSQIDASKRRLAQNGVLLKGVILNAVKRKASTSPYDSGAYGYYTYTQQA
>gnl|bykdb|A0A3D3PV27 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Leclercia sp] (length=209 residues).
SLRTSLHFAMMQASNNVLMLSGVSPSIGKTFVCANLAAVVSQTNKRVLLIDCDMRKGYTHELLGTNNVNGLSDILLGKGD
ISQCAKPTSIPNFDLVSRGQVPPNPSELLMSERFTQLVKWASENYDLVLIDTPPILAVTDAAIVGRHAGTTLMVARYAVN
TLKEVETSLSRFEQNGIAVKGVILNSIFRRATGYQDYGYYEYEYKSDSK
>gnl|bykdb|A0A3D3VHV9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas sp] (length=488 residues).
LESPRPADAARILDEVSRLYVLQNVQRKSAEAQQSLDFLKEQLPTVRRQLEAAEQALNAYQAKAGSVDITLETQAVLDQV
VELDTSISELQLKRSEMERRFTRQHPSYQALMEQLNQLNSRRNALVDRVGDLPATQQELLRLSRDVKVSTEIYTAMLNTS
QELDVVRAGTVGNVRIIDDAVVDTSQPVKPKKALIVVLATLLGGMLGVAIALLRHALNRGIENPELLEQIGLPVYASVPF
SKDQQQIERNAKGKTITQNSQLLAATNPADLSIEALRSLRTSLHFAMMEARNNILMISGPSPSVGKSFISTNLAAIVAQA
GQKVVLIDGDMRKGYAHKLMSLPAEPGLSNLLVNTHTLADALQKSEVPNLHFIPRGQIPPNPSELLMHVNFESLLKQLSG
MYDLVIVDTPPILAVTDAALVGRLAGTSLIVSRFGLNPVKEVEQTLQRFRNNGVEIKGAIFNAVEKKASAYGYGNYGYYQ
YEYKSDKK
>gnl|bykdb|A0A3D5BR56 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfomicrobium sp] (length=267 residues).
MSRIEDAMAKAAGLHSSSSKGGGKKKKRAKGSDRHPLKHGEESRSIRLPEETMVVVNEPFSPMAEEFRKLKEALVKMTKR
ERFDNLIAVTSATAGEGKSMTAINLAATLAREFDHTALLVDADLRRPSVDKYLNLGSKKGLADCLREGLDVGDLLVRTEF
GKLTVLPAGTHVPNPVEFFTSETMRQIFLELKNRYADRYIIIDTPPVLPFAETRSIASIADGVILVVKEGRPTLDQIQET
IEALENKVLGIVYNGAQLQDRSSYYYY
>gnl|bykdb|A0A3D5UYX7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhodobiaceae bacterium] (length=479 residues).
ELNAQLILARASLAEAQAKYNRARQLRAQGGSVESVADVLASGTISGLRQKQAELAREKANLSAKYGPRHPAIVNIEAQQ
SDIGSQISAEVSRIIESLANNVSVAKTRVSALRDNLNQIKGETGADNQALIQLRELEREADATRAVYEAFLNRFKETTGQ
QGLQTPDTRIISQAVVPQAASYPRVTLFVGLGFVLSLMLGCGVAFLLEHFDNGIQTARDIEQSLHLPHLVSLPATPAEKG
PGGKVVLPQDYLIAKPLSAFSESLRSLRSALQLSNVDNPPKIILFTSALPAEGKTTTAVSFARAAAASGLKVVLVDCDLR
HPSIHRAFGLGRPEEGLVEFLAERLELSAVMVKDSKSELDIIPVATGTANPPDVLGSVQMKLLLQRLRDDYDLVVLDSAP
VLPVSDSRVLSRLADETVFVVRWNETPRDAAQSALKELRQFDAKIAGAVLTIVDTARQARYGYGDGGYYYSRYSKYYVN
>gnl|bykdb|A0A3D5ZY44 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Oceanicaulis sp] (length=284 residues).
MAGAGTIVLLEVFDNGVRTEADVERELGVAHIASVPLLGQGRFGRKRSGKSDQPYDYIRENPLSGIAEAFRVIRSAILLS
NIDAAHKTVAITSALPGEGKTTTTYSLGRISAMSGSRTLIMDCDLRRRLLTKAAAPQAAKGLLEVLSGDCTLDEVLVADA
EQGLHILPVVESQFTPRDVFNSDAFKSLMAVLRQRYDLVLIDTAPVLAVTDTRVIAARADAVVMNVKWKTTPREAAASAL
ETLHDVRANVLGVALAQVDMNAQARYGYEGSSYYYKNYRSYYSG
>gnl|bykdb|A0A3D6C3I2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobacteraceae bacterium] (length=229 residues).
MDGLHPSIVTALNPQSVEAEQFRLLKNNILFPEKGFPPRSIMITSPSPDEGKSFVSANLAVSIAQSIDEYVLLIDCDLRG
PSVHKLFGVENNKGLSDHLSSDIPLNALLKKTFIDKLTLLPGGSVPPNPSELLSSEQMRTLLSEVKSRYSDRYVIIDTPP
PYITSETNAIARVVDGIIIVVRQGKTRKKEVQDIVDIYGRDKILGVIKNFATTTPMMGYKYQKYGYARR
>gnl|bykdb|A0A3D8MRR7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Bradymonadaceae bacterium TMQ3] (length=738 residues).
MSDQYGFQEPRQSSAPEERGESLGALIGRYWALFRRFYWVLILTSIACVAAAYFWTDRQPRIYQATSKLIFHESRPNVFG
KQFERVELVDPGGRWQFEQFWNTQKEVLGSKWFAQRVIEREGLLDAPGFLSPSVQQLDEDERMKRAVNTLQRVAVYSLQR
DSRVGLVQVRFKDPELAASIADGISETYVEYIREFQTGGLRQLANWFDDYVSTKREELDESRSELQKYQRDNNILSHTFE
DRREMAAEGLAAVSTQLRDVQARLFAEEALLNQLETMESRGDDLRALGDLVDNPALKRGLDRESELLERRAELKTRYLDA
HPEVRAVDEQLEVVRRSIEEEIGRIRTAVANRAAVTRRNTANLQEEIERHKAEIAELNQIGFRYTEMRDSTETLRQHYET
VLGRTNELDLNALYESEIIQILENADVPGAPISPQVPLNLAVGLLLGLFLGGSIMVLIDALDTTVKTEEHVTKYTTRPIL
GMLPAVNAGAVKGVEKFGDSALDTLTHTAPRSSFAEAIKTLRTNLMFMAPDNPPRVLLMTSPGPGEGKTLTSVNMAIALA
QSGQRTLVIDSDMRRPRVHKALGMDNTVGLSEAITGERTYKEAVRPTGIENLEVMTCGPVPPNPSELLQTERFRKLVRDL
REDYDRVIFDSPPLAAVADALVLSHSADVVLLILKFGQTRQELLRRSIEQLESIGAPFGGTVLNDIDENAGYGYAYYYRY
RYDEPGDSGDSKGGKMAS
>gnl|bykdb|A0A3E0H727 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Paraperlucidibaca baekdonensis] (length=307 residues).
MVALQEVLLNLDNPLYRAYVSHPSQWLASIAGNVNIFVFAQLTLRPIEPKKSLIVVLATIPASDAQDKLVKKLQKKGGSL
AVLAHYEPTDLAIESLRSLRTSLHFALVDAPNNLLMITGPGPGVGKSFLSVNMAALLASTGERVLLIDADMRRGYLNEYF
GAERKHGLSELIAQGLEASTVIRATGLENFDYVSTGELPPNPTELLLHPRFEQFLKDMEAKYDRVIIDSPPVMAVTDAAI
VGRHAGATLFVARFNQTQMHEIELSLKRLGQAGVSVKGVLLNAVAAAAGGYGYGYKYGYAYKYDQRK
>gnl|bykdb|A0A3E0WKI3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Alkalilimnicola ehrlichii] (length=408 residues).
MLNQVVEVEQRLAEMDLERSQLRMSYASQHPNIIALDEQMERLRERRREFDSRIRELPQSQQELLRLRREAEVNSALYTA
MLNNAQELRVVRAGMVGNVRVVDEAITGHRPVRPNRSLTLAVSVVLGGLLGVFTVFLRNMLRRVVVSPDELEKAFDLSCY
AVIPESETFHRQERRAQKGKGAPPILVRDMPEDLASESLRGLRTGLHFALMNRNGRCVALTSPNPSAGKSFLSLNLAYLL
AEAGKRTIVVDADLRRGHIHKTLDVTRAPGLSDVIAGKASLDEAIRPVGDSKLHFLPTGEIPPNPSELLMSERLDEVLRS
LEESYDLVILDTAPVLAATDGVLVAARAAAVFLAIRAGTTSLAEVRQAVRAIYRDSVPISGFILNRLQQGSARYSNGGYY
HYQYSYNA
>gnl|bykdb|A0A3E0WXH2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Alkalilimnicola ehrlichii] (length=276 residues).
MERIKQALEKAKSQAAGSTTGWSGVSPGAFVAAESKASADTGDVSSLAYSHTRVVTLDPTHLEKHRVVAFNKNDPSTVAF
DRLRTQVLQKMDEKAWRTLAITSPNEGAGKTVVAINLAISIARQTGKTAMLVDFDLRRPKIAKYLGFDAERSLNEVLAGQ
ATVADALINPGIPRLVVLPTMRPEQLSAELLSSRVAESLIQELRNRYPDRIVIFDLPPLLNTDDALVALPQIDAALLIIG
NGEVTEAELKDSYRCFTADRLLGTVLNKGEESANYY
>gnl|bykdb|A0A3M0ZZ99 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Alphaproteobacteria bacterium] (length=383 residues).
MEALRGELAAIEGREAEVTAELRRALQQGNLSAEALARFYELRQEAEIARSQYAALLARQRQLEAQAPIQLADARIVSEA
LAPGTPSFPNRRMILGVGALLALGLGFAFALAREIHFDGITSPERLETVLGLPVAATLPRHPAGRRDAAGCDGAPADAVA
RAPLSAYAEAVRALRAALDRQLPPTAEAARVVMICSAQAGEGKSTTALALARAHAQLGQRVILVDADLRRPSLHALIGAC
PLYGLADYLADPHTEPEGDGFLVQDPLSAATLVVGRPWSESATDRLLLSPAFMALMAHLRSIAELVVIDTPPLLGMVDGE
ILAGGADAAVLVSRFGRSSQAALRAARARLDAALPSGAPVLAVLNGAEAWSAAAGSAPLYYHA
>gnl|bykdb|A0A3M1CJM3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Deltaproteobacteria bacterium] (length=533 residues).
AAAWLASQAAELKTRMEQAEYQLYEYKRKQHILSVSLEDRQNIISQRLQDLNQTLNKVQAERIALEARRQKILDIKEHRL
ALDAVDKVISNPLIQQLKANYVKLKEEHTELSTKYLPDHPKMKVVENKLKLLQRSINREIDNVLESLEAEYQVKLDSEKR
LRRELERVKAEAQELNKKEIEYNRLKRVADNYAALYQHILKRQKEATLAAHQETNNVYKLDSAVEPLRPVYPRVKLNLLL
AMVVGLLGGIGLAFFLEYLDNTVKTQEDVERQLGVPFLGLIPTIKPEEKEDIDDATPLRDNFLITHPKSSVAECCRTVRT
NILFMSPENPPRRILVTSAGPQEGKSTVVINLGITMAQSGSSVLLIDTDMRRPRLHKSFDMKKPEGISSVILGEVGLDEA
IVGTEVEKLDILPCGPIPPNPTELFHTERFAQLLETLSSKYDRLIFDSPPVMMVADPLILSHSMDGVIMVVKGASTSRDV
VKRALKQLEDVKARVLGVVINDLDLDNKQYGYYYYRRYGYYYGEKESDAASTG
>gnl|bykdb|A0A3M1D4H3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Deltaproteobacteria bacterium] (length=485 residues).
IQETRARLARARAFQGRESVDQVAATTSAANKLVARLQDDLTNLRQKRANELTDKTPEHPDIQNLDKLIAETEAQLAEAL
AAQHALDPTVEQYEAQLAGLVKKGAEIDASIQRTTEQFSTYPDKMRHMSQLELAAEAAENVYKSLQEQNYQVGVAESMLV
SDMQLVEPAVAPERHYSPKLLVNAVFGIIAGGVFGFGLAFLLEYVDDTVRTPEELSMVWEVPKLGVVPRFKLTGERRVID
ELATTHPIAESYRTIRNGLMYASLDKPLRLIAVSSAVPSEGKSTFSVNLGISFAREGKRVLIVDCDLRRPAQHRNFPLVS
NHVGLTDVLTGTASFEDAVQETTVPNLSLLTSGPTPADPARLVESLRLRQLLLDFRKQYDVVIVDTPPCLVVNDAIVIGR
AVDGMILVVESGSTSRKLVTEMKNRFEVAGLEPVGVVLNKLDFVSSGYGYYYKAYRRYGQEGADGDRAKASEEGVGDQGS
TGGAA
>gnl|bykdb|A0A3M2BE89 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Gammaproteobacteria bacterium] (length=568 residues).
LGQPLTLVAQASNHYRLLDEEGEMLLEGQIGRVAEDHGISLYVSELIARPGTRFDLKKTGWLTAVKTLQKTLKVSEKGKK
TGVFLLTLEDPDADRAVAILNAIANVYLRQNVERKSEEAQKALEFLQGQLPKLKAQLETSESRLNDYRLQRGSVDVGLEA
EALLDQSAKLEQQISELKLKKLELRRRFTDNHPVIQSLEDKLGRLQTEQQTLEQRIKALPSTEQEVLRLMRDVKVQTELY
TLLLNKTQELEVARAGTIGNVRVLDYAVRPDRPVKPKRALIVALGLVAGAFLGILLVFVRKAMQQGIQSPDEIEKRLGLS
VYASVPHSEAQKKLHEQMKKGRGSREYLLARVDDTDLAIESLRSLRTNLHFGMMDADNNRILITGPAPGVGKSFVSANLA
SVLASADKRVLLIDADLRKGHLHTYFSLSHKPGLSECIRGDMSLSDAVQPSGQDHLDILSTGAYPPNPSELLMSEAFGKL
LTDASTRYDLILIDTPPVLAVTDAVVIGKLVGTAFLLLRAGRHPLGEIQQAQRQLENGGVKIKGVIFNDIQPKRSQYGYY
GSYHYAYK
>gnl|bykdb|A0A3M2VEK7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. atrofaciens] (length=696 residues).
MDRRRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHARSQCQATLGVAELIKSRALLGKVVDDLQLNRLQTPDLFPV
IGPYLYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGERLTLTAGKPGQFSLYDSEHNLLLGGAINRVVE
GHGIKIQVATLQARPGTDFTVSRQRTLSTALIYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLKRVELERLYTREHPTY
RSLMSQMNQLEQQRQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGNIGNVRVIDNADTNVERPV
KPMKTLIVLIATLLGALVAMTMVFVRQAFYRGVESAEIIENLGMPVYASLPYSRQQEHLDKRDHAGKESKLLSIAAPAEL
AIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTDKRVLLIDADMRKGYLHRLLGLQPKHGLSDT
LAARLRCTEVINTTRVRHLDFISCGFAAPNPSELLMHDNFHKMLTELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTVQEIEASKRRLGQNGILIKGAIFNAVVRKATTSDYDCAAYGYNYHPAPR
>gnl|bykdb|A0A3M2XYQ3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. syringae] (length=696 residues).
MDRRPVFSARPGLRHSGHAGVSGHRHDSDRTPKNRHRGYAGSQCQATLGVAELIKSRALLGKVVDDLRLNRLQTPDLFPV
IGPYLYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPENLLGEKLTLTAGKPGQFSLYDSEHNLLLGGAINRVVE
GHGIKIQVATLQARPGTDFTVSRQRTLSTALIYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLKRVELERLYTREHPTY
RSLMSQMNQLEQQRQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGNIGNVRVIDNADTNVERPV
KPMKTLIVLIATLLGALVAMTMVFVRQAFYRGVESAEIIENLGMPVYASLPYSRQQEHLDKRDHAGQESKLLSIAAPAEL
AIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGKRVLLIDADMRKGYLHRLFGLQPKHGLSDT
LAARLRCTEVINTTRVRHLDFISCGFAAPNPSELLMHDNFHKMLTELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTVQEIEASKRRLGQNGILIKGAIFNAVVRKATTSDYDCAAYGYNYHPAPR
>gnl|bykdb|A0A3M2ZQH6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas savastanoi] (length=696 residues).
MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVAELIKSRALLGKVVDDLKLNTLQTPDFFPV
IGPYLYRTFKPVRDGELAKPLFGLTQYAWGGENIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVE
GNGVKIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDGVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTY
RSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPV
KPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGMPVYASLPHSRQQERLEKRDQDSKDSRLLSIAAPGEL
AIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDT
LAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNRMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNYHPAPR
>gnl|bykdb|A0A3M3CJL0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. pisi] (length=773 residues).
MAGPARHHRPLPAARVSLRTDLRAALALHRRLAPSFSVRSNRINDRHEPSFPEFPSGLPDRSGNSPADAVRSQDPDPVDR
RRVFPDRPGLCHSGHTGVSGHRHDSDRASKNRHRGHTGSQRQATLGVAELIKSRALLGKVVDDLQLNRLQTPDLFPVIGP
YLYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDSEHNLLLGGAINRVVEGHG
IKIQVATLQARPGTDFTVSRQRTLSTALIYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERSSAE
AAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLKRVELERLYTREHPTYRSL
MSQMNQLEQQRKGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGNIGNVRVIDNADTNVERPVKPM
KTLIVLIATLLGALVAMTMVFVRQAFYRGVESAEIIENLGMPVYASLPYSRQQEHLDKRDHAGKESKLLSIAAPAELAIE
SLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGKRVLLIDADMRKGYLHRLFGLQPKHGLSDTLAA
RLRCTEVINTTRVRHLDFISCGFAAPNPSELLMHDNFHKMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLVARF
GMTTVQEIEASKRRLGQNGILIKGAIFNAVVRKATTSDYDCAAYGYNYHPAPR
>gnl|bykdb|A0A3M3EF92 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas amygdali pv. lachrymans] (length=696 residues).
MDRQPVFSDRSGLCHSGHAGVSDHRHDSDRAPKNRHRGHPGGQRQAIVSVAELIKSRALLGKVVDDLKLNTLQTPDFFPV
IGPYLYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVE
GNGVKIQVAALRAHPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQNAQRANRILDEVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEEAETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTY
RSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPV
KPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGMPVYASLPHSRQQERLEKRDQDSKDSRLLSIAAPGEL
AIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDT
LAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNKMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNYHPAPR
>gnl|bykdb|A0A3M3EFX7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. aptata] (length=696 residues).
MDRRPVFSARHGLRHSGHAGVSGHRHDSDRTPKNRHRGYAGSQCQATLGVAELIKSRALLGKVVDDLKLNRLQTPDLFPV
IGPYLYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDSEHNLLLGGAINRVVE
GHGIKIQVATLQARPGTDFTVSRQRTLSTALIYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLKRVELERLYTREHPTY
RSLMSQMNQLEQQRQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGNIGNVRVIDNADTNVERPV
KPMKTLIVLIATLLGALVAMTMVFVRQAFYRGIESAESIENLGMPVYASLPHSRQQEHLDKRDHAGQESKLLSIAAPAEL
AIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGKRVLLIDADMRKGYLHRLFGLQPKHGLSDT
LAARLRCTEVINSTRVRHLDFISCGFAAPNPSELLMHDNFHKMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTVQEIEASKRRLGQNGILIKGAIFNAVVRKATTSDYDCAAYGYNYHPAPR
>gnl|bykdb|A0A3M3F6F5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. atrofaciens] (length=773 residues).
MAGPARHHRPLPAARVSLRTDLRAALALHRRLAPSFSVRSNRINDRHEPSFPEFPSGLPDRSGNSPADAVRSQDPDPVDR
RRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHAGSQCQATLGVAELIKSRALLGKVVDDLQLNRLQTPDLFPVIGP
YLYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGERLTLTAGKPGQFSLYDSEHNLLLGGAINRVVEGHG
IKIQVATLQARPGTDFTVSRQRTLSTALIYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERSSAE
AAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLKRVELERLYTREHPTYRSL
MSQMSQLEQQRQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGNIGNVRVIDNADTNVERPVKPM
KTLIVLIATLLGALVAMTMVFVRQAFYRGVESAEIIENLGMPVYASLPYSRQQEHLDKRDHAGKESKLLSIAAPAELAIE
SLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGKRVLLIDADMRKGYLHRLLGLQPKHGLSDTLAA
RLRCTEVINTTRVRHLDFISCGFAAPNPSELLMHDNFHKMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLVARF
GMTTVQEIEASKRRLGQNGILIKGAIFNAVVRKATTSDYDCAAYGYNYHPAPR
>gnl|bykdb|A0A3M3G2W8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas savastanoi pv. glycinea] (length=696 residues).
MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVAELIKSRALLGKVVDDLKLNTLQTPDFFPV
IGPYLYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLIAGKPGQFSLYDNEHNLLLGGTINRIVE
GNGVKIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEDAETALNNFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTY
RSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPV
KPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGMPVYASLPHSRQQERLEKRDQDSKDSRLLSIAAPGEL
AIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDT
LAARLRCTEVIHQTRVRRLDFMSCGFAAPNPSELLMHDNFNKMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNYHPAPR
>gnl|bykdb|A0A3M3GA16 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas savastanoi pv. glycinea] (length=653 residues).
RKAIVSVAELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPE
HLLGEKLTLIAGKPGQFSLYDNEHNLLLGGTINRIVEGNGVKIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAG
RDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLSI
ETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTYRSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQ
TYTLMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPVKPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLG
MPVYASLPHSRQQERLEKRDQDSKDSRLLSIAAPGELAIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLA
TIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDTLAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNKM
LAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLVARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYD
YAAYGYNYHPAPR
>gnl|bykdb|A0A3M3H5V6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas coronafaciens pv. striafaciens] (length=238 residues).
PGKNSRATLEPKLLSIAAPDELAVESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSANLAAIIAQTGKRVLLIDA
DMRKGYLHRIFGLQPRHGLSDTLAARLPCSEVINPTRIHHLDLISCGFAAPNPSELLMHDNFHKMLAELSPRYDLILIDT
PPILAVTDATLVGRQAGTCLLVARFGMTTIKEIEACKRRLGQNGVLIKGAIFNAVVRNAMTSDYDCAAYGYNYHPAPR
>gnl|bykdb|A0A3M3KPE5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas coronafaciens pv. zizaniae] (length=647 residues).
MIKSRALLGKVVDDLKLNVLQTPDFFPVIGPYLHRTFTPGSQRTLAEPLFGLNRYAWGGEKIDVFQLDVPESLLGENLTL
TAGQPGQFSLYDDEHRLLLRGATNRVVEGSGVTIQVAALQARPGTDFTVSRQRTFSTALSYQNRLKITEAGRDSGIIYLS
IEDPDAQKANRILEEVSHLYVRQNVERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNFQTSAKSVDLSIETKGVLDQV
VSLDATLSELKLKRVELERLYTREHPTYRSLMSQINQLEQQRQALLKKIEALPMTQQELLRLTRDMQVTSQTYTLMLNKS
QEQDILRAGSIGNVRIIDNADSNIERPVRPMKKLIVLIASLFGVLVAVTIIFIRQAFYRGVESAEVIESLGMPVYASLAF
SRHQDRLEKPGKNSRATLEPKLLSIAAPDELAVESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSANLAAIIAQT
GKRVLLIDADMRKGYLHRIFGLQPRHGLSDTLAARLPCSEVINPTRIHHLDLISCGFAAPNPSELLMHDNFHKMLAELSP
RYDLILIDTPPILAVTDATLVGRQAGTCLLVARFGMTTIKEIEACKRRLGQNGVLIKGAIFNAVVRNAMTSDYDCAAYGY
NYHPAPR
>gnl|bykdb|A0A3M3LF66 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas coronafaciens pv. zizaniae] (length=828 residues).
MCAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWPVARPARSRCSRPLSATPFSLRTDLCAALAV
HRRLASSFSVRRDTINDRHEPCSFGSLPGFTGRSGNRSADVVRSQSLDSLDRRAVLPDRAGLRDSGDALLPGQCHDPDRA
QKNWHRGHARGQRQADVSVPELIKSRALLGKVVDDLKLNVLQTPDFFPVIGPYLHRTFTPGSQRTLAEPLFGLNRYAWGG
EKIDVFQLDVPESLLGENLTLTAGQPGQFSLYDDEHRLLLRGATNRVVEGSGVTIQVAALQARPGTDFTVSRQRTFSTAL
SYQNRLKITEAGRDSGIIYLSIEDPDAQKANRILEEVSHLYVRQNVERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNN
FQTSAKSVDLSIETKGVLDQVVSLDATLSELKLKRVELERLYTREHPTYRGLMSQINQLEQQRQALLKKIEALPMTQQEL
LRLTRDMQVTSQTYTLMLNKSQEQDILRAGSIGNVRIIDNADSNIERPVRPMKKLIVLIASLFGVLVAVTIIFIRQAFYR
GVESAEVIESLGMPVYASLAFSRHQDRLEKPGKNSRATLEPKLLSIAAPDELAVESLRSLRTSLHFAMLEARNNVLMISS
PTPGAGKSFVSANLAAIIAQTGKRVLLIDADMRKGYLHRIFGLQPRHGLSDTLAARLPCSEVINPTRIHHLDLISCGFAA
PNPSELLMHDNFHKMLAELSPRYDLILIDTPPILAVTDATLVGRQAGTCLLVARFGMTTIKEIEACKRRLGQNGVLIKGA
IFNAVVRNAMTSDYDCAAYGYNYHPAPR
>gnl|bykdb|A0A3M3NNF2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas savastanoi pv. savastanoi] (length=650 residues).
MVSVAELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLL
GEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVEGNGVKIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDS
GIIYLSIEDQDAQRANRILDGVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLSIETK
GVLDQVVSLDSMLSELKLRRVELERLYTREHPTYRSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYT
LMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPVKPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGMPV
YASLPHSRQQERLEKRDQDSKDSRLLSIAAPGELAIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATII
AQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDTLAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNRMLAE
LSPLYDLILIDTPPILAVTDATLVGRQAGTCLLVARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAA
YGYNYHPAPR
>gnl|bykdb|A0A3M3P9B7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae] (length=773 residues).
MAGPARHHRPLPAARVSLRTDLRAALALHRRLAPSFSVRSNRINDRHEPSFPEFPSGLPDRSGNSPADAVRSQDPDPVDR
RRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHAGSQCQATLGVAELIKSRALLGKVVDDLQLNRLQTPDLFPVIGP
YLYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGERLTLTAGKPGQFSLYDSEHNLLLGGAINRVVEGHG
IKIQVATLQARPGTDFTVSRQRTLSTALIYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERSSAE
AAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLKRVELERLYTREHPTYRSL
MSQMSQLEQQRQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGNIGNVRVIDNADTNVERPVKPM
KTLIVLIATLLGALVAMTMVFVRQAFYRGVESAEIIENLGMPVYASLPYSRQQEHLDKRDHAGKESKLLSIAAPAELAIE
SLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGKRVLLIDADMRKGYLHRLFGLQPKHGLSDTLAA
RLRCTEVINTTRVRHLDFISCGFAAPNPSELLMHDNFHKMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLVARF
GMTTVQEIEASKRRLGQNGILIKGAIFNAVVRKATTSDYDCAAYGYNYHPAPR
>gnl|bykdb|A0A3M3RP89 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas coronafaciens pv. coronafaciens] (length=828 residues).
MCAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWPVARPARSRCSRPLSATPFSLRTDLCAALAV
HRRLASSFSVRRDTINDRHEPCSFGSLPGFTGRSGNRSADVVRSQSLDSLDRRAVLPDRAGLRDSGDALLPGQCHDPDRA
QKNWHRGHARGQRQADVSVPELIKSRALLGKVVDDLKLNVLQTPDFFPVIGPYLHRTFTPGSQRTLAEPLFGLNRYAWGG
EKIDVFQLDVPESLLGENLTLTAGQPGQFSLYDDEHSLLLRGATNRVVEGSGVTIQVAALQARPGTDFTVSRQRTFSTAL
SYQNRLKITEAGRDSGIIYLSIEDPDAQKANRILEEVSHLYVRQNVERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNN
FQTSAKSVDLSIETKGVLDQVVSLDATLSELKLKRVELERLYTREHPTYRGLMSQINQLEQQRQALLKKIEALPMTQQEL
LRLTRDMQVTSQTYTLMLNKSQEQDILRAGSIGNVRIIDNADSNIERPVRPMKKLIVLIASLFGVLVAVTIIFIRQAFYR
GVESAEVIESLGMPVYASLAFSRHQDRLEKPGKNSRATLEPKLLSIAAPDELAVESLRSLRTSLHFAMLEARNNVLMISS
PTPGAGKSFVSANLAAIIAQTGKRVLLIDADMRKGYLHRIFGLQPRHGLSDTLAARLPCSEVINPTRIHHLDLISCGFAA
PNPSELLMHDNFHKMLAELSPRYDLILIDTPPILAVTDATLVGRQAGTCLLVARFGMTTIKEIEACKRRLGQNGVLIKGA
IFNAVVRNAMTSDYDCAAYGYNYHPAPR
>gnl|bykdb|A0A3M3TPR7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas savastanoi pv. phaseolicola] (length=696 residues).
MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVAELIKSRALLGKVVDDLKLNTLQTPDFFPV
IGPYLYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLIAGKPGQFSLYDNEHNLLLGGTINRIVE
GNGVKIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTY
RSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPV
KPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGMPVYASLPHSRQQERLEKRDQDSKDSRLLSIAAPGEL
AIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDT
LAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNKMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNYHPAPR
>gnl|bykdb|A0A3M3TQV3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas amygdali pv. morsprunorum] (length=696 residues).
MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVAELIKSRALLGKVVDDLKLNTLQTPDFFPV
IGPYLYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVE
GNGVKIQVAALRAHPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEEAETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTY
RSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPV
KPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGIPVYASLPHSRQQERLEKRNQDSKDSRLLSIAAPGEL
AIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDT
LAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNRMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKTTTSDYDYAAYGYNYHPAPR
>gnl|bykdb|A0A3M3U4Q3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas savastanoi pv. glycinea] (length=696 residues).
MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVAELIKSRALLGKVVDDLKLNTLQTPDFFPV
IGPYLYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLIAGKPGQLSLYDNEHNLLLGGTINRIVE
GNGVKIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTY
RSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPV
KPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGMPVYASLPHSRQQERLEKRDQDSKDSRLLSIAAPGEL
AIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDT
LAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNKMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNYHPAPR
>gnl|bykdb|A0A3M3UCT3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. pisi] (length=773 residues).
MAGPARHHRPLPAARVSLRTDLRAALALHRRLAPSFSVRSNRINDRHEPSFPEFPSGLPDRSGNSPADAVRSQDPDPVDR
RRVFPDRPGLCHSGHTGVPGYRHDSDRASENRHRGHAGSQCQATLGVAELIKSRALLGKVVDDLQLNRLQTPDLFPVIGP
YLYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDSEHNLLLGGALNRVVEGHG
IKIQVATLQARPGTDFTVSRQRTLSTALIYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERSSAE
AAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLKRVELERLYTREHPTYRSL
MSQMNQLEQQRQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGNIGNVRVIDNADTNVERPVKPM
KTLIVLIATLLGALVAMTMVFVRQAFYRGVESAEIIENLGMPVYASLPYSRQQEHLDKRDHAGQESKLLSIAAPAELAIE
SLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGKRVLLIDADMRKGYLHRLFGLQPKHGLSDTLAA
RLRCTEVINTTRVRHLDFISCGFAAPNPSELLMHDNFHKMLAELSPLYDLILIDTPPILAVTDATLVGLQAGTCLLVARF
GMTTVQEIEASKRRLGQNGILIKGAIFNAVVRKATTSDYDCAAYGYNYHPAPR
>gnl|bykdb|A0A3M4A0E8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. persicae] (length=696 residues).
MDRQPVFSDRPGLRHSGHAGVSGHRHDSDRAPKNRHRGHPGGQRQAIVSVTELIKSRALLGKVVDDLKLSTLQTPDFFPV
IGPYLYRTFKPVRDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVE
GNGVKIQVAALRAHPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTY
RSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTNVERPV
KPMKTLIVLIATLIGALVAMIIVFVRQAFYRGIESAEVIESLGMPVYASLPHSRQQERLEKRDQDSKDSRLLSIAAPGEL
AIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDT
LAARLRCTEVIHQTRVRHLDFISCGFAAPNPSELLMHDNFNRMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTVQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNYHPAPR
>gnl|bykdb|A0A3M4A376 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas amygdali pv. morsprunorum] (length=696 residues).
MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVAELIKSRALLGKVVDDLKLNTLQTPDFFPV
IGPYLYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVE
GNGVKIQVAALRAHPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEEAETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTY
RSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPV
KPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGIPVYASLPHSRQQERLEKRDQDSKDSRLLSIAAPGEL
AIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDT
LAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNRMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKTTTSDYDYAAYGYNYHPAPR
>gnl|bykdb|A0A3M4C263 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas coronafaciens pv. atropurpurea] (length=647 residues).
MIKSRALLGKVVDDLKLNVLQTPDFFPVIGPYLHRTFTPGSQRTLAEPLFGLNRYAWGGEKIDVFQLDVPESLLGENLTL
TAGQPGQFSLYDDEHRLLLRGATNRVVEGSGVTIQVAALQARPGTDFTVSRQRTFSTALSYQNRLKITEAGRDSGIIYLS
IEDPDAQKANRILEEVSHLYVRQNVERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNFQTSAKSVDLSIETKGVLDQV
VSLDATLSELKLKRVELERLYTREHPTYRSLMSQINQLEQQRQALLKKIEALPMTQQELLRLTRDMQVTSQTYTLMLNKS
QEQDILRAGSIGNVRIIDNADSNIERPVRPMKKLIVLIASLFGVLVAVTIIFIRQAFYRGVESAEVIESLGMPVYASLAF
SRHQDRLEKPGKNSRATLEPKLLSIAAPDELAVESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSANLAAIIAQT
GKRVLLIDADMRKGYLHRIFGLQPRHGLSDTLAARLPCSEVINPTRIHHLDLISCGFAAPNPSELLMHDNFHKMLAELSP
RYDLILIDTPPILAVTDATLVGRQAGTCLLVARFGMTTIKEIEACKRRLGQNGVLIKGAIFNAVVRNAMTSDYDCAAYGY
NYHPAPR
>gnl|bykdb|A0A3M4ENY1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. atrofaciens] (length=644 residues).
MIKSRALLGKVVDDLQLNRLQTPDLFPVIGPYLYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
TAGKPGQFSLYDSEHNLLLGGALNRVVEGHGIKIQVATLQARPGTDFTVSRQRTLSTALIYQNRLKIAEAGRDSGIIYLS
IEDQDAQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLSIETKGVLDQV
VSLDSMLSELKLKRVELERLYTREHPTYRSLMSQMSQLEQQRQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKS
QEQDILRAGNIGNVRVIDNADTNVERPVKPMKTLIVLIATLLGAMVAMTMVFVRQAFYRGVESAEIIENLGMPVYASLPY
SRQQEHLDKRDHAGQESKLLSIAAPAELAIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGKR
VLLIDADMRKGYLHRLFGLQPKHGLSDTLAARLRCTEVINTTRVRHLDFISCGFAAPNPSELLMHDNFHKMLAELSPLYD
LILIDTPPILAVTDATLVGRQAGTCLLVARFGMTTVQEIEASKRRLGQNGILIKGAIFNAVVRKATTSDYDCAAYGYNYH
PAPR
>gnl|bykdb|A0A3M4GLF4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. actinidiae] (length=696 residues).
MDRQPVFSDRPGLRHSGHAGVSGHRHDSDRAPKNRHRGHPGGQRQAIVSVTELIKSRALLGKVVDDLKLSTLQTPDFFPV
IGPYLYRTFKPVRDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGILNRVVE
GNGVKIQVATLRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTY
RSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTNVERPV
KPMKTLIVLIATLIGALVAMIIVFVRQAFYRGIESAEVIESLGMPVYASLPHSRQQERLEKRDQDSKDSRLLSIAAPGEL
AIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDT
LAARLRCTEVIHQTRVRHLDFISCGFAAPNPSELLMHDNFNRMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTVQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNYHPAPR
>gnl|bykdb|A0A3M4PBZ2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas viridiflava] (length=696 residues).
MDRQPVFSDRPGLRHSGHAGVSGHRHDSDRAPKNRHRGHPGGQRQAIVSVTELIKSRALLGKVVDDLKLSTLQTPDFFPV
IGPYLYRTFKPVRDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVE
GNGVKIQVAALRAHPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTY
RSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTNVERPV
KPMKTLIVLIATLIGALVAMIIVFVRQAFYRGIESAEVIESLGMPVYASLPHSRQQERLEKRDQDSKDSRLLSIAAPGEL
AIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDT
LAARLRCTEVIHQTRVRHLDFISCGFAAPNPSELLMHDNFNRMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTVQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNYHPAPR
>gnl|bykdb|A0A3M4WA51 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. actinidiae] (length=696 residues).
MDRQPVFSDRPGLRHSGHAGVSGHRHDSDRAPKNRHRGHPGGQRQAIVSVTELIKSRALLGKVVDDLKLSTLQTPDFFPV
IGPYLYRTFKPVRDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVE
GNGVKIQVAALRAHPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEEAETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTY
RSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGSIGNVRVIDDADTNVERPV
KPMKTLIVLIATLIGALVAMIIVFVRQAFYRGIESAEVIESLGMPVYASLPHSRQQERLEKRDQDSKDSRLLSIAAPGEL
AIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDT
LAARLRCTEVIHQTRVRHLDFISCGFAAPNPSELLMHDNFNRMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTVQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNYHPASR
>gnl|bykdb|A0A3M4YBJ4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas coronafaciens pv. striafaciens] (length=696 residues).
MDRRRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHAGSQCQATLGVAELIKSRALLGKVVDDLQLNRLQTPDLFPV
IGPYLYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTSGKPGQFSLYDSEHNLLLGGALNRVVE
GHGIKIQVATLQARPGTDFTVSRQRTLSTALIYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLKRVELERLYTREHPTY
RSLMSQMSQLEQQRQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGNIGNVRVIDNADTNVERPV
KPMKTLIVLIATLLGALVAMTMVFVRQAFYRGVESAEIIENLGMPVYASLPYSRQQEHLDKRDHAGKESKLLSIAAPAEL
AIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGKRVLLIDADMRKGYLHRLFGLQPKHGLSDT
LAARLRCTEVINTTRVRHLDFISCGFAAPNPSELLMHDNFHKMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTVQEIEASKRRLGQNGILIKGAIFNAVVRKATTSDYDCAAYGYNYHPAPR
>gnl|bykdb|A0A3M4ZQ14 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas coronafaciens pv. garcae] (length=841 residues).
MCAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWPVARPARSRCSRPLSATPFSLRTDLCAALAV
HRRLASSFSVRRDTINDRHEPCSFGSLPGFTGRSGNRSADVVRSQSLDSLDRRAVLPDRAGLRDSGDALLPGQCHDPDRA
QKNWHRGHARGQRQADVSVPELIKSRALLGKVVDDLKLNVLQTPDFFPVIGPYLHRTFTPGSQRTLAEPLFGLNRYAWGG
EKIDVFQLDVPESLLGENLTLTAGQPGQFSLYDDEHRLLLRGATNRVVEGSGVTIQVAALQARPGTDFTVSRQRTFSTAL
SYQNRLKITEAGRDSGIIYLSIEDPDAQKANRILEEVSHLYVRQNVERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNN
FQTSAKSVDLSIETKGVLDQVVSLDATLSELKLKRVELERLYTREHPTYRGLMSQINQLEQQRQALLKKIEALPMTQQEL
LRLTRDMQVTSQTYTLMLNKSQEQDILRAGSIGNVRIIDNADSNIERPVRPMKKLIVLIASLFGVLVAVTIIFIRQAFYR
GVESAEVIESLGMPVYASLAFSRHQDRLEKPGKNSRATLEPKLLSIAAPDELAVESLRSLRTSLHFAMLEARNNVLMISS
PTPGAGKSFVSANLAAIIAQTGKRVLLIDADMRKGYLHRIFGLQPRHGLSDTLAARLPCSEVINPTRIHHLDLISCGFAA
PNPSELLMHDNFHKMLAELSPRYDLILIDTPPILAVTDATLVGRQAGTCLLVARFGMTTIKEIEACKRRLGQNGVLIKGA
IFNAVVRNAMTSDYDCAAYGYNYHPAPPLARNAPRHPSRFI
>gnl|bykdb|A0A3M5AD05 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas coronafaciens pv. coronafaciens] (length=647 residues).
MIKSRALLGKVVDDLKLNVLQTPDFFPVIGPYLHRTFTPGSQRTLAEPLFGLNRYAWGGEKIDVFQLDVPESLLGENLTL
TAGQPGQFSLYDDEHRLLLRGATNRVVEGSGVTIQVAALQARPGTDFTVSRQRTFSTALSYQNRLKITEAGRDSGIIYLS
IEDPDAQKANRILEEVSHLYVRQNVERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNNFQTSAKSVDLSIETKGVLDQV
VSLDATLSELKLKRVELERLYTREHPTYRSLMSQINQLEQQRQALLKKIEALPMTQQELLRLTRDMQVTSQTYTLMLNKS
QEQDILRAGSIGNVRIIDNADSNIERPVRPMKKLIVLIASLFGVLVAVTIIFIRQAFYRGVESAEVIESLGMPVYASLAF
SRHQDRLEKPGKNSRATLEPKLLSIAAPDELAVESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSANLAAIIAQT
GKRVLLIDADMRKGYLHRIFGLQPRHGLSDTLAARLPCSEVINPTRIHHLDLISCGFAAPNPSELLMHDNFHKMLAELSP
RYDLILIDTPPILAVTDATLVGRQAGTCLLVARFGMTTIKEIEACKRRLGQNGVLIKGAIFNAVVRNAMTSDYDCAAYGY
NYHPAPR
>gnl|bykdb|A0A3M5B9D9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. aceris] (length=696 residues).
MDCRPVFSARPGLRHSGHAGVSGHRHDSDRTPKNRHRGYAGSQCQATLGVAELIKSRALLGKVVDDLKLNRLQTPDLFPV
IGPYLYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDSEHNLLLGGAINRVVE
GQGIKIQVATLQARPGTDFTVSRQRTLSTALIYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLKRVELERLYTREHPTY
RSLMSQMNQLEQQRQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGNIGNVRVIDNADTNVERPV
KPMKTLIVLIATLLGALVAMTMVFVRQAFYRGIESAEIIENLGVPVYASLPHSRQQEHLDKRDHAGQESKLLSIAAPAEL
AIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGKRVLLIDADMRKGYLHRLFGLQPKHGLSDT
LAARLRCNEVINSTRVRHLDFISCGFAAPNPSELLMHDNFHKMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTVQEIEASKRRLGQNGILIKGAIFNAVVRKATTSDYDCAAYGYNYHPAPR
>gnl|bykdb|A0A3M5DM48 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas amygdali pv. photiniae] (length=650 residues).
MVSVAELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLL
GEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVEGNGIKIQVATLRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDS
GIIYLSIEDQDAQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLSIETK
GVLDQVVSLDSMLSELKLRRVELERLYTREHPTYRSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYT
LMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPVKPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGMPV
YASLPHSRQQERLEKRDQDSKDSRLLSIAAPGELAIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATII
AQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDTLAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNRMLAE
LSPLYDLILIDTPPILAVTDATLVGRQAGTCLLVARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAA
YGYNYHPAPR
>gnl|bykdb|A0A3M5EZK7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. aceris] (length=645 residues).
MIKSRALLGKVVDDLKLNRLQTPDLFPVIGPYLYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTL
TAGKPGQFSLYDSEHNLLLGGAINRVVEGQGIKIQVATLQARPGTDFTVSRQRTLSTALIYQNRLKIAEAGRDSGIIYLS
IEDQDAQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLSIETKGVLDQV
VSLDSMLSELKLKRVELERLYTREHPTYRSLMSQMNQLEQQRQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKS
QEQDILRAGNIGNVRVIDNADTNVERPVKPMKTLIVLIATLLGALVAMTMVFVRQAFYRGIESAEIIENLGVPVYASLPH
SRQQEHLDKRDHAGQESKLLSIAAPAELAIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGKR
VLLIDADMRKGYLHRLFGLQPKHGLSDTLAARLRCNEVINSTRVRHLDFISCGFAAPNPSELLMHDNFHKMLAELSPLYD
LILIDTPPILAVTDATLVGRQAGTCLLVARFGMTTVQEIEASKRRLGQNGILIKGAIFNAVVRKATTSDYDCAAYGYNYH
PAXPR
>gnl|bykdb|A0A3M5F5X1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas savastanoi] (length=703 residues).
MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHSRGQRQAIVSVAXXXXXXXELIKSRALLGKVVDDLKLNTLQ
TPDLFPVIGPYLYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGG
TINRIVEGNGVKIQVAALRAHPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYV
RQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLY
TREHPTYRSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGSIGNVRVIDNAD
TNVEKPVKPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGMPVYASLPHSRQQERLEKRDQDSKDSRLLS
IAAPGELAIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQP
KHGLSDTLAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNKMLAELSPLYDLILIDTPPILAVTDATLVGRQ
AGTCLLVARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNYHPAPR
>gnl|bykdb|A0A3M5G7H9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas savastanoi] (length=696 residues).
MDRQPVFSDLSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVAELIKSRALLGKVVDDLKLNTLQTPDFFPV
IGPYLYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVE
GNGVKIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTY
RSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPV
KPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGMPVYASLPHSRQQERLEKRDQDSKDSRLLSIAAPGEL
AIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDT
LAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNRMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTALEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNYHPAPR
>gnl|bykdb|A0A3M5GJ64 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas savastanoi] (length=696 residues).
MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVAELIKSRALLGKVVDDLKLNTLQTPDFFPV
IGPYLYRTFKPVRDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVE
GNGIKIQVATLRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTY
RSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPV
KPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGMPVYASLPHSRQQERLEKRDQDSKDSRLLSIAAPGEL
AIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDT
LAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNKMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNYHPAPR
>gnl|bykdb|A0A3M5J1E2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas amygdali pv. lachrymans] (length=696 residues).
MDRQPVFSDRSGLCHSGHAGVSGHRHDSDRAPKNRHRGHPGGQRQAIVSVAELIKSRALLGKVVDDLKLNTLQTPDFFPV
IGPYLYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVE
GNGVKIQVAALRAHPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQNAQRANRILDEVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEEAETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTY
RSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPV
KPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGMPVYASLPHSRQQERLEKRDQDSKDSRLLSIAAPGEL
AIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDT
LAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNKMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNYHPAPR
>gnl|bykdb|A0A3M5JFB0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas amygdali pv. mori] (length=696 residues).
MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVAELIKSRALLGKVVDDLKLNTLQTPDFFPV
IGPYLYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLIAGKPGQFSLYDNEHNLLLGGTINRIVE
GNGVKIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANQILDEVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTY
RSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPV
KPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGMPVYASLPHSRQQERLEKRDQDSKDSRLLSIAAPGEL
AIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDT
LAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNKMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNYHPAPR
>gnl|bykdb|A0A3M5K254 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas savastanoi] (length=696 residues).
MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVAELIKSRALLGKVVDDLKLNTLQTPDFFPV
IGPYLYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLIAGKPGQFSLYDNEHNLLLGGTINRIVE
GNGVKIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANQILDEVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTY
RSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPV
KPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGMPVYASLPHSRQQERLEKRDQDSKDSRLLSIAAPGEL
AIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGRRILLIDADMRKGYLHRLFGLPPKHGLSDT
LAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNKMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNYHPAPR
>gnl|bykdb|A0A3M5KZ75 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. solidagae] (length=663 residues).
MPSHSRCRRRPXXXTTEIELIKSRALLGKVVDDLQLNRLQTPDLFPVIGPYLYRTFKPAREGELAQPLFGLTQYAWGGEK
IEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDSEHTLLLGGAINRVVEGHGIKIQVATLQARPGTDFTVSRQRTLSTALIY
QNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQ
TSARSVDLSIETKGVLDQVVSLDSMLSELKLKRVELERLYTREHPTYRSLMSQINQLEQQRQGLLKKIDALPMTQQELLR
LTRDMQVISQTYTLMLNKSQEQDILRAGNIGNVRVIDNADTNVERPVKPMKTLIVLIATLLGALVAMTMVFVRQAFYRGV
ESAEIIENLGMPVYASLPHSRQQEHLDKRDHAGKESKLLSIAAPAELAIESLRSLRTSLHFAMLEARNNVLMISSPTPGA
GKSFVSSNLATIIAQTGKRVLLIDADMRKGYLHRLFGLQPKHGLSDTLAARLRCTEVINTTRVRHLDFISCGFAAPNPSE
LLMHDNFHKMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLVARFGMTTVQEIEASKRRLGQNGILIKGAIFNAV
VRKATTSDYDCAAYGYNYHPAPR
>gnl|bykdb|A0A3M5L3G5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. solidagae] (length=645 residues).
ELIKSRALLGKVVDDLQLNRLQTPDLFPVIGPYLYRTFKPAREGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLT
LTAGKPGQFSLYDSEHTLLLGGAINRVVEGHGIKIQVATLQARPGTDFTVSRQRTLSTALIYQNRLKIAEAGRDSGIIYL
SIEDQDAQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLSIETKGVLDQ
VVSLDSMLSELKLKRVELERLYTREHPTYRSLMSQINQLEQQRQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNK
SQEQDILRAGNIGNVRVIDNADTNVERPVKPMKTLIVLIATLLGALVAMTMVFVRQAFYRGVESAEIIENLGMPVYASLP
HSRQQEHLDKRDHAGKESKLLSIAAPAELAIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGK
RVLLIDADMRKGYLHRLFGLQPKHGLSDTLAARLRCTEVINTTRVRHLDFISCGFAAPNPSELLMHDNFHKMLAELSPLY
DLILIDTPPILAVTDATLVGRQAGTCLLVARFGMTTVQEIEASKRRLGQNGILIKGAIFNAVVRKATTSDYDCAAYGYNY
HPAPR
>gnl|bykdb|A0A3M5M873 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas savastanoi] (length=696 residues).
MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHSRGQRQAIVSVAELIKSRALLGKVVDDLKLNTLQTPDLFPV
IGPYLYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVE
GNGVKIQVAALRAHPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTY
RSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPV
KPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGMPVYASLPHSRQQERLEKRDQDSKDSRLLSIAAPGEL
AIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDT
LAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNKMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNYHPAPR
>gnl|bykdb|A0A3M5R8G1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas savastanoi pv. glycinea] (length=651 residues).
AIVSVAELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHL
LGEKLTLIAGKPGQLSLYDNEHNLLLGGTINRIVEGNGVKIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRD
SGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLSIET
KGVLDQVVSLDSMLSELKLRRVELERLYTREHPTYRSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTY
TLMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPVKPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGMP
VYASLPHSRQQERLEKRDQDSKDSRLLSIAAPGELAIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATI
IAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDTLAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNKMLA
ELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLVARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYA
AYGYNYHPAPR
>gnl|bykdb|A0A3M5UI30 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas savastanoi pv. nerii] (length=693 residues).
MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVAELIKSRALLGKVVDDLKLNTLQTPDFFPV
IGPYLYRTFKPVRDGELAKPLFGLTQYAWGGENIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVE
GNGVKIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDGVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTY
RSLMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPVKPM
KTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGMPVYASLPHSRQQERLEKRDQDSKDSRLLSIAAPGELAIE
SLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDTLAA
RLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNRMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLVARF
GMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNYHPAPR
>gnl|bykdb|A0A3M5V012 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas savastanoi pv. glycinea] (length=651 residues).
AIVNVAELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHL
LGEKLTLIAGKPGQLSLYDNEHNLLLGGTINRIVEGNGVKIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRD
SGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLSIET
KGVLDQVVSLDSMLSELKLRRVELERLYTREHPTYRSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTY
TLMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPVKPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGMP
VYASLPHSRQQERLEKRDQDSKDSRLLSIAAPGELAIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATI
IAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDTLAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNKMLA
ELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLVARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYA
AYGYNYHPAPR
>gnl|bykdb|A0A3M5VR55 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. syringae] (length=773 residues).
MAGPARHHRPLPAARVSLRTDLRAALALHRRLAPSFSVRSNRINDRHEPSFPEFPSGLPDRSGNSPADAVRSQDPDPVDR
RRVFPDRPGLCHSGHTGVSGHRHDSDRASENRHRGHARSQCQATLGVAELIKSRALLGKVVDDLQLNRLQTPDLFPVIGP
YLYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGERLTLTAGKPGQFSLYDSEHNLLLGGAINRVVEGHG
IKIQVATLQARPGTDFTVSRQRTLSTALIYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERSSAE
AAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLKRVELERLYTREHPTYRSL
MSQMNQLEQQRLGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGNIGNVRVIDNADTNVERPVKPM
KTLIVLIATLLGALVAMTMVFVRQAFYRGVESAEIIENLGMPVYASLPYSRQQEHLDKRDHAGQESKLLSIAAPAELAIE
SLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGKRVLLIDADMRKGYLHRLLGLQPKHGLSDTLAA
RLRCTEVINTTRVRHLDFISCGFAAPNPSELLMHDNFHKMLTELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLVARF
GMTTVQEIEASKRRLGQNGILIKGAIFNAVVRKATTSDYDCAAYGYNYHPAPR
>gnl|bykdb|A0A3M5XGQ7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas savastanoi pv. phaseolicola] (length=773 residues).
MAGPARHHRPLPAARVSLRTDLRAALALHRRLAPSFSVRSNRINDRHEPSFPEFPSGLPDRSGNSPADAVRSQDPDPVDR
RRVFPDRPGLCHSGHTGVPGYRHDSDRASENRHRGHAGSQCQATLGVAELIKSRALLGKVVDDLQLNRLQTPDLFPVIGP
YLYRTFKPARDGELAQPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDSEHNLLLGGALNRVVEGHG
IKIQVATLQARPGTDFTVSRQRTLSTALIYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERSSAE
AAQRLQFLRSQLPAVRKQLEESETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLKRVELERLYTREHPTYRSL
MSQMNQLEQQRQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGNIGNVRVIDNADTNVERPVKPM
KTLIVLIATLLGALVAMTMVFVRQAFYRGVESAEIIENLGMPVYASLPYSRQQEHLDKRDHAGQESKLLSIAAPAELAIE
SLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGKRVLLIDADMRKGYLHRLFGLQPKHGLSDTLAA
RLRCTEVINTTRVRHLDFISCGFAAPTPSELLMHDNFHKMLAELSPLYDLILIDTPPILAVTDATLVGLQAGTCLLVARF
GMTTVQEIEASKRRLGQNGILIKGAIFNAVVRKATTSDYDCAAYGYNYHPAPR
>gnl|bykdb|A0A3M5YLE8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas coronafaciens pv. coronafaciens] (length=841 residues).
MCAAAAPCRTPGQPRAAAPGRADPGDGTAAHARPAQVRARSTWQNFLDWPVARPARSRCSRPLSATPFSLRTDLCAALAV
HRRLASSFSVRRDTINDRHEPCSFGSLPGFTGRSGNRSADVVRSQSLDSLDRRAVLPDRAGLRDSGDALLPGQCHDPDRA
QKNWHRGHARGQRQADVSVPELIKSRALLGKVVDDLKLNVLQTPDFFPVIGPYLHRTFTPGSQRTLAEPLFGLNRYAWGG
EKIDVFQLDVPESLLGENLTLTAGQPGQFSLYDDEHRLLLRGATNRVVEGSGVTIQVAALQARPGTDFTVSRQRTFSTAL
SYQNRLKITEAGRDSGIIYLSIEDPDAQKANRILEEVSHLYVRQNVERSSAEAAQRLEFLRSQLPAVRKQLEESEVALNN
FQTSAKSVDLSIETKGVLDQVVSLDATLSELKLKRVELERLYTREHPTYRGLMSQINQLEQQRQALLKKIEALPMTQQEL
LRLTRDMQVTSQTYTLMLNKSQEQDILRAGSIGNVRIIDNADSNIERPVRPMKKLIVLIASLFGVLVAVTIIFIRQAFYR
GVESAEVIESLGMPVYASLAFSRHQDRLEKPGKNSRATLEPKLLSIAAPDELAVESLRSLRTSLHFAMLEARNNVLMISS
PTPGAGKSFVSANLAAIIAQTGKRVLLIDADMRKGYLHRIFGLQPRHGLSDTLAARLPCSEVINPTRIHHLDLISCGFAA
PNPSELLMHDNFHKMLAELSPRYDLILIDTPPILAVTDATLVGRQAGTCLLVARFGMTTIKEIEACKRRLGQNGVLIKGA
IFNAVVRNAMTSDYDCAAYGYNYHPAPPLARNAPRHPSRFI
>gnl|bykdb|A0A3M5YQT8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas amygdali pv. myricae] (length=699 residues).
MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVAELIKSRALLGKVVDDLKLNTLQTPDFFSV
IGPYLYRTFKPVREGELSKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVE
GNGVKIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANQILDEVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEEAETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTY
RSLMSQMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTNVE
KPVKPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGMPVYASLPHSRQQERLEKRDQDSKDSRLLSIAAP
GELAIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGL
SDTLAARLRCTEVIHQTRVRHLDFMSCGFAAPTPSELLMHDNFNKMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTC
LLVARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNYHPAPR
>gnl|bykdb|A0A3M6AI26 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas savastanoi] (length=696 residues).
MDRQPVFSDRSGLCHSGHSGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVAELIKSRALLGKVVDDLKLNTLQTPDFFPV
IGPYLYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLTAGKPGQFSLYDNEHNLLLGGTINRIVE
GNGVKIQVAALRARPGTDFSVSRQHTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTY
RSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRASSIGNVRVIDNADTNVEKPV
KPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGMPVYASLPHSRQQERLEKRDQDSKDSRLLSIAAPGEL
AIESLRSLRTSLHFAMLEARNNVLMISSPSPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDT
LAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNRMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNYHPAPR
>gnl|bykdb|A0A3M6C224 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas savastanoi pv. phaseolicola] (length=696 residues).
MDRQPVFSDRSGLCHSGHAGVSGHRHDPDRAPKNRHRGHPGGQRQAIVSVAELIKSRALLGKVVDDLKLNTLQTPDFFPV
IGPYLYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGEKLTLIAGKPGQFSLYDNEHKLLLGGTINRIVE
GNGVKIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERS
SAEAAQRLQFLRSQLPAVRKQLEDAETALNNFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTY
RSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPV
KPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGMPVYASLPHSRQQERLEKRDQDSKDSRLLSIAAPGEL
AIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDT
LAARLRCTEVIHQTRVRHLDFMSCGFAAPTPSELLMHDNFNKMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLV
ARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYGYNYHPAPR
>gnl|bykdb|A0A3M6CFI7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. helianthi] (length=746 residues).
MHRRLASSFSVRSNRINDRHEPSIPGFPTGLADRSGNSSADAVRPQDPDRVDRRPVFSGGSGLCHSRHAGVSGHRHDSDR
AQKNRHRRHSGGQRQTTLSVAELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPLRDGELAEPLFGLTHYAWG
GEKIDVFQLEVPEYLLGEKLTLTAGRPGQFSLYDNEHNLLLGGTTNRVVEGNGIRIQVATLLARPGTNFSLSRQRTLSTA
LVYQNRLKIAEAGRDSGIIYLSIEDQNAQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESEAALN
TFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTYRSLMSQMNQLEQQKQGLLKKIDALPMTQQE
LLRLTRDMQVISQTYTLMLNKSQEQDILRAGNIGNVRVIDNADTNVEKPVKPMKTLIVSLATLIGALVAMIIVFIRQAFY
RGIESAETIESLGMPVYASLPHSRQQERLEKRTPDSKESRLLSIAAPSELAIESLRSLRTSLHFAMLEARNNVLMISSPT
PSAGKSFVSSNLATIIAQTGKRVLLIDADMRKGYLHRVLGLQPKHGLSDTLAARLRCTDVINQTRVRHLDFISCGFAAPN
PSELLMHDNFHKMLAELSPLYDLILIDTPPVLAVTDATLVGRQAGTCLLVARFGMTTVQEIEACKRRLGQNGILIKGAIF
NAVVRKATTSDYDCAAYGYNYHPAPR
>gnl|bykdb|A0A3M6FIV7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas caricapapayae] (length=746 residues).
MHRRLASSFSVRSNRINDRHEPSIPGFPTGLADRSGNCSADAVRPQDPDRVDRRPVFSGGSGVCHSRHAGVSGHRHDSDR
AQKNRHRRHSGGQRQTTLGVAELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAEPLFGLTHYAWG
GEKIDVFQLEVPEHLLGEKLTLTAGRPGQFSLYDNEHNLLLGGTTNRVVEGNGIRIQVATLLARPGTNFSLSRQRTLSTA
LVYQNRLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESEAALN
TFQTSARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTYRSLMSQMNQLEQQKQGLLKKIDALPMTQQE
LLRLTRDMQVISQTYTLMLNKSQEQDILRAGNIGNVRVIDNADTNVEKPVKPMKTLIVSLATLIGALVAMIIVFIRQAFY
RGIESAETIESLGMPVYASLPHSRQQERLEKRTPDSKESRLLSIAAPSELAIESLRSLRTSLHFAMLEARNNVLMISSPT
PGAGKSFVSSNLATIVAQTGKRVLLIDADMRKGYLHRVLGLQPKHGLSDTLAARLRCTDVINQTRVRHLDFISCGFAAPH
PSELLMHDNFHKMLAELSPLYDLILIDTPPVLAVTDATLVGRQAGTCLLVARFGMTTVQEIEACKRRLGQNGILIKGAIF
NAVVRKATTSDYDCAAYGYNYHPAPR
>gnl|bykdb|A0A3M6GHH2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas amygdali pv. tabaci] (length=418 residues).
MDLSIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTYRSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDM
QVISQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPVKPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEV
IESLGMPVYASLPHSRQQERLEKRDQDSKDSRLLSIAAPGELAIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFV
SSNLATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDTLAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHD
NFNKMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLVARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKAT
TSDYDYAAYGYNYHPAPR
>gnl|bykdb|A0A3M7LJH0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio anguillarum] (length=493 residues).
TGIVELSFTGENPSQIQAILDDISQNYFLQNVQRNSAEAEKSLAFLKGHLPTIKTELDSAEDVLNRYRQANDSIDLSLEA
KSTLEVMVKLEAQLNELTFKESEVSQRFTTDHPAYKSLLDKRQVLLGEKERLNQQVQKLPKTQREILRMTRDVQVNQQIY
IQLLNKVQELNIIKAGTVGNVRILDSAATYAKAVKPKKPLLVVLATLLGGMVSVGGVLVKAALHRGVENPDDIEQLGLSV
YASVPKSILQLEFAEKINKKRKSLQEMMLLAESNPADLSIEALRGLRTSLHFAMLEAKNNVVMISGPAPGIGKSFVSTNF
AAVVAKTGQKVLLIDADMRKGYLQQPFGVKWENGLSDLLSGKIDYAQAIKTTQVDNLDIMTRGQVPPNPSELLMHQRFKA
LVEWASQNYDLVIIDTPPVLAVTDPSIVGAHAGTTLMVARFGLNTAKEIDVARNRFEQAGIEVKGVIFNAVEKKASSSYG
YGYYNYAYSSDKK
>gnl|bykdb|A0A3M8EMP2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfuromonadales bacterium] (length=290 residues).
MSRIEEILEKATRLREKGPAPGTESSASAPLKVDLASRPLVSPDYGTYTVDNKIDVTNPYLVTVTQPQSQVTEEYKKLKS
IIIKMTKGEQFLNTFMVTSTLGGEGKSITSLNIAMALAQEYDHTVVLVDCDLRRPSIHAYLDIPVGPGLSDCLVKGVDVG
SALVKTGIGKLSVLPAGSRVQNPAELISSARMRDFITELKSRYSDRYVIIDTPPVLNFAEAHAIGSVVDGAIFVVREGYV
PVQHLKDAVEMLKGVNILGVVYNNVEMTRYNSYRYYGSYGYKGYTADGAA
>gnl|bykdb|A0A3N5FRH4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobacteraceae bacterium] (length=285 residues).
MGKMYEALQKAEKERIPEQKREPVKAVFDNSVLDDKLVTFFQSGSVVAEQFRKLRTYLFRADLEKKLKTILVTSSFSGDG
KSLIAINLAITIAVELHSHAMLVDCDLRNPTLSKWFGMTESKGLSDYLLGYDDLPGLLIKTQIDKLTLLSGGSTQGNPVE
LIASKRMETLVNELKSRYTDRYIILDSSPVLATTEPNVLDKMVDGIIFVIRAGETPRESVQQAIKMLGKEKIIGIVLNDI
NFKSPALHSRYFGTSRYYYNFGYTKENKPQNFLGKVSSFFKKPKR
>gnl|bykdb|A0A3N5J7U8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Xanthomonadales bacterium] (length=237 residues).
MSESRDPAGSGQMFDIESPLAIELRRIMIRLSRHLDFDRKRAVMVTSAQRGEGKSLFSLHFSLVLAYHLAKRILLIDADV
RRPVQHKVFEVELGPGFANVLAGELPVSKAVQRTRVKNLDFLPAGFAGTHASRLFGDGQVRRVVEELHGTYDMILLDSPP
VVPVSDPLHYLDAVDGCLYLVMAGQTPKDVSKRGVDLLRGAGANILGVVANNLGEVLPYYYDQKYYGYEGSKKVRKA
>gnl|bykdb|A0A3N5MZ53 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Betaproteobacteria bacterium] (length=313 residues).
LASAQARVIESAVPPQVPYKPKRARIVAISVLLALLFGVGAALLLASLDATIKNSSDVAEKLKRPLLGIVPLLKGNALSV
VSTPGNTDEAREVDLRFAEAMRTIRTAVSLDRVDKPHKIILVTSSIGNEGKSIVALNLAIAFARAEKTLLLDGDMRRPSV
RKMLGLRRDVPGLSELLSERARLIECIIKTGFENLDAISTGFIPPDPLELLSSPRMTKALKVLANDYARVIIDCPPILPV
SDAALLSKYADSVLFVVKADATPAPQIRNGLALLERVDAPITGIVLTQLDTRKAEKYGDYGYAGYYAPYASKS
>gnl|bykdb|A0A3N5P205 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Deltaproteobacteria bacterium] (length=269 residues).
MSRLEKALKRAKQDRDDKGASVVETRQRLTDLEYTQTRVEKTSDAVLKKSGVLTSFIPPSIIEQYNLLRVRVLEALSKNG
HNSILVASPGQGEGKTFTAVNLAVSIAREKTHTVLLVDTDLRRPAVHNYFGLSQEPGLYEHLTMGVPLSELLINPGTPRL
TLLPAGKAEQYPSDFLNAPAMHSFVREVKERYPDRYIIFDSPPLLGFSDALYLSRFADGIIIVVRSQETKEEDLKRSLEL
LHGRSIMGTVLNGVRSELAEWRGYEKYYQ
>gnl|bykdb|A0A3N5PM86 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Deltaproteobacteria bacterium] (length=405 residues).
MVRLSAAMKGINEKIAQEVKKILQSVETEYRVALAEEKSIREAMEEKKREALYLNEKQIGYNSLKRDTDTSRSLYESLLK
RVKEAGLTEGLEATNIVVVDPARVPDHPVKPRKARNFLLAIIVSLALGVGMAFFFEYLDNTINTPDELERYFKVPFLGVV
SKFKIDAPGEEIILNSNPKSNVAEGFRTIRTNLLFSSPDVEKKHILITSSLPMDGKTLQSANIAVSFAQMGKKVLLIDAD
MRKARIHEIFNLDRSPGLSEYLAGKESVPQMTEIPGLEVLTAGRTCPNPSELLGSKRMKELLEPERAGGDFDMVIIDSPP
VLSVADAAILSAVTDGVVLVVKAGSTPRPAIQRAIQQLSDVEARLIGCVLNAMDFEKESYYYSYYYRYKKYYDHYYGEEG
EGKKT
>gnl|bykdb|A0A3N5RNY4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobacteraceae bacterium] (length=271 residues).
MNSTEQVSVKRIKIDAAVVLPDRPRSKIPDHFALSIWQGTEAETLPAKVSHRIVGRTHPFSSVVEEYKKLRIKILSATQK
KFRNTIMVASAQSGEGKTVTAINLAISIAQSLDHTVLLVDADLRQPSIHTYLGINPHYGLSDYLTSRLNLSDILIKTWIK
NLVFLPAGTPQRNSSELLASRRMRDLVQEVKNRYRDRYVIFDSPPLLPIADGLSLSEYMDGVLFITLAEKTNPVFAKQAL
AHLKNRNILGVVYNGSRQSTSPYQYPSYYTI
>gnl|bykdb|A0A3N5YUD9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobacteraceae bacterium] (length=277 residues).
MSLKQALEKAKKMRSETPAHSGPPEVQTAVSDSPQRPAEWKSPAYLNSQRVELNPAVLTSNRCVCIAPTAKEIDQYKVLR
TKIQFAAKQKGWNTLMITSALEGEGKTLTAINLALTFAKAYNQTVLLVDGDLRRQTIHKMLGFPSRLGLVDYLQHEVPVK
DIVVWPGIEQMTVISGGRTVSNSSELLGSPRMRALVEEMKSRYPDRTLIFDSAPVLGGADAMALTPFVDGIVVVVEAGRT
GLRELRKAVAMLPADKIMGFVLNRQKNPSTTNYSYYG
>gnl|bykdb|A0A3N5Z7F8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Deltaproteobacteria bacterium] (length=322 residues).
NALVTKIKEQRITEKIQPVNVWVIDAAETPEYPAKPRKKLNILLGIFFGIFGGIGLAFFIEYLDNTIKSSEDVEENLHIP
VLGVIPFSKIKNQRIENVVVDEPASLITENYRALRTSVMLCSAEKPPQTILVTSMASGEGKTTTAANLAFTIAKTGKNVL
LVDGDLRRPRLHKVFNLENTSGLSTFLSGVSSGDILQKSSVGNLSIMTSGPIPPIPSELLNSVRMEKLVKTLSTKFDHII
FDSAPVLSVTDSQILTRFIDSIIVVARAGHTTYEAARKGLKILKEIEPHPIGMVINAVDTKRGWINHYYGYDGYCSRVAD
DS
>gnl|bykdb|A0A3N9VAW3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Geobacter sp] (length=302 residues).
MSRIEEALEKAAQLRNNKRGFDVPGKISAPAPSMVSPTTQYPPLTEAAVALASPMLVTATDPHSPSAEEYRKLKSVLVSM
TQQDTFRNTLMVASSVSGEGKSITALNLAISMAQEFDHTVLLVDADLRKPSLHTYFGLEPKLGLSDCLQGGADLGDALIK
TGIGKLTLLPSGKPVRNPAELFSSQRMKELIQDMKYRYPDRYIIIDTPPVLLFAETLSLSYLVDGVVFVVREGMASVQNI
SDALGNLKGSLVLGIVYNDVKEESLDSRYYYYNYGARAGTVPGGNGGAAARKGLFGRLFTRG
>gnl|bykdb|A0A3P5DSS6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=447 residues).
MRNDLDLAEDKLNEYRRKSDSVDLSLEAKSVLDQIVNVDNQLNELTFRESEISQLYTKEHPTYKALMEKRKTLQDEKAKL
NKRVSAMPETQQEILRLSRDVESGRAVYMQLLNRQQELNIAKSSAIGNVRIIDDAVVQPKPVKPKKIIIVLVGFALGFIL
SMSLVFIRVLLRRGIESPEQLEELGINVYASVPVAESVAQKARAYKIIGKRQQLNNEKSLLAIENPADLAIEAIRGLRTS
LHFAMLEARNNILMISGASPNAGKTFVSSNLAAVIAQSGKNVLFIDTDMRKGYVHKVFNTTNENGLSEYLAGKINISQAI
KKVNQAGFDYISRGMVPPNPAELLMHRRLEELLHWASKNYDIVILDTPPILAVTDAAVLGHYVGTTLLVARFEINTAKEI
EIAKKRFEQSGIVVKGCILNGVIKKASGYYGYGYNHYGYSYSEGEKR
>gnl|bykdb|A0A3P6L543 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas paucimobilis] (length=229 residues).
MPTLEISQAKLDFVKKAEEYYNSLCMNLQLSGDGLKVFSITSVKLGEGKSTTSTNIAWAFARAGYKTLLIDGDIRNSVML
GVFKARDKITGLTEFLSGTTDLSQGLCDTNIENLFVIQAGSVSPNPTALLQSKNFTTMLETLRKYFDYIIVDTAPVGVVI
DAAIITRKCDASILVTEAGEINRRDIQKAKEQLEHTGKPFLGVVLNKFDTSVNKYGSYGNYGDYGKNKK
>gnl|bykdb|A0A3R0G3L3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Salmonella enterica] (length=236 residues).
MAASKKAKKGGLALNNRRKLIAKYDPKSPISEQYRNIRTNIIYSSVDEEIRSILVTSSGPGEGKSTTTANLAVVFAQQGK
TVLLVDADLRKPTVHYTFNLNNTAGLTSILTNQMNLMEAVHQNDEQNLYILPSGPIPPNPSELLGSKAMSHFLEQALEEF
DIILFDTPPVMAVTDAQVLANLCDGSILVVGSGKADKEAVVKTKELLASSTGKILGVVLNNKKADKKGSYYYYGTN
>gnl|bykdb|A0A3R9TWL5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter baumannii] (length=228 residues).
IPILAVKNSADIAIESLRSIRTAIHFALANAKNNIIMIAGPSPEVGKSFISTNLATIFAQGDKRVLLIDADMRRGYMHKY
FDVDVKPGLSELLSGQADLQKVLHKTQVANLDVITRGKSPTNPSEILSSNQFKELLEQLQSQYDHIIIDTPPVLAVTDGI
IISQYTGVNLIVARYAKSQMKELELTLNRFEQADVKVNGFILNDIQRASAGYGYGYNYAYAYKAQKED
>gnl|bykdb|A0A3S1E286 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1] (length=222 residues).
AFDVVMEDRGSRVIGVISVLPGEGKSTVAANLAGLLAATGARTLLIDGDLRNPGLSRSLGMEAEQGLMEAVVNGQTWQSV
GKVDRQTKLAIIPAVLRGQFSHTSELLGSAGMRRFIENAKETFEYIIVDLPPLGPVVDAKAFAPLVDGFVLVTEWGRTPR
NMVRSMLESEPYIANKVIGAVLNKVDLKKLAKYGALGGSERFFDRYSTYYLEKSEQRPKQAA
>gnl|bykdb|A0A3S1FD32 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2] (length=392 residues).
AAQGKSSVDNQTQVKLRELDQQATALTTLYQTFLGRYEEAAQQQSFPVGKIRIISDASMPMAASSPRTIVVLGLSLVLGL
LMGAGFGGLNEFNERFFRTGEDVRDRVNLKFLGYLPTIGGKLGKEEKPGETQVDAKTTQSLSAAERRARMRVSIDSPASM
FSETLRSAKIAFDVVMEGQGSRVIGVISVLPGEGKSTVAANLAGLLAANGSKTLLIDGDLRNPGLSRGLGMETEQGLMEA
VVSGQTWQSVGKIDRQTKLAIIPAVLRGHFSHTSELLSSAGMRRFIENAKETFEYIVVDLPPLGPVVDAKAFAPLVDGFV
LVTEWGRTPRAMVRSMLESEPYVANKIIGAVLNKVDLKKLAKYGSFGGSEKFFDKYSSYYLEKSEVRGKAPV
>gnl|bykdb|A0A3S1IBR2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2] (length=562 residues).
RAAVWLQGRLTELRQSSQAASLAVEKFRAEHGLAANSDGQLMSDKQLSDLNAQLIVAQADTARASARYQQYKAIVDSGSE
NAFKDAAISSDQPSSSVISALKTRYLTVAKRLQDVEANFGPEHPQAVALSKEKADISTQIFGELKQLTESYRNEYEVAQA
RETALRANVAAAQGKSSVDNQTQVKLRELDQQATALTTLYQTFLGRYEEAAQQQSFPVGKIRIISDASMPMAASSPRTIV
VLGLSLVLGLLMGAGFGGLNEFNERFFRTGEDVRDRVNLKFLGYLPTIGGKLGKDEKPSETQVDAKTTQSLSAAERRARM
RVSIDSPASMFSETLRSAKIAFDVVMEGQGSRVIGVISVLPGEGKSTVAANLAGLLAANGSKTLLIDGDLRNPGLSRGLG
METEQGLMEAVVSGQTWQSVGKIDRQTKLAIIPAVLRGHFSHTSELLSSAGMRRFIENAKETFEYIVVDLPPLGPVVDAK
AFAPLVDGFVLVTEWGRTPRAMVRSMLESEPYVANKIVGAVLNKVDLKKLAKYGSFGGSEKFFDKYSSYYLEKSEVRGKA
PV
>gnl|bykdb|A0A3S1MCW7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1] (length=478 residues).
PVLESAGLQKLSDKLADLTSQYQQKLGILKPGFPEMQQLQSQIKELQRLYNNGVLTITDSLRQKYQEAQNKEADLKSKLA
EMEMQQDIFNDKNIKYTILKREVDSNRSQYDSLITKLNEVGVSSELKSQSAAIVDFAAQPGSPYSPRLTISLAIALFLFM
ALSASIIYIIELLNNTFTNPEQVEKELGLAMLGILPLVDDRELIASIADQKSGLSEAYRSLRTSLQFSGAEGAPRSLLVT
SSEPSEGKSTTSFKLGQDFAALGARVLIVDGDLRKPNLHRLFGLDNTIGLSNLLTNTVRKEDLASIFRATKYPNVTVLTS
GTIPPNPADLLSSPKMALIITNLGKRFDLVIIDAPPVVGLSDAPILSRLAEGTLMVISTNQVTRKSAKTALKRLRAAGAN
VVGAAMSKFAVNKFDYNYGYKYMNYQYYDYGTGTPKIEGKVDDGADQPAYAKSPAFRRLVRRIRSGVGGFVDRAKSIS
>gnl|bykdb|A0A3S1NQ09 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1] (length=651 residues).
YVRPSSSMPGGADFSKLDPAARDALIATSRRDYAILKLQNEIRAERVGRSYVIALGYQATDPALANAITKAYADAYLADQ
LDASFDATERAAVWLQGRLTELRQSSQAASLAVEKFRAEHGLAANSDGQLMSDKQLSDLNAQLIVAQADTARASARYQQY
KAIVDSGSENAFKDAAISSDQPSSSVISALKTRYLTVAKRLQDVEANFGPEHPQAVALSKEKADISTQIFGELKQLTESY
RNEYEVAQARETALRANVAAAQGKSSVDNQTQVKLRELDQQATALTTLYQTFLGRYEEAAQQQSFPVGKIRIISDASMPM
TASSPRTIVVLGLSLVLGLLMGAGFGGLNEFNERFFRTGEDVRDRVNLKFLGYLPTIGGKLGKEEKPGETQVDAKTTQSL
SSAEKRARMRVSIDSPASMFSETLRSAKIAFDVVMEGQGSRVIGIISVLPGEGKSTVAANLAGLLAANGSKTLLIDGDLR
NPGLSRGLGMETEQGLMEAVVGGQTWQSVGKIDRQTKLAIIPAVLRGHFSHTSELLSSAGMRRFIENAKETFEYIVVDLP
PLGPVVDAKAFAPLVDGFVLVTEWGRTPRAMVRSMLESEPYVANKIVGAVLNKVDLKKLAKYGSFGGSEKFFDKYSSYYL
EKSEVRGKAPV
>gnl|bykdb|A0A3S1NZ06 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1] (length=532 residues).
AEHGLSASSDGQLMSAKQLADLNAQLIVAQADTARASARYQQYKSIVDSGSENAFKDAAISSDQPSSSVIAALKTRYLTV
AKRQQDVEANFGPQHPQAVALAKEKADISAQIFGELKQLTESYRNEYEVALARETALRANVAAAQGKSSIDNQSQVQLRD
LDQKATALTTLYQTFLGRYEEAAQQQSFPVGKIRIISDASTPLAASSPRTIIVLGLSLVLGVLMGAGFGGLNEFNERFFR
TGEEVRDRVGLKFLGYLPTIGSKPTKEDKPAEPDLKVARSPAAIERRARMRVSIDAPASMFSETLRSAKIAFDVVMEGQG
SRVIGVISVLPGEGKSTVAANLAGLLAANGARTLLIDGDLRNPGLSRSLGMEAEQGLMEAVVSGQTWQSVGKIDRQTKLA
IIPAVSRGHFSHTSELLSSAGMRRFIENAKETFEYIVVDLPPLGPVVDAKAFAPLVDGFVLVTEWGRTPRAMVRSMLESE
PYVANKIVGAVLNKVDLKKLAKYGSFGASEKFFDKYSSYYLDKSEVRSKTAV
>gnl|bykdb|A0A3S1P7J5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2] (length=366 residues).
TTLYQTFLGRYEEAAQQQSFPVGKIRIISDASMPMTASSPRTIVVLGLSLVLGLLMGAGFGGLNEFNERFFRTGEDVRDR
VNLKFLGYLPTIGGKLGKEEKPGETQVDAKTTQSLSSAEKRARMRVSIDSPASMFSETLRSAKIAFDVVMEGQGSRVIGI
ISVLPGEGKSTVAANLAGLLAANGSKTLLIDGDLRNPGLSRGLGMETEQGLMEAVVGGQTWQSVGKIDRQTKLAIIPAVL
RGHFSHTSELLSSAGMRRFIENAKETFEYIVVDLPPLGPVVDAKAFAPLVDGFVLVTEWGRTPRAMVRSMLESEPYVANK
IVGAVLNKVDLKKLAKYGSFGGSEKFFDKYSSYYLEKSEVRGKAPV
>gnl|bykdb|A0A3S1PSR2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1] (length=205 residues).
SVLPGEGKSTVAANLAGLLAANGSKTLLIDGDLRNPGLSRGLGMETEQGLMEAVVSGQTWQSVGKIDRQTKLAIIPAVLR
GHFSHTSELLSSAGMRRFIENAKETFEYIVVDLPPLGPVVDAKAFAPLVDGFVLVTEWGRTPRAMVRSMLESEPYVANKI
VGAVLNKVDLKKLAKYGSFGGSEKFFDKYSSYYLEKSEVRGKAPV
>gnl|bykdb|A0A3S1THE9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1] (length=210 residues).
VIGVISVLHGEGKSTVAANLAGLLAANGSKTLLIDGDLRNPGLSRGLGMETEQGLMEAVVSGQTWQSVGKIDRQTKLAII
PAVLRGHFSHTSELLSSAGMRRFIENAKETFEYIVVDLPPLGPVVDAKAFAPLVDGFVLVTEWGRTPRAMVRSMLESEPY
VANKIVGAVLNKVDLKKLAKYGSFGGSEKFFDKYSSYYLEKSEVRGKAPV
>gnl|bykdb|A0A3S1WTQ1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1] (length=275 residues).
IGGKLGKEEKPGETQVDAKTTQSLSSAEKRARMRVSIDSPASMFSETLRSAKIAFDVVMEGQGSRVIGIISVLPGEGKST
VAANLAGLLAANGSKTLLIDGDLRNPGLSRGLGMETEQGLMEAVVGGQTWQSVGKIDRQTKLAIIPAVLRGHFSHTSELL
SSAGMRRFIENAKETFEYIVVDLPPLGPVVDAKAFAPLVDGFVLVTEWGRTPRAMVRSMLESEPYVANKIVGAVLNKVDL
KKLAKYGSFGGSEKFFDKYSSYYLEKSEVRGKAPV
>gnl|bykdb|A0A3S1X1N3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1] (length=313 residues).
LLMGAGFGGLNEFNERFFRTGEDVRDRVNLKFLGYLPTIGGKLGKEEKPGETQVDAKTTQSLSAAERRARMRVSIDSPAS
MFSETLRSAKIAFDVVMEGQGSRVIGVISVLPGEGKSTVAANLAGLLAANGSKTLLIDGDLRNPGLSRGLGMETEQGLME
AVVSGQTWQSVGKIDRQTKLAIIPAVLRGHFSHTSELLSSAGMRRFIENAKETFEYIVVDLPPLGPVVDAKAFAPLVDGF
VLVTEWGRTPRAMVRSMLESEPYVANKIVGAVLNKVDLKKLAKYGSFGGSEKFFDKYSSYYLEKSEVRGKAPV
>gnl|bykdb|A0A3S2AQS7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1] (length=409 residues).
NKETDLKSKLAEMERQQVVFNDKNIKYTILKREVDSNRSQYDSLIAKLNEVGVSSELKTQSAAIVDFASLPTAPYSPRLS
INLAVALALFMALAASIIYIIELLNNTFTNPEQIEKELGLTMLGILPLVGDRELIASIADQKSGLSEAYRSLRTSLQFSG
AEGAPRSLLVTSSEPSEGKSTTSFKLGQDFAALGARVLLVDGDLRKPNLHRLFGLDNAIGLSNLLTNTVRKDDLPGIFRP
TKYPNVTVLTSGTIPPNPADLLSSPKMALILTNLGKRFDLVIIDAPPVVGLSDAPILSRLAEGTLMVVSTNQVTRKSAKT
ALKRLRSAGANVIGAAMSKFTVNKFDYNYAYKYMNYQYYDYGASTPKIEGKVDDGAGQPAHAKSPAFRRLVRRLRSGVGG
FVGRAKSAS
>gnl|bykdb|A0A3S2C404 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1] (length=268 residues).
EEKSGETQVDAKTAQSLSAAEKRARMRVSIDSPASMFSETLRSAKIAFDVVLEGQGSRVIGIISVLPGEGKSTVAANLAG
LLAANGAKTLLIDGDLRNPGLSRGLGMEAEQGLMEAVVNGQTWQSVGKIDRQTKLAIIPAVLRGHFSHTSELLSSAGMRR
FIENAKETFEYIVVDLPPLGPVVDAKAFAPLVDGFVLVTEWGRTPRAMVRSMLESEPYVANKIVGAVLNKVDLKKLAKYG
SFGGSEKFFDKYSSYYLEKSEVRGKAPV
>gnl|bykdb|A0A3S2FP30 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1] (length=489 residues).
RIEKGRGSSLGPVLESEGLQKLSEKLADLTSQYQQKLGILKPGFPEMQQLQSQIKELQRIYNNGVLAITDSLRLKYQEAQ
NKEADLKSKLAEMERQQVVFNDKNIKYTILKREVDSNRSQYDSLIAKLNEVGVSSELKTQSAAIVDFASLPTAPYSPRLS
INLAVALALFMALAASIIYIIELLNNTFTNPEQIEKELGLAMLGILPLVGDRELIASIADQKSGLSEAYRSLRTSLQFSG
AEGAPRSLLVTSSEPSEGKSTTSFKLGQDFAALGARVLLVDGDLRKPNLHRLFGLDNAIGLSNLLTNTVRKDDLPGIFRP
TKYPNVTVLTSGTIPPNPADLLSSPKMALILTNLGKRFDLVIIDAPPVVGLSDAPILSRLAEGTLMVVSTNQVTRKSAKT
ALKRLRSAGANVIGAAMSKFTVNKFDYNYAYKYMNYQYYDYGASTPKIEGKVDDGAGEPAHAKSPAFRRLVRRLRSGVGG
FVDRAKSAS
>gnl|bykdb|A0A3S2K5U0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1] (length=285 residues).
LVLGFFVGGAGAVLRELFASGFMAKKQIEEELSVPVLASIPRMAGWSRDAHSQAQPVAYLERRPLSRFSEAVRRLRLGID
ATPEQARLPRLMLVTSAMPGEGKTTLVLSLACSAAADGERVLVVDADLRLSATTAFFGMVDKVGLVDLLTLPVKAANAIH
RDERSGISLLPAGARTRNPPALLASARMRSVFEELRGKFDTVIIDAPPVGAAADATILARYVDKVLFVVKWRETSREAVA
EGIRHLGGRSKIAGIALTMVDEPKLPKYGRYTSIESSVSDSYYLN
>gnl|bykdb|A0A3S3EAI9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium sp] (length=356 residues).
YEEASQQQSFPVGKIRVISDATLPQSAATPRTSIVLGLSLVLGVMMGAGVGGLNEFRERFFRTGEDVRDRVGLKFLGYLP
IIGSKVAKDDKRDDGQADIKTAQSPSAAERRARMRVSIDAPASMFSETLRSAKIAFDVVMEGQGSRVIGVISVLPGEGKS
TVAANLAGLLAANGSKTLLVDGDLRKPGLSRSLGMEAEQGLMQAVVSGQTWQSVGKIDRQTKLAIVPAVPRGHFSHTSEL
LSSAGMRRFIDNAKETFEYIIVDLPPLGPVVDAKAFAPLADGFVLVTEWGRTPRAMVQSILSSEPYIANKIVGVVLNKVD
LKKLAKYGSIGGSEKFFDRYSSYYLEKSEARTKANT
>gnl|bykdb|A0A3S3UPT3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1] (length=326 residues).
PRTMRVLALSLVLGLMLGAGFGGLNEFNERFFRTGEDIRDRAGLKFLGYLPTIGGGRAKDSKADDLPADGKVASLSSAER
RARMRVSIDAPASMFAETLRNAKIAFDVVMEDRGSRVIGVISVLPGEGKSTVAANLAGLLAANGAKTLLVDGDLRNPGLS
RSLGMEAEQGLMEAVVNGQTWQSVGKVDRQTKLAIIPAVLRGQFSHTSELLGSAGMRRFIENAKETFEYIIVDLPPLGPV
VDAKAFAPLVDGFVLVTEWGRTPRNMVRSMLESEPYIANKVIGAVLNKVDLKKLAKYGALGGSERFFDRYSSYYLEKSEA
RAKQAA
>gnl|bykdb|A0A3S4HTS8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Serratia odorifera] (length=288 residues).
MLIVTLLGGLFSTGFVLLKTMLHRGIESPEQLEQQGINVYASIPLSEWQQKSDRETMLSGRRSSQRNYTLLAVGNPADLA
IEAVRSLRTSLHFASLEAKNNVLMISGASPSIGKTFVSINLAAVIAQAGQRILVVDADMRKGYAHSLLNCELGTGLSDVL
SGQASAQQAIKKTAIENLSFLSRGKIPPNPSELLMHNRLTEFLEWAGKEYDIVLVDTPPILAVTDAAIVARNVGTTLLVA
RYGVNSLKEIEVSIRRFEQNGMEIKGIILNAVENKSGSAYGYYAYEYK
>gnl|bykdb|A0A3S4JGG5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Serratia plymuthica] (length=440 residues).
MPEVRSSLDSAEDKLNRFRQANDSVDLSLEAKSVLDTIVGVEAQLNELTFKEAEISKLYTKEHPAYRALMEKRATLQQEK
DKLNKRVSGMPKTQQEILRLTRDVQAGQEIYMQLLNKQQELGITKASTVGNVRIVDPAVTQPRPVKPQKTIIVLIVTLLG
GLFSTGFVLLKTMLHRGIESPEQLEQQGINVYASIPLSEWQQKSDRETMLSGKRSSIKSYTLLAVGNPADLAIEAVRSLR
TSLHFASLEAKNNVLMISGASPSIGKTFVSINLAAVIAQAGQRILVVDADMRKGYAHSLLNCELGIGLSDVLSGQASAQQ
AVRKTSIENLSFISRGKIPPNPSELLMHNRLTEFLAWAGKEYDIVLVDTPPILAVTDAAIVARNVGTTLLVARYGVNSLK
EIEVSIRRFEQNGMEIKGIILNAVEHKSGSAYGYYAYEYK
>gnl|bykdb|A0A3T9EHW9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=385 residues).
KVHPAYRTLLEKRQALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITEASTVGDVRIVDPAIT
QPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARDSVKTIKGIKRYKQSQ
LLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLLIDCDMRKGYTHELLG
TNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVLIDTPPILAVTDAAIV
GRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A3Z1VWW2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Shigella flexneri] (length=247 residues).
TRLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQS
DQKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWAND
HYDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYG
YSYSEKE
>gnl|bykdb|A0A400JH80 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=484 residues).
TRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDNQLNE
LTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISKSS
AIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEHGISVYATIPMSEWLDKRTRL
RKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSDQK
VLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDHYD
LVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGYSY
SEKE
>gnl|bykdb|A0A401FQP5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfonema ishimotonii] (length=298 residues).
MTPTLPKVSQQLYCRGQRVKLFRRKQKSDKRPIPRKHGGFTFDSDPSNGEATSGKADEQTPVLRQKQSDKKLLPHLEPQQ
FEVDQFKTLRTRILFPSSGKQPRSIAVTSAVPGEGKSFVAANLAISIAQNIDKEQTLLVDCDMRLPSVHRIFGYEAVAGL
SEYLSADAPLSDLLIRPRLIGNLSILPGGTPPENPAELLSSKKMLDLLKDVQSRYDDRYIIIDLPPPVLAAEANVIARAV
DAVVVVVNYGHTSRSKVSELIEMLGTDQVLGIVLNRFDTSMHSSAYRMYLKYIRRKEV
>gnl|bykdb|A0A410V446 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Bradyrhizobium guangdongense] (length=270 residues).
MDSIKHAVELARSAEQGARIVQPHSVGPQGNASDAIREIRLNSAHLEKNRIVAHGGISGQPGRYYDMLRTQVLQEMDKKG
WQFLAVTSPTPGCGKTVTACNLAMSIARLPERSVLLVDLDLRKPTLATYLGFKPEHDIIDVLEGQDALASAVVEAAIGPT
KMLVLPGSTTSHNSSEWMASQTMATLLERIKRDFRSRTVIFDLPPMLLGDDVISILPRMDAVLLIAAVGSTSVADIKECQ
KHLQRTPVVRVVVNKTAGAAEEGFYGYGYY
>gnl|bykdb|A0A421K431 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][gamma proteobacterium symbiont of Stewartia floridana] (length=272 residues).
MEKIKQALDRARDNRISKTSLDKDRVVMSKDPESDFTSNITYTKTKSVELSQHNLREKRVIIGDINDSVSDQYKVLRTHV
LQKLKANQWNSLAITSPTEGCGKTLTSINLAISLAREVNHSVLLVDLDLRRPSIQNYFFNDEQPGISEYLNGNMELSEVL
FNPGLDRLVILPGNKPFSNSSEMLSSPKMVQLVEDLKSRYPNRMVIFDMPPLLSCDDVIAFSPYIDSVMLVIEEGVTRKD
ELKRAIDLLGDTNMLGTVLNKSKASGLSYGSY
>gnl|bykdb|A0A423GQ41 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas brassicacearum] (length=249 residues).
MTIPKAMTVTGQSASLNALSYVQTKVVPLRPDHLERNRIVAYNKNSNMGGAFDLLRTQVLKVMEENGWRTLAITSPTPEA
GKTVLAINLAMSIAHHTTKTALLVDFDLRRPMVGACLGLPMEKSLNELLDDEAELQEVLVNPTLPRFVVLPTREPIPLST
EVLSSPTVSHLITDLRERYDSRIVIFDLPPLLSSDDVITVLPKFDCVLLVVANGMNSKKEIEESLYHLGTANLIGTVLNK
AERPSRSYY
>gnl|bykdb|A0A423H7J2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas brassicacearum] (length=249 residues).
MTIPKAMTVTGQSASLNALSYVQTKVVPLRPDHLERNRIVAYNKNSNMGGAFDLLRTQVLKVMEENGWRTLAITSPTPEA
GKTVLAINLAMSIAHHTTKTALLVDFDLRRPMVGACLGLPMEKSLNELLDDEAELQEVLVNPTLPRFVVLPTREPIPLST
EVLSSPTVSHLIADLRERYDSRIVIFDLPPLLSSDDAITVLPKFDCVLLVVANGMNSKKEIEESLYHLGTANLIGTVLNK
AERPSRSYY
>gnl|bykdb|A0A423J219 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas brassicacearum] (length=262 residues).
MEIINSDTEKAEQQTSSKAMTPTAQSTGLNALSYVQTKVVPLRPDHLERNRIVAYNKNSNMSGAFDLLRTQVLKIMEENG
WRTLAITSPTPEAGKTVLAINLAMSIAHHTTKTALLVDFDLRRPKVGQYLGLPMDKSLNELLADEAELQEVLVNPTLPRF
VVLPTREPIPLSTEVLSSPAVSHLIADLRERYNSRIVIFDLPPLLSSDDVINVLPRFDCVLLVVANGLNSKKEIEESLHH
LGTANLIGTVLNKAEPENRSYY
>gnl|bykdb|A0A430DNP0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. ABOLF] (length=299 residues).
MAEPPLAPSSPKLALNLVVALALGLILAGAAVLVREQFDDAVRAPDEVEGKLGLPLLGAIPLVQDIAVDVARPRSPAGEA
YNALRSALLHASPHGLPRTLLVTSSQPGEGKSTSSYAIAAGLARLGKRVVLVDLDLRRPSLHRMLDLPNGCGVSDVLARE
ARLESALQHAQALGFPVLTAGPVAPNPAELLGSASMAEMMVGLVERFEAIVLDAPPVLGLADAPTLAAQAEATVFVVEAG
RRGRGATKAALRRLRAERAAILGVVLTKFDLRKAGAGQRYYRNGYYDYGEADTLRQAAE
>gnl|bykdb|A0A432EMV7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Gammaproteobacteria bacterium] (length=556 residues).
KSLIAYLSYVSKDPQLSADAANAISEAFIEVGLETQLDETRQAKQWLLSNLDSLREKLSQSEARLREYKDKEGLVDSESF
AAQTSDKLGELTSELVKAKAKRAEAEVLFKQVKAAEKRGDDYGSLAAVLNNTLIQALKQEQSQLQRKVSELSGRYLDKHP
KMIAAKADLEEAISRVELETAKVVDGIKRDYEAARAQEKEIKRFIREQKSEMRAFSGKSSDLTELEREVQANKDLYDAFL
KRLKELDVSGFNSKTRVHIIDKAVAPEEVYKPDKQQLLGIALLLGLFAGIALAFLREHLDNTFNLPEDLEEKLKLPVLGM
LPKLGGKYKEGPERHYLVDKRSSFAEAVNGIRTGILFSDIDNPPKTVLVTSAVPNEGKTTTASNLALSFSQLGRTLLIDA
DLRKPSLGKAMGGASAPADLPNLTSGEKAFHEGLLHDKEVENLYFMPSNMIQEILQSQRLEEVFKFLRKYFVHIIVDCPP
VLPVFDPLIASQLADCVIFVAKAGDTPDTASKEAVKRLRFAKLEPLGAVLTMVDIEKLNGHAGYEYYGSEYRDGAV
>gnl|bykdb|A0A432HIS7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Deltaproteobacteria bacterium] (length=274 residues).
MGKIYDALEKSQQYTPNKSSSIDRAHLEAVEDTDVKKTSSPFPLRLNFTNRPLDGSLISYFNPQSIEAEQFRKLASNILF
QNPEKGSRCLLVTGVSRGEGKSFVTSNLAISLAKSLEEPVLLMDCDLRRPSLHTRFGFGNVPGLSDHFIKGMDISSLIQR
TAVNRLSLLPAGSKSFHSAELLSSKRMAQLLKTIKNLNKGRIILIDSPPPSATAEPVAIASQVDGVIVTVQCESTPREMV
VDLIDNIGKEKILGIVLNRFKKPFSAYKKYEMYE
>gnl|bykdb|A0A432SAI6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sulfurimonas sp] (length=241 residues).
ALSSIPVYGAIPHLNSRKNIQSFQEALRVVRTNLEFLQGSQKSKILTITSSIPSEGKTTVSTELANIIAKSHKKVVLLDL
DMRRARIHEKYKLANNIGVSTLLAGNNTLDEVLQTTQIENLDVLTAGPVPPNPSELLLTDTFKEIINVLLERYDYIIFDS
PPVGLVTDAMILMKLSDINLFVFKANYSKKDFIKNINRFVEEQELSSCGTILNGVEMGKKFGYGYGYGYGYGYAHNYYNS
K
>gnl|bykdb|A0A432ZK62 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Idiomarina taiwanensis] (length=401 residues).
MVACLGLDLCWFDRRLSLRLVIKQINAQVSTLLETQQEVLRLARDVEVSQEIYVQLLNRMQELNVLKAGTVGNVRILDEA
VTNPIPVAPKKALIVVLATMLGGMASVGYVFVMAAFNRGVEPAEQIEELGINVYASVPESPLQQSMNEKSTKSLLRMARN
PNIEVKLPFLAIEDPADLAIEALRGLRTSLHFAMLEAQNKTIMVSGPAPAVGKSFVTANFAAVLAQAGQKVVVVDGDIRR
GYMHIQLGGNNKYGLSDFLADKNAENNEDGVNKLIQQTKVTNLDFIPRGTAAPNPSELLMQSKMSALLDELNKHYDYVLI
DTPPILAVTDAAIVGRYAGTSLLVARFGQTPAKEVEATVKCFAQNGVDVRGVILNGVQRRASGYYGYGYGYHYGYSYKSE
Q
>gnl|bykdb|A0A434B8G6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1] (length=297 residues).
FFRTGEDVRDRVNLKFLGYLPTIGGKLGKDEKPSETQVDAKTTQSLSAAERRARMRVSIDSPASMFSETLRSAKIAFDVV
MEGQGSRVIGVISVLPGEGKSTVAANLAGLLAANGSKTLLIDGDLRNPGLSRGLGMETEQGLMEAVVSGQTWQSVGKIDR
QTKLAIIPAVLRGHFSHTSELLSSAGMRRFIENAKETFEYIVVDLPPLGPVVDAKAFAPLVDGFVLVTEWGRTPRAMVRS
MLESEPYVANKIVGAVLNKVDLKKLAKYGSFGGSEKFFDKYSSYYLEKSEVRGKAPV
>gnl|bykdb|A0A434DUT4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1] (length=392 residues).
NVALAAGKSSIDNQTQVQLRELEQKATALSTLYQTFLGRYEEASQQQSFPVGKIRVISDATLPQSAATPRTSIVLGLSLV
LGLMMGAGVGGLNEFRERFFRTGEDVRDRVGLKFLGYLPVIGSKVAKNDDGQADVKTAQSPSAAERRARMRVSIDAPASM
FSETLRSAKIAFDVVLEGQGSRVIGVISVLPGEGKSTVAANLAGLLAANGSKTLLVDGDLRNPGLSRSLGMEAEQGLMEA
VVSGQTWQSVGKIDRQTKLAIVPAVPRGHFSHTSELLSSAGMRRFIDNAKETFEYIVVDLPPLGPVVDAKAFAPLADGFV
LVTEWGRTPRAMVQSILSSESYIANKIVGVVLNKVDLKKLAKYGSIGGSEKFFDRYSSYYLEKSEARTKANT
>gnl|bykdb|A0A434IDQ0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1] (length=234 residues).
SMFSETLRSAKIAFDVVMEGQGSRVIGVISVLPGEGKSTVAANLAGLLAANGSKTLLIDGDLRNPGLSRGLGMETEQGLM
EAVVSGQTWQSVGKIDRQTKLAIIPAVLRGHFSHTSELLSSAGMRRFIENAKETFEYIVVDLPPLGPVVDAKAFAPLVDG
FVLVTEWGRTPRAMVRSMLESEPYVANKIIGAVLNKVDLKKLAKYGSFGGSEKFFDKYSSYYLEKSEVRGKAPV
>gnl|bykdb|A0A434IGN6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1] (length=499 residues).
NTALATAIQERLDAGRMVDQIDKGRGASLGPVLESEGLQKITDKLADLTSQYQQKLGILKPGFPEMQQLQAQIKELQRLY
NNGVLTITDSLRQKYQEAQNKEADLRSKLAEMEKQQVIFNDKNIKYTILKREVDSNRSQYDNLIAKLNEVGVSSELKSQN
AAIVDFATQPGSPYSPRLSINLAMALGLFMALSASIIYVIELLNNTFTNPEQIEKELGLAMLGILPLVDDRELIASITDQ
KSGLSEAYRSLRTSLQFSGAEGAPRSLLVTSSEPSEGKSTTSFKLGQDFAALGARVLIVDGDLRKPNLHRLFGLDNTIGL
SNLLTNTVRKEDLASIFRATKYPNVTVLTSGTIPPNPADLLSSPKMALIITNLGKRFDLVIIDAPPVVGLSDAPILSRLA
EGTLMVISTNQVTRKSAKTALKRLRAAGANVVGAAMSKFAVNKFDYNYAYKYMNYQYYDYGTSTPKLEGKVDDGADQPAF
AKSPAFRRLVRRIRSSVGG
>gnl|bykdb|A0A435BMN6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1] (length=252 residues).
LSAAEKRARMRVSIDAPASMFAETLRNAKIAFDVVMEGQSSRVIGVISLLPGEGKSTVAANLAGLLAANGARTLLIDGDL
RNPGLSRSLGMETEQGLMEAVVSGQTWQSVGKVDRQTKLAIIPAVLRGQFSHTSELLSSAGMRRFIDNAKETFEYIVVDL
PPLGPVVDAKAFAPLVDGFVLVTEWGRTPRAMVRSMLESEPYVANKIIGAVLNKVDLKRLAKYGSLGGSEKFFDRYSTYY
LEKSEARTKQAA
>gnl|bykdb|A0A435F6C0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1] (length=264 residues).
GETQVDAKTAQSLSAAEKRARMRVSIDSPASMFSETLRSAKIAFDVVLEGQGSRVIGIISVLPGEGKSTVAANLAGLLAA
NGAKTLLIDGDLRNPGLSRGLGMEAEQGLMEAVVNGQTWQSVGKIDRQTKLAIIPAVLRGHFSHTSELLSSAGMRRFIEN
AKETFEYIVVDLPPLGPVVDAKAFAPLVDGFVLVTEWGRTPRAMVRSMLESEPYVANKIVGAVLNKVDLKKLAKYGSFGG
SEKFFDKYSSYYLEKSEVRGKAPV
>gnl|bykdb|A0A435IRM5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1] (length=262 residues).
TQVDAKTTQSLSSAEKRARMRVSIDSPASMFSETLRSAKIAFDVVMEGQGSRVIGIISVLPGEGKSTVAANLAGLLAANG
SKTLLIDGDLRNPGLSRGLGMETEQGLMEAVVGGQTWQSVGKIDRQTKLAIIPAVLRGHFSHTSELLSSAGMRRFIENAK
ETFEYIVVDLPPLGPVVDAKAFAPLVDGFVLVTEWGRTPRAMVRSMLESEPYVANKIVGAVLNKVDLKKLAKYGSFGGSE
KFFDKYSSYYLEKSEVRGKAPV
>gnl|bykdb|A0A435LF38 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1] (length=236 residues).
PASMFSETLRSAKIAFDVVMEGQGSRVIGIISVLPGEGKSTVAANLAGLLAANGSKTLLIDGDLRNPGLSRGLGMETEQG
LMEAVVGGQTWQSVGKIDRQTKLAIIPAVLRGHFSHTSELLSSAGMRRFIENAKETFEYIVVDLPPLGPVVDAKAFAPLV
DGFVLVTEWGRTPRAMVRSMLESEPYVANKIVGAVLNKVDLKKLAKYGSFGGSEKFFDKYSSYYLEKSEVRGKAPV
>gnl|bykdb|A0A435LQD4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1] (length=430 residues).
LYNNGVLAITDSLRLKYQEAQNKETDLKSKLAEMERQQVVFNDKNIKYTILKREVDSNRSQYDSLIAKLNEVGVSSELKT
QSAAIVDFASLPTAPYSPRLSINLAVALALFMALAASIIYIIELLNNTFTNPEQIEKELGLTMLGILPLVGDRELIASIA
DQKSGLSEAYRSLRTSLQFSGAEGAPRSLLVTSSEPSEGKSTTSFKLGQDFAALGARVLLVDGDLRKPNLHRLFGLDNAI
GLSNLLTNTVRKDDLPGIFRPTKYPNVTVLTSGTIPPNPADLLSSPKMALILTNLGKRFDLVIIDAPPVVGLSDAPILSR
LAEGTLMVVSTNQVTRKSAKTALKRLRSAGANVIGAAMSKFTVNKFDYNYAYKYMNYQYYDYGASTPKIEGKVDDGAGQP
AHAKSPAFRRLVRRLRSGVGGFVGRAKSAS
>gnl|bykdb|A0A435NNF5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1] (length=233 residues).
SEPSEGKSTTSFKLGQDFAALGARVLLVDGDLRKPNLHRLFGLDNAIGLSNLLTNTVRKDDLPGIFRPTKYPNVTVLTSG
TIPPNPADLLSSPKMALILTNLGKRFDLVIIDAPPVVGLSDAPILSRLAEGTLMVVSTNQVTRKSAKTALKRLRSAGANV
IGAAMSKFTVNKFDYNYAYKYMNYQYYDYGASTPKIEGKVDDGAGQPAHAKSPAFRRLVRRLRSGVGGFVGRA
>gnl|bykdb|A0A435ZMC2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2] (length=277 residues).
PTIGGKLGKEEKPGETQVDAKTTQSLSAAERRARMRVSIDSPASMFSETLRSAKIAFDVVMEGQGSRVIGVISVLPGEGK
STVAANLAGLLAANGSKTLLIDGDLRNPGLSRGLGMETEQGLMEAVVSGQTWQSVGKIDRQTKLAIIPAVLRGHFSHTSE
LLSSAGMRRFIENAKETFEYIVVDLPPLGPVVDAKAFAPLVDGFVLVTEWGRTPRAMVRSMLESEPYVANKIVGAVLNKV
DLKKLAKYGSFGGSEKFFDKYSSYYLEKSEVRGKAPV
>gnl|bykdb|A0A436B5W5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1] (length=573 residues).
SFIDQRLDQTSETSDLARQFIQEQVLQVKQKLQTSEKELVTYAKDAGITVTGDDKSLIGSNIEALNTALATAIQERLDAG
RVVDQIEKGRGSSLGPVLESEGLQKLSDKLADLTSQYQQKLGILKPGFPEMQQLQSQIKELQRLYNNGVLAITDSLRLKY
QEAQNKETDLKSKLAEMERQQVVFNDKNIKYTILKREVDSNRSQYDSLIAKLNEVGVSSELKTQSAAIVDFASLPTAPYS
PRLSINLAVALALFMALAASIIYIIELLNNTFTNPEQIEKELGLTMLGILPLVGDRELIASIADQKSGLSEAYRSLRTSL
QFSGAEGAPRSLLVTSSEPSEGKSTTSFKLGQDFAALGARVLLVDGDLRKPNLHRLFGLDNAIGLSNLLTNTVRKDDLPG
IFRPTKYPNVTVLTSGTIPPNPADLLSSPKMALILTNLGKRFDLVIIDAPPVVGLSDAPILSRLAEGTLMVVSTNQVTRK
SAKTALKRLRSAGANVIGAAMSKFTVNKFDYNYAYKYMNYQYYDYGASTPKIEGKVDDGAGQPAHAKSPAFRRLVRRLRS
GVGGFVGRAKSAS
>gnl|bykdb|A0A436BIA6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1] (length=205 residues).
SVLPGEGKSTVAANLDGFLAANGSKTLLIDGDLRNPGLSRGLGMETEQGLMEAVVGGQTWQSVGKIDRQTKLAIIPAVLR
GHFSHTSELLSSAGMRRFIENAKETFEYIVVDLPPLGPVVDAKAFAPLVDGFVLVTEWGRTPRAMVRSMLESEPYVANKI
VGAVLNKVDLKKLAKYGSFGGSEKFFDKYSSYYLEKSEVRGKAPV
>gnl|bykdb|A0A436K268 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1] (length=304 residues).
LNEFNERFFRTGEDVRDRVNLKFLGYLPTIGGKLGKEEKPGETQVDAKTTQSLSSAEKRARMRVSIDSPASMFSETLRSA
KIAFDVVMEGQGSRVIGIISVLPGEGKSTVAANLAGLLAANGSKTLLIDGDLRNPGLSRGLGMETEQGLMEAVVGGQTWQ
SVGKIDRQTKLAIIPAVLRGHFSHTSELLSSAGMRRFIENAKETFEYIVVDLPPLGPVVDAKAFAPLVDGFVLVTEWGRT
PRAMVRSMLESEPYVANKIVGAVLNKVDLKKLAKYGSFGGSEKFFDKYSSYYLEKSEVRGKAPV
>gnl|bykdb|A0A436NMQ4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1] (length=461 residues).
LTSQYQQKLGILKPGFPEMQQLQSQIKELQRIYNNGVLAITDSLRLKYQEAQNKEADLKSKLAEMERQQVVFNDKNIKYT
ILKREVDSNRSQYDSLIAKLNEVGVSSELKTQSAAIVDFASLPTAPYSPRLSINLAVALALFMALAASIIYIIELLNNTF
TNPEQIEKELGLAMLGILPLVGDRELIASIADQKSGLSEAYRSLRTSLQFSGAEGAPRSLLVTSSEPSEGKSTTSFKLGQ
DFAALGARVLLVDGDLRKPNLHRLFGLDNAIGLSNLLTNTVRKDDLPGIFRPTKYPNVTVLTSGTIPPNPADLLSSPKMA
LILTNLGKRFDLVIIDAPPVVGLSDAPILSRLAEGTLMVVSTNQVTRKSAKTALKRLRSAGANVIGAAMSKFTVNKFDYN
YAYKYMNYQYYDYGASTPKIEGKVDDGAGEPAHAKSPAFRRLVRRLRSGVGGFVDRAKSAS
>gnl|bykdb|A0A436XH86 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1] (length=339 residues).
PTAPYSPRLSINLAVALALFMALAASIIYIIELLNNTFTNPEQIEKELGLAMLGILPLVGDRELIASIADQKSGLSEAYR
SLRTSLQFSGAEGAPRSLLVTSSEPSEGKSTTSFKLGQDFAALGARVLLVDGDLRKPNLHRLFGLDNAIGLSNLLTNTVR
KDDLPGIFRPTKYPNVTVLTSGTIPPNPADLLSSPKMALILTNLGKRFDLVIIDAPPVVGLSDAPILSRLAEGTLMVVST
NQVTRKSAKTALKRLRSAGANVIGAAMSKFTVNKFDYNYAYKYMNYQYYDYGASTPKIEGKVDDGAGEPAHAKSPAFRRL
VRRLRSGVGGFVDRAKSAS
>gnl|bykdb|A0A437R5U4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Bradymonadales bacterium SEH01] (length=738 residues).
MSDQYGFQEPRQSSAPEERGESLGALIGRYWALFRRFYWVLILTSIACVAAAYFWTDRQPRIYQATSKLIFHESRPNVFG
KQFERVELVDPGGRWQFEQFWNTQKEVLGSKWFAQRVIEREGLLDAPGFLSPSVQQLDEDERMKRAVNTLQRVAVYSLQR
DSRVGLVQVRFKDPELAASIADGISETYVEYIREFQTGGLRQLANWFDDYVSTKREELDESRSELQKYQRDNNILSHTFE
DRREMAAEGLAAVSTQLRDVQARLFAEEALLNQLETMESRGDDLRALGDLVDNPALKRGLDRESELLERRAELKTRYLDA
HPEVRAVDEQLEVVRRSIEEEIGRIRTAVANRAAVTRRNTANLQEEIERHKAEIAELNQIGFRYTEMRDSTETLRQHYET
VLGRTNELDLNALYESEIIQILENADVPGAPISPQVPLNLAVGLLLGLFLGGSIMVLIDALDTTVKTEEHVTKYTTRPIL
GMLPAVNAGAVKGVEKFGDSALDTLTHTAPRSSFAEAIKTLRTNLMFMAPDNPPRVLLMTSPGPGEGKTLTSVNMAIALA
QSGQRTLVIDSDMRRPRVHKALGMDNTVGLSEAITGERTYKEAVRPTGIENLEVMTCGPVPPNPSELLQTERFRKLVRDL
REDYDRVIFDSPPLAAVADALVLSHSADVVLLILKFGQTRQELLRRSIEQLESIGAPFGGTVLNDIDENAGYGYAYYYRY
RYDEPGDSGDSKGGKMAS
>gnl|bykdb|A0A440NX85 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium sp] (length=239 residues).
IDAPASMFAETLRNAKIAFDVVMEGQGSRVIGVISLLPGEGKSTVAANLAGLLAANGARTLLIDGDLRNPGLSRSLGMET
EQGLMEAVVSGQTWQSVGKVDRQTKLAIIPAVLRGQFSHTSELLSSAGMRRFIDNAKETFEYIVVDLPPLGPVVDAKAFA
PLVDGFVLVTEWGRTPRAMVRSMLESEPYVANKIIGAVLNKVDLKRLAKYGSLGGSEKFFDRYSTYYLEKSDARTKQAA
>gnl|bykdb|A0A443GJ52 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium sp] (length=649 residues).
VIRYFRPNPAVGTTDVAQLDPATRDAMIASSRRDYAILKLQNEVQAERIGRSYVISIAYQATDPVLATAVTKAYADAYLA
DQLDASFDATERAAVWLQGRLTELRESSQAAALAVEKFRAEHGLAVNDGQLISDKKLGDLNGQLIEAQADTARASARYQQ
YKSIVESGSDNAFRDAAISADQPSNSVISTLKTRYLTVAKRQQDVEANFGAEHPQAVALAKEKADISAQIFGELKQLTES
YRNEYEVALARETALRANVALAAGKSSIDNQSQVKLRELEQKATALSTLYQTFLGRYEEASQQQSFPVGKIRVISDATLP
QSAATPRTSIVLGLSLVLGLMMGAGVGGLNEFRERFFRTGEDVRDRVGLKFLGYLPVIGSKVAKNDDGQADVKTAQSPSA
AERRARMRVSIDAPASMFSETLRSAKIAFDVVLEGQGSRVIGVISVLPGEGKSTVAANLAGLLAANGSKTLLVDGDLRNP
GLSRSLGMEAEQGLMEAVVSGQTWQSVGKIDRQTKLAIVPAVPRGHFSHTSELLSSAGMRRFIDNAKETFEYIVVDLPPL
GPVVDAKAFAPLADGFVLVTEWGRTPRAMVQSILSSESYIANKIVGVVLNKVDLKKLAKYGSIGGSEKFFDRYSSYYLEK
SEARTKANT
>gnl|bykdb|A0A443INY4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sinirhodobacter sp. 2D-5] (length=277 residues).
MEKLQIAIEKARASRLAQRGLTIDVEESVSVAAPTEQRAEAWSALPEMTLDPALLEKNRVIAYHDGPHSAYYDVLRTRLR
DETKRRGIKRIAITSTGPGAGKSTTLANVSLAFARMPHFRTMIFDFDLRRPSLARILGQSPQHDMGEVLRGEVRFEDLAL
RYGENVAYGLNREAVRNSSELLQSEQTHDFLNAVEEVYQPDLMLFDMPPFLAADDTQGFLGFIDGVLMIVEAERTSRHQF
DTVEQKLSELTAVVGVVLNKCPFPDDSDAGSYGYSYY
>gnl|bykdb|A0A443K010 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sinirhodobacter sp. D19-10-3-21] (length=282 residues).
MEKLQIAIEKARASRLAQRGVTSHEDSAPEAPVVTLAEQVGAWAALPEMTLDPKVLEKNRVISNLQGQHAAYYDILRTRL
RDEAKRRGIRRIAITSTRPQAGKSTTLANVSLAFARMPHYRTMVFDFDLRRPSLARILGQTPEHNMGEVLRGEVRFEDHI
LRYGANVAYGLNSVAVPNSSELLQSEQTHDFLNAVEEIYQPDLMLFDMPPFLAADDTQGFLGFIDGVLLIVEAEKTTRHQ
LDAVEQKLSELTTVVGVVLNKCPFPDESDAGSYGYGGYGYGY
>gnl|bykdb|A0A443VCQ6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Raoultella planticola] (length=235 residues).
VNEYRDGLLANENPADLAIEAIRGLRTSLHFAMMEARNNILMISGASPNAGKTFVSTNLSAIIAQSNKRVLFIDADLRKG
YTHKLFEVSNDNGLSDLLSGKTEITKAIKKLSVPGFDFISRGNIPPNPAELLMHERFGKLLEWANNEYDLVIIDTPPILA
VTDAAIIGNYSGTTLLVARFEMNTPKEIEVSVKRFEQSGVKVKGCIMNGVVKKASSYYSYGYSYYGYSYNKEDKK
>gnl|bykdb|A0A444I5K6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhizobium leguminosarum] (length=652 residues).
HELRIVDEFQLVDNPFMGPKSSLFSVSTLKSFMNFRSWFADDAAVAPDPEMRRRGAAETVAGNIDVERVGRSYVLDVSYT
AQSPDLARDIAAAIADVYLVDKLNSKYEATRRAGQWLQERIEELRQQALDTDLAVQKFRSEHGLVEAGSGTLISDQQLSE
INTQLINAQAETAKAEARYARVKSIIDAKQTDAIVTDVLDSSISNDLRKKYLEASKLETEIEARLGPDHVQAVRLRAEME
EYKRLMFDELNRIAESYQSELQVAKSRENSLRDSVTQATGVAATAGETQVELRELERTRDTYKNLYQSFLTRYQEAIQQQ
SFPITAARIITTAETPTKPSAPKRALVVAFAMFVGCAFGSGIAAFREFRDRFFRTGDDVRDVLDVESLGVMPLIENNVDD
PTLVDPSNPRSIARGGKTTTYVEEHPLSAFAETLRSAKIAIDLSAADQRCKVIGVVSSLPGEGKSTTSINFAKLLAMQGA
RCLLIDGDMRNPGATRAIGRHAEAGLLEAIVDSRPLKDLILLDPKTKLAFLPTVARYRVPHSSELLASRGMDQLLQTARQ
SFDYIIVDLPPLAPVVDARAINSKLDAVVFVIEWGKTSRKVVQSTLLSEPELYAKCVGTILTKVDPSQMKLYRTFGSSEY
YYKRYSRYYTES
>gnl|bykdb|A0A444IY46 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Candidatus Electrothrix aarhusiensis] (length=369 residues).
MEVQAQDQKQKAIELNDKASQYRILLRETETNKSIYETLLQRAKEIEATLGAAVTNITLVDRSRVPLYPSSPKVVRNLLL
GLILGLFCGIGLAFLLEYFDDTIKSPEELIERFHIPVLGLIPFDKECINKRRDMALKSYTDPRSPVAESIRTAITSIDLS
AAEHPPKTLLVTSILPGAGKSSLSTNTALSYLSSGDNCLIIDVDLRKPSLHRVFDAERKGEGLSSVLSGISTLKEVIQKT
DYKGLDYISSGPLPPNPAELVASNRMRELLKTVSEHYSHVILDAPPFQGFAEILVLANMVDGLILITVEGDTPRDGVKHF
RRSVLNVNGKILGTIINKTGLQKGYGAYSKYSYYAYQYDYNYGESRNDG
>gnl|bykdb|A0A444R390 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=235 residues).
KGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLLIDCDM
RKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVKWASKNYDLVLIDTPP
ILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A445MZQ4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][uncultured Desulfobacterium sp] (length=263 residues).
MGKLSDALDRHQSERAVKTLMFRPETDHGLGTVMQKEFDPKLVVLTAPESMDAENFKVLKGQIFFPKDGIRPRTILVTSA
FPGEGKSFIAANLAASIAQGMNEYALLVDCDFRRPRIHKILGYSNKEGLSDYLTGKKPLHELLIKTKIEKLSLLTSGTSP
SKPSELLSSNMMKELFQEFKERYDDRYVIVDTAPSHVISEVNILAKYVDGVIFVVMAGKSPREVIQKSIEAIGKEKVLGI
IFNGYEKAYKPYDRYYRNYYKKD
>gnl|bykdb|A0A447B6K7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=615 residues).
MDLQYSVKPKSIPFIGEGIDRIWGEGKGEIHIKHLYIPMRNGENVASFVLTVKNKSTYEIKKDDVEAEGNVGTTLEVGGI
SLLVDAITAREGSQFVVNYKTRLKAISDLQDALSISEQGKDTGMLELTLIGANPTLIRNTLDGITQNYLEQNVARQAAQD
AKSLDFLNKQLPKVRDELDIAESKLNTYRKQKDSVDLSMEAKTVLDQIVNVDNQLNELTFREAEISQLYTKEHPTYKALM
EKKQTLQEEKSKLGKRVSSMPATQQEVLRLSRDVESGRAVYLQLLNRQQELNIAKSSAIGNVRVIDNAVTDPEPVKPKKV
LIIVGAVIIGLILSIILVLLKVFLRRGIESPEQLEELGINVYASIPVSEWLTNKTSKTNKKKNESEILLIDENPADLAVE
AIRSLRTSLHFAMMESKNNVLMISGASPNAGKTFVSTNLAATIASAGKRVLFIDADLRKGYVHKIFKNNHEKGLSDILSG
LIEVKSSIEKVPNGAFDFISRGQVPPNPSELLMHPRFEALLKWASQEYDLVIIDTPPILAVTDAAIIGRYVGTTLLVARY
EANTAKEILISKRRFEQSGVEIKGCILNGVVKKASSYYGYGYNHYGYSYGEHPKK
>gnl|bykdb|A0A447LR75 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Atlantibacter hermannii] (length=236 residues).
MKGVKRFKQSELLAVGNPTDLAIEAVRSLRTSLHFAMMQARNNVLMLTGVSPSIGKTFVCANLAAVISQTHKRVLLIDCD
MRKGYTHELLGTSNVNGLSDVLAGQGDIAACARPTSVAGFDLVPRGQVPPNPSELLMSERFGALIAWASKNYDIVLIDTP
PILAVTDAAIAGRHAGTTLMVARYAVNTLKEVETSLSRFEQNGIAVKGVILNSIFRRATGYQDYGYYEYEYQSDTK
>gnl|bykdb|A0A447RKQ7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella pneumoniae] (length=269 residues).
MKTPEQLEELGINVYASIPVSESNPKNVIAKRLNKRDDSRPKVLLATENPADLAIEAIRGLRTSLHFAMLEARNNLLMIS
GASPNAGKTFVSSNLSSVISQTGKKVIFIDADLRKGYTHKLFNIKNTNGLSDYLSGRVALDKIINNLQTEGFDYISRGSV
PPNPAELLMHNRLAELLEWANKSYDIVILDTPPILAVADAAIIGNYVGTTLLVARFEENTPKEIDISVKRFQNSGVNIKG
CILNGVVKKATNKYGYGYNYYDYSYSDKK
>gnl|bykdb|A0A447YBN8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella aerogenes] (length=302 residues).
MVVLIGLVFGIFVSAGIVFGRMFLRRGIESPEVLEELGINVYASVPVSEWLTQKQSKTGKVITKKALLKQKEETQSLLAL
DNPADLAIEAIRSLRTSLHFAMMESSNNVLMISGASPNAGKSFISSNLAVIIAQTGKKVLLIDADMRKGYIHRVFGKNND
NGLSDILSGKVEFEKAVKNSQLENLNFVCRGQVPPNPSELLMHPRFKAFLDQASSNYDLILIDTPPILAVTDAAIIGQYV
GTALLVARFELNTAKEIEISKRRFEQSGVPVKGCILNGVIKKASSYYGYGYNHYGYTYNSDK
>gnl|bykdb|A0A454CTF1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio harveyi] (length=404 residues).
MMVALEAQLNELTFKESEISQKFTQDHPAYKSLLDKRQTLLQEKARLNRQVQKLPKTQREVLRMTRDVEVNQQIYIQLLN
KVQELNIIKAGTVGNVRIIDSAQSYAIPVKPKKPLIVVLATLLGGMVAVAFVLVKTAFHRGVTSPDEIEQTGISVYASVP
KSVQQLEVASKLKRKSNKDLLLLAEENPADLSIEALRGLRTSLHFAMMEAKNNVLMISGPAPSIGKTFVSTNFAAVAAKT
GQKVLLVDADMRKGYLQQCFGLTADNGLSDFLSGKISQDMVIKPTKVENLDVITRGQVPPNPSELLMHPRFVEFVEKASQ
EYDLVIIDTPPVLAVTDPSIVGAIAGTTLMVARFDQTTSKELEVARSRFEQSGVEVKGVILNAIEKKAASSYGYGYYNYA
YKSE
>gnl|bykdb|A2W025 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia cenocepacia PC184] (length=574 residues).
MPALEGKKLTLTAGPNGTYSLVDENGTRLLAGRVGESAQGGGVTLLVQKLVARPGTQFTVVRYNDLDAISGFQAGIQVSE
QGKQTGVVQISLEGKDPDQTAAIANALAQSYLNQHVVAKQAEATKMLDFLKGEEPRLKADLERAEAALTQYQRTSGSINA
SDEAKVYLEGSVQYEQQIAAQRLQLASLAQRFTDSHPMVIAAKQQLAELQGEKDKFSNRFRSLPATEVKAVQLQRDAKVA
EDIYVLLLNRVQELSVQKAGTGGNIHLIDSALRPGAPVKPKKVLILSAAVFLGLILGTGVVFLRRNLFQGIEDPDRIERA
FNLPLYGLVPQSAEQVKLDAAAEKGGSRARPILASLRPKDLSVESMRSLRTAMQFAMMDAKNRVIVLTGPTPGIGKSFLT
VNLAVLLAHSGKRVLLIDADMRRGMLDRYFGLTVQPGLSELLSDQSPLEEAVRETPVQGLSFIAAGTRPPNPSELLMSTR
LPQYLEGLGKRYDVVLIDSPPVLAVTDATIIGRMAGSTFLVLRSGMHTEGEIADAIKRLRTAGVDLEGGIFNGVPPKARG
YGRGYAAVHEYLSA
>gnl|bykdb|A3VE95 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Maritimibacter alkaliphilus HTCC2654] (length=704 residues).
MTTFDMQAVRSGRSSERSEDIDRVDVRGLLRAIFSRGPLIGGLAVGCALLLFVVTQFIPSTYTAYSKVMLDAREVRIMSS
DEVVSNLSLSDPVIQSEVSVMTSNILIERLILEVGIERLETLYWGEVRGDRDEASRLADLTWAIRQDLNVSRESESYVFE
IQFSAAEPGIAQQIANGIADTYIALQLENRRDSAVQATAWIQEQVNEARATVEAAEAALAEYRSDALTREGGTYETSTQQ
LGNLSSQLVVARSERVTAEAQYEQLRNLLENQGLDALAKAVTSPLLERLNQDKLALERQDAQWGASFGPDHPQRVRIANE
IAGVEAEMQTEAERIIELRRNEVEVARLREQSLADGIQQLEDRLAGMSANSIGRTQLEREAAAARENYEALLARLGAASG
QENLQRPEARVIERATFPAVPSAPRPKLMAAFGLVLGLTAGLVAALFLEMTRSTFRTRREVEAETGLSVLASLPLQAQDG
TRDVIRGLRINSNTLFGEKVRQLRTLMNMRDRDVARVVSVTSSQPGEGKSTTAMALAQMAALAGKSVIVVDGDLRRSRLA
ETFGWQVDYDFADFILETADLPETIHLDEETGIHFLAAVTPCPEAADDLSEDWLRPLMKELKRVFDVVIIDTPPLLNVAD
GLVFNTVADSILYVVRWDETKRAAVREGIDALAEVGLTPAGIVLNQVDPKAAEKIYGDGYAAYS
>gnl|bykdb|A3X191 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Nitrobacter sp. Nb-311A] (length=270 residues).
MDSIRQAVERARAAESTLRNDASGLADLAGMTRQDPFDQVTEVLLDQAHLESTRIVAHGISNQDGRCYDMLRTQVLQELD
QNDWRFLAVTSPTAGCGKTVTACNLAMSIARLPGRSAFLVDLDLRKPMVAKYLGLQKGGGVLSVLENPATLSAAMLQVEI
NQSRFLVLPGSEFCAASSEWMASQTMEALLKTIKSDFRTRVVIFDLPPLLLGDDVISILPRMDAALLVTSVGNTSISDIK
ECQRHLRRTPVVRVVVNKATETAGSYYGYY
>gnl|bykdb|A5G4N9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Geobacter uraniireducens] (length=330 residues).
MEAMEPHTEVLEPPMDVLEPHMEVLEPHMEVLEPHDESSTGERLVLKPRVHHLKKTPPTEKHIRLPEHKRHVPEAPQYEF
TTRPAEMEKLGWVSPTYHQSRSVTLDPRAIAENRCVAFMSDAPEVEAYRILRTKIMHRIREKGGNTLMVTSALAGEGKTL
TAINLALTFAKEFSQTVLLVDCDLRRQKIHDYLKFDSDRGVCDYLLDDCPVSELMVWPGIEKLTLISGGRTISDSSELLG
SPRMKELVADLKNRYPDRLVIFDVPPVLATADALAFTPLVDTILVTVREGETAVDDINRALGMLPPDKILGLVLNRTRRP
MNSYYPPQKK
>gnl|bykdb|A6DVL6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Roseovarius sp. TM1035] (length=209 residues).
MAFDVLRTKLLAALRAHGWHRVAITSPTPDCGKSFVAANLAISLSRQSSVRTVLMDMDLRRPSLAQTLGQPDPGRMAGFL
SGDIPLQRFLTCPEDNLLNIGQTLAMGLNDRAEPYAAEILHAPETGEVLQDMYHHLAPDVVIFDMPPALYYDDVLGFRPQ
FDGVLIVVGGGRTTAQHIRDVKARFGSDTPLLGVVMNRAEGESIAKYGY
>gnl|bykdb|A8LNM8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Dinoroseobacter shibae] (length=276 residues).
MEKLQAALDKARERREGSVPPSGLSSQRPSQRAPLEDRWKALKPIHTDPKILRKNRVFFKDSQNSEAASFDVLRTKVLLQ
MEKNGWTRMAVTSAGSRAGKSTVCCNLASSIARQQSIRAIFMDLDMRNPSMAKKLGVETDGTVADMMTGSISFEEHASRL
GPNVALAMNARPVKDPSDVFLDDATGNFLRRLEQEYQPNLMVFDVPPIFVSDDATAIFSHVDCVLIVVDAERSTIPDLDR
CEKEVADHANVLGMVLNKCRFPEAGYGYGYGYGKKS
>gnl|bykdb|B3Q577 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhizobium etli] (length=648 residues).
MEDKSSSSDLLDAKSETERLLSRSIAERVVRELQLNLRPEFNPALREVTFFESIRTNLRGLFDPRKPAEPVRDGIDAVIP
EFYRALGVWHEDKSDVVQVSFTTNDPQLAAAVPNRVISIYLDERKGSVRSRLDAAEKWIVQRISEQKARADTAREAARSY
QESMDVISKEDAQDERLKSLIELTGREGKIEETRVEVKAVISTLEAADSASVAVQNIALPDDITSKQRDLHAQEDDLARL
LELYDGNAEAVVDLRGKIEKSRADLSFATKQYLQTMRAKLAALDHEAAAVQSILDVAHEKRARDALVQTELTRLQRISDK
EQTALEKLEDQRRDLADKAKLPGAELEVLSPASVPLAAQGRGRLFYLVSALLAAISAAVTAAFVIEMWDRSIRSFDQIAG
MARTIPAGLIPRLARRENPKTIFGQVRVPMFDEAIRTVILTLKQSNGGKLPNSIVVTSAHSGEGKSLIARSLAIELAAAA
IPVLLVDGDLRRGELESYFKSGLRQGLNEFLNGHADIRDVVDHHPSGIDFIPSGKFSLQRRVRSNGLAEIIEMAGAAGRI
VIFDSAPVLASTDTVLLTALAEKTLAVVRWGKTSRRAVEFGLQQMKSPRNSEIIVAINRVNPEKHALYNFSDSELFSRSL
MKYYNFKE
>gnl|bykdb|B7RS54 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Roseobacter sp. GAI101] (length=255 residues).
MVPEAGHKGAPTMQEINTVADAWRNLPATDLDATTLAKSRIVGHLSAGEAHHFDMMRTRVLQQMRRNGWRRLAITSPTAG
CGKSTVAVNLALSLRRQAELRSVLLDCDLRRPSLARMLGIADDMDLGGCLRGDHDFAARARRIGSTLAISASKDPALDAG
EVFGGRYLPRALAAIEDGLAPDVMIFDTPPILLTHDMMSFASHVDCVLLVAGAEMTSVKEIDLCERELAAQTNVMGVVFN
KCRHIGDGYGYDTYD
>gnl|bykdb|D8EEU7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli MS 119-7] (length=394 residues).
MYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISKSSAIGNVRIIDP
AVTQPQPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEHGISVYATIPMSEWLDKRTRLRKKNLFSNQQ
RHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRR
GYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDHYDLVIVDTPPML
AVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGYSYSEKE
>gnl|bykdb|E1Y9C0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][uncultured Desulfobacterium sp] (length=197 residues).
MLRTRILRRTKERGGRSIMITSALSGEGKTTTAINLSLTFAKGFEQTVMLVDCDFRKQCVHEVMGFNSDRGLLDHLLDDM
PLSDLIVWPGIEKLTVISGGKTIQESSEVIASPRMRELDSEMKNRYPERYVIFDVPPLLVGTDAMTFAPLVDWIIMVVQA
GKTSMAEVNKAMQMLPKEKVLGLILNRQTAQAEAYPY
>gnl|bykdb|E1YJF1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][uncultured Desulfobacterium sp] (length=302 residues).
MNKKQEYIGWIFMGKMFEALQKAEDENVRTPQAETVEPSLDNDTVFDDNLVCHFQSNSIVSEQFRKLRTYLFMPALGAKP
KTILMTSAVSGEGKSLIAINLAITIAKELHSHALLMDCDLRNPSLSRWFGVNKAKGLSDYLVGNSELPDLLIKTGIDKLN
ILPGGDSQENPAELIGSKKMEGLIDELKSRYSDRHIILDSSPVLATTEPQVLYKVVDCIILVVRAGVTPRGSVQQAIKFL
GKEKIVGVVLNDMNFRSAALRSRYFGTSRYYPYYGSDNNDKNQNFGSKFNSIFKKKQREQHK
>gnl|bykdb|E8RBB2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobulbus propionicus] (length=290 residues).
MGKVFNALKRVDASEDTVPSAAEQVALESQNFPEVDSRETGHTHEDEAADRQSPRQGRWDDRLSLATVTTGPVAESIRAL
RTRILYPNSGPIPRSILVTSASPGEGKSFICANLGISLAQGVDNYCLLVDCDLRRPAQHTLFGLSNRSGLADYLQHKKKL
SELLVSSGVEKLSILQAGPRSINPAELLGSASMISLVDELAKRYDDRIVLLDSPPLHAASETAVLAQHVDGVILVVRYGA
SRREYVKALADAIGRDKILGVVFNAYKATMLDYKVFGYYEYQQDYYYSEQ
>gnl|bykdb|F2NDF5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobacca acetoxidans] (length=305 residues).
MSFIEKAVELAKSSRRQEEGSHRSELEKLLEQQPLSDLEEAPYPEEIKDIAYSLTKTVPIQMETMVRNRLITGGVNPEIQ
QSYKLLRTHILQKTHGQNHNVLMITSPMPEEGKTLTAINLAVSLSQELSQTVLLVDLDMRFPSISRYFGFTAERGLADYL
EGKANIPELLVHPQGIDGLVILPAGRPTEWAAELIRSPRMLQLVPELKNFYPNRYVLFDLPPMLSFADALSFAPLVDGII
LVVAARKTSRDDLKRCQEMLQGRPIIGYVFNKAEELKQSSYYRYYRSSDRPKRSWFFWTGNGKKQ
>gnl|bykdb|F2NEE9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobacca acetoxidans] (length=302 residues).
MSFIDKALERAQAARQKDKPKVEEDIKAPWAENSRKPLPVAGSVGYAGPVKDICYTTTKTYPVDMKLLAKNYIIVGDEFP
DITEEYKLLRTHIIHKTKKNNYNTIMFTSPQLNEGKTLTTLNIAISIAQEIDKTVLLVDTDLRNPTIHRYLGLSPRRGLV
DYLKDGIPIPELLIHPEGIDKMVVLPAGRATGDAAELIKSPQMVDLVQELKHCYEDRYVLFDLPPLLSYADALAFAPLMD
CIVMVVEAGRTRCDQIEQGIEMLKDFNLLGLVLNKVKKKDQGSYYDYYQSREPKKSKFRIFG
>gnl|bykdb|F3FHG4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. japonica str. M301072] (length=395 residues).
MKLKRVELERLYTREHPTYRSLMSQMNQLEQQRQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLMLNKSQEQDILRAG
NIGNVRVIDNADTNVERPVKPMKTLIVLIATLLGALVAMTMVFVRQAFYRGVESAEIIENLGMPVYASLPYSRQQEHLDK
RDHAGKESKLLSIAAPAELAIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQTGKRVLLIDADMR
KGYLHRLFGLQPKHGLSDTLAARLRCTEVINTTRVRHLDFISCGFAAPNPSELLMHDNFHKMLAELSPLYDLILIDTPPI
LAVTDATLVGRQAGTCLLVARFGMTTVQEIEASKRRLGQNGILIKGAIFNAVVRKATTSDYDCAAYGYNYHPAPR
>gnl|bykdb|F3GGI0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. pisi str. 1704B] (length=501 residues).
RLKIAEAGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESETALNTFQTS
ARSVDLSIETKGVLDQVVSLDSMLSELKLKRVELERLYTREHPTYRSLMSQMNQLEQQRQGLLKKIDALPMTQQELLRLT
RDMQVISQTYTLMLNKSQEQDILRAGNIGNVRVIDNADTNVERPVKPMKTLIVLIATLLGALVAMTMVFVRQAFYRGVES
AEIIENLGMPVYASLPYSRQQEHLDKRDHAGQESKLLSIAAPAELAIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGK
SFVSSNLATIIAQTGKRVLLIDADMRKGYLHRLFGLQPKHGLSDTLAARLRCTEVINTTRVRHLDFISCGFAAPNPSELL
MHDNFHKMLAELSPLYDLILIDTPPILAVTDATLVGLQAGTCLLVARFGMTTVQEIEASKRRLGQNGILIKGAIFNAVVR
KATTSDYDCAAYGYNYHPAPR
>gnl|bykdb|F5NSX0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Shigella flexneri K-227] (length=258 residues).
MSGDSGGQSKRTRLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFV
SSTLAAVIAQSDQKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRD
RMRQLLEWANDHYDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRAS
TAYSYGYNYYGYSYSEKE
>gnl|bykdb|G2E3C0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Thiorhodococcus drewsii AZ1] (length=283 residues).
MERLKKAMERARAERQASLAGSAGRPERQKAGGSRFAHRTQPRPPASDAKVDYTHTATLDVDADAMRERRVILADGVDPI
ADAYKVLRTHVLQRMRANGWKTLAVTSPGIGDGKTITSINLAISLAREVNQTVLLVDLDLRRPSIGRYFSEGPTQGISDH
LTHGVDLADLLINPGIDRLVVLPGHDSFTHSSEMLSSPQLVQLVRELKERYEDRLILFDMPPLFAGDDVIAFLPYVDAVM
LVVEDGKVSKSELEQANQLLGDKNFIGIVLNKAEQVGDVSGYY
>gnl|bykdb|G3J0M3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Methylobacter tundripaludum] (length=251 residues).
MIKNTDKYPLDSIRYTKTHSVMIDPDVLRNNRVIMGLNNDPRADYFRVLRTTVLKQLRENNWNSFAITSATPEAGKSFIS
VNLAIAIAMEGNQSVLIVDADLRRPSVGQYLGLQCEFGLVDCLTSDVPLEDVLVNPGIERLVVLPGKSSDNNSSELISSR
KMISLIQEIKSRYESRIIIFDLPPLFAADDAMVLMPYADAALLVVEDGKNTSEELQHSMYILEQTNLLGLVLNKSRQPLP
TYQYGYVSEAD
>gnl|bykdb|H0T8B0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Bradyrhizobium sp. STM 3809] (length=671 residues).
MIGSKKDVWIRSDLTIENLLVDDAAVETEIETTVSEKVIATVVSRLRLDQNPEFECPDRGLFAIFSPSKTSLPPSEARIR
CAVSTVASNLSIVRVGRSYIEEITYTSRDPVLAGEVANAIAQAYIEDQLQSYFETSIRTNTWLEKRVAELHKQVQESLQA
VQDFKFQNAIILGSQGRLASEVELDKLAKELAKSRAETIQAQAKLEQITHVLVQRSKSQDFDVSSPAVPDALNSPVINGL
RDDFLKDKSKEAELSARYGTDHQAAVQLRERMAARQQAIWDEIGRLAEGYKSQVQIAKAHEDELNKKLDEVFQQSAATRQ
LQAKLRELESTAKVYQSNYATFLARFTQTAQQQPVPANSSRIVHEAGPGFRIAPISSQILMLSALYGLGFGVLASLVRNR
TDRGLRTRKEVERVAQKPCLANLPDAGRKRLGLGRRGSKRPEAAFRQIVDAGPFSATAEALRAVKLALELKQEGSKIIGM
VSARPGEGKTTTAAGLATFLAKNQHRVLLVDGDLRKQSMTRMLGYAKQSGLIELRAGQVDFEEVIISDLAHGFDFVPASA
LLRPSSGADILNSPRVSEALKSAKGKYDYVLVDLPPILPVVDVVAAASTFDAFVLVVNWNETRASEVLAALSASPSITDR
VVGVILNKVDEAALRRFEGRSKRSSRYYEFA
>gnl|bykdb|I2WC85 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli 9.0111] (length=188 residues).
MTPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVP
PNPSELLMRDRMRQLLEWANDHYDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGA
ILNGVIKRASTAYSYGYNYYGYSYSEKE
>gnl|bykdb|I4CBA7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfomonile tiedjei] (length=692 residues).
MSTYSPHDSEAFEFSSPRHSLTGHVRTIFRKKWLFLGIVALALAGGVVVGLVRSPVYKSSAILRVELGGPSQRGLQGALE
FFAEFSIFYETQVQSLKEMAQSGSLSTPDRRGLEDAAKALPRWSDIRITENRGSQLINVEASANDPFAAREKLRDYLEQY
IRADRERLETLANSLLAKLQNELRQAEERMRKSQEELVNFAREHGMVLLDDEPELESSLLETAGKTFLDIRNERLNLETL
TLHKQMILPKYIDNEFLSTLKKNSAALKADYVSAASVLGSGHFQHSLAQGKLYAMEKAISEVEQSEIASSLEAAKKRESA
ALQAYELAKEAAIRAGSNATRLSILKRAAAADAQVYLTLTQKIKQMALFSRLAPHTLGIEGPPTLPTKPVFPDWRRIIAA
SLFVGLFGAIVVILGPGMLSTGVKTSGDIKELGLPVLGVIPDAKSIMRGNFGGVSGFSYELSPHYFPLSLLTDALHVVRE
NIASALKKDEGAAICVTSSLPSEGKTFVATSLAATIASERNRVIVIDGDLRNPRVSEVFKSSRQEKGLAEFLSGNTVSAE
EIIRQSTIPGLFYVLAGNRPDNPVALLKSPRFGAFLQHCIQTFDLVIVDAPPVLGFADAAILAKSCTGALMVVRQGFEKM
ELIKDARDTFRRLKIRILGAMLNFAETDLPELGFIHDDVYSGYAKFLDKPTQ
>gnl|bykdb|J2TAD5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas sp. GM60] (length=268 residues).
MEINKPDTEGDVQQSSSALVTTPKAMTATGHSAGLNALSYVQTKVVPLRPDHLERNRIVAYNKNSNMGGAFDLLRTQVLK
IMEENGWRTLAITSPTPEAGKTVLAINLAMSIAHHTTKTALLVDFDLRRPTVGACLGLPMEKSLNEYLADEAELQEVLVN
PTLPRFVVLPTRKPIPLSTEVLSSPAVTHLISDLRERYNSRIVIFDLPPILSSDDVITVLPKFDCVLLVVANGMNSKKEI
EESLHHLGSANLIGTVLNKAEPQNRSYY
>gnl|bykdb|J3H699 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas sp. GM67] (length=268 residues).
MEFNKTDTEDDEKQSSSALVATPKAMTATGHSAGLNALSYVQTKVVPLRPDHLERNRIVAYNKNSNMGGAFDLLRTQVLK
IMEENGWRTLAITSPTPEAGKTVLAINLAMSIAHHTTKTALLVDFDLRRPTVGACLGLPMDKSLNEYLADEAELQEVLVN
PTLPRFVVLPTRKPIPLSTEVLSSPAVTHLISDLRERYNSRIVIFDLPPILSSDDVITVLPKFDCVLLVVANGMNSKKEI
EESLHHLGSANLIGTVLNKAEPQNRSYY
>gnl|bykdb|K0NP00 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobacula toluolica] (length=286 residues).
MGKIYSAFEKKRSEERGLITDLETEYVSEEPKNDFYVSNSDISMAEPYEEIPENIDPTLVTVHIPHSIESEQFRLLKNNI
LFPENGTPPRSIMITSPSPDEGKSFVAANLSISIAQSIDEHVLLMDCDLRSPTIHKLFGLPDTKGLSDHLSTAITLSSLL
LKTFINKLTILPGGTVPRNPSELLSSEHMRRLIHEVKLRYSDRYIIIDTPPPYITSEGNALARYVDGIIVIIRHGKTRMK
DVQDIISIYGKEKIIGVVHNFAEKRPGYGYGYYKYGYGNHKYGHVK
>gnl|bykdb|K0XBA5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Shigella flexneri 1485-80] (length=301 residues).
MNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEHGISVYATIPMSEWLDKRTRLRKKNLFSNQQRHRTKNIPFLAVD
NPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRRGYSHNLFTVSNEH
GLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDHYDLVIVDTPPMLAVSDAAVVGRSVG
TSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGYSYSEKE
>gnl|bykdb|L0H287 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Thioflavicoccus mobilis 8321] (length=281 residues).
MHRLRKAGKRPLAEPADGAGATRVASLAELPDHQQSTRGGADAPNDPAGASIRTRRVLVDPERLLANRIVAMAAHDPAAM
AYKVLRTHVLQRMRANGWKTLAITSPTQGNGKTVTAINLAITLARDVKYTALLVDLDLRRPAVASHFFDHPVPGLSDYIT
DDVPIEELLVNPGIDRLMLLPGNHSFTHSSETLCSPKMIELVNEIKGRYSDRFVLFDLPPVLGGDDVMAFSPYVDALLLV
VEEGKTSKDELSQAYEQLDKAKILGTVLNKAEEASTGAGYY
>gnl|bykdb|M2U8P2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pacificimonas flava] (length=699 residues).
MTADFAEKNATGPLLDFGKLTVIARRRIVPMAVAAALCALAVAALYFTSEPTYSASGQIGFERGADELLPGLSERRAEIT
DAASVETAVQALRAPEIATAVARTVGPERILRAYMDPDQPIPTERQAATRRAAAFIRGGLSARREGTSFVITIASEGPDP
EIAAAAVNSVIDIYVGGQVSEKSSQRQREISILRERIAELKTDLQDAETQVANYRARTNLVDIKDDSTAAQQILSQLGAE
LAQAEAEQAVAESRAASPAAAIQSSSLLRELRAREAALSAERADLAGRYGERHPSLANIDRQLSDLNERISEEIARERDA
ARREAQTASRRTASIRSSLNDAQSELLEGNNASVRLAELERNAEAARALYESFLSRLRENVAAAGTEQTNAYPLSRASAP
RVPASPSLQMFGLIGLMGAGLAAAATAAALELREQGYRSRREVERHLGLPVLASVADVSTVPDRPVRVRGLRDVSEYLTQ
NDGSVFNEAFRSLRTALHVGRSDQIAKSIAVCSALPSEGKTTTALCLAWSAAMAGHKTIILDCDHRRATFSRSLSKSFDY
GLGDVLNGEATLEEAIIPGPIPNAFLLPQRSHGREHLDVLLSQRMQDLIAELQNSYDFVILDTPPILPVAESRALSAMVE
AAILVVRWRGTTRESASQALEELHRADANLIGAVLSKVDLRKPIDAYESGVYYYEVAKE
>gnl|bykdb|Q44570 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Komagataeibacter xylinus] (length=291 residues).
KLGIGLIAVALAAGAVRCCCAITSRRALPRSSACAAIPLPLLAVVPKVGGRTEQTVRRHVLDHPYSRATEAVRSLVMQLS
MRVHEGGQPLCLAITSAGPEEGKSTLALWMAAVARRGGQKVLVIDADHRRGMLDHYLTDGTTGRPSLGMSDLVTSGVRVA
DVIRTDPEAGFDYIPAGRTIEHAFSPVEIRRLRAMLVELKQSYELIIIDCPPLLGLSDALVHANMADQVIFVCRWKSTAQ
RAVMACLERLEACGAHLAGVVATMVEDNAMDVMGYSYGNRDIRILSRFDEQ
>gnl|bykdb|Q44573 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Komagataeibacter xylinus] (length=637 residues).
MIHSRDVAAAVMAQLPPPAAPPHVGLRDRLCHMGLGFLCHASTPVDPQVQREHEEDAFLNNLTVTPEPRTQILDINVVDG
NPERAAALANAVVTNYQRIALARQTADINRVATWLDNRTAALRQRWLDAVQKANTFDNVHGLTNTSEGSTSTPLIERQIA
DTSANLSQAEGRLAAAQARADALQDAAARGDARAAVALSQEPILVATANALMQLQSTRQEEAATYGPQHPRLRALDQQIA
TTRASLEAETQAALSTIREDQISARAEVQRLNENLDLLRQKAGGQSAPQAEYRTLDQEAQSARAVYETFLEHAKEVVDRA
ALLQPPISVVSHASPPDVPSFPNRKKIGLGLIAVALAAGAGAVLLRDYFAAGFTEIERLRAAVPLPLLAVVPKVRGRTEQ
AVRRHVIDHPYSRATEAVRSLVMQLSMRVHEGGQPLCLAITSAGPEEGKSTLALWMATIARRGGQKVLVIDADHRRGMLD
QYLADGTTGRPSLGMSDLVTSGVPVADVIRTDPDTGFDYIPAGRTMQHAFSPVEIRRLRTILTELKRSYELVIIDCPPLL
GLSDALVHANMADQVIFVCRWKSTAQRAVMACLERLEACGAPLAGVVATMVEDNAMDVMGYSYGNRDIKILSRFDDK
>gnl|bykdb|S0G1D4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfotignum phosphitoxidans DSM 13687] (length=268 residues).
MGKLFDALEKARQDHRVQEDEVPVHTVKTGEIPANDRQILPKTVHPSMVTLLKPHSLEAEQFRILKNNILFPEKGDPPRS
IMITSPSPSEGKSFVAANLAVSIAKSIDEYVLLMDCDLRSPTLHTLFSFPEGPGLSDHLARAMPLPEMLKKTFINKLTLL
PAGSIPQNPSELLSSEQMRTLLYEVKSRYRDRYVIIDTPPPNLTSETNAIARVVDGIVIVVRYGKTTRKQVENLIDIYGR
KKILGVIKNFSKKPVLSRYPYSHYGNTS
>gnl|bykdb|S1EXJ6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli KTE73] (length=215 residues).
MEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRHGYSHNLFTVSNAHGLSEYL
AGKDELNKVIQHFGKGGFDVITRGQMPPNPSELLMRDRMRQLLEWANDHYDLVIVDTPPMLAVSDAAVVGRSVGTSLLVA
RFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGYSYSEKE
>gnl|bykdb|S7TK97 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfovibrio sp. X2] (length=270 residues).
MSRIEEALSKAAGMKPAVDGPRPSQAKSVAASKCCPMPETPEMNKVSVRESTLVSIFEPQSPAAEEYRKLKESLVKLTRK
DRFNNLIMVTSATMGEGKTMTAINLAVSLAQEYDHTVLLVDADFRRPTCHLYLGLEPEVGLSDCLLEGRDIGEALVKTGI
GKLALLPAGSKVSNPAELFSSQAMKNIFTEMKGRYADRYVIIDTPPVLPFAETRSLASIADGVILVVREGGPSLDEVETA
VGALERKVLGVVYNAAKSPPLHSGYYYYNR
>gnl|bykdb|S7UE93 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfovibrio alkalitolerans DSM 16529] (length=270 residues).
MSRIEEALAKAANLNTNSGPGLERSGRHGRKVGRSPLVEPQITPVQQVPEPTLVTINAPLSPMAEEYRKLKEALVKMTKR
ERFDNLIAVTSATVGEGKSMTAINLAASLAQEYDHTVLLVDADLRRPVVHKYLGFEQGKGLSDCLIEGRDVSEVLVKTNI
GKLVVLPAGTSVPNPAELFSSEAMRNLFMEMKGRYSDRYIIVDTPPVLPFAESRSMAGIADGVLLVVKEGQPSVEQVQEA
IDALQNKVLGIVYNGAHMSKSSNGYYYYAK
>gnl|bykdb|V4J283 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][uncultured Thiohalocapsa sp. PB-PSB1] (length=524 residues).
KISLVAAAGALSGAFTAVEYPNYSGILNVGFSAGEPEQAATILNAILDNYQRRNVERKGEEADKTLEFLEKQLPPLKARL
EAAESAYNDYLREHGTIDITRETENVLTSIMEIENELFTLQQERETLRSRFKPTHPKIRSLDGLMATLTGKLRTLEQQTE
ALPEVQQTVLRLSRDVEVNSSLYSRLINAMQELRIAKAGTVGNARIIDYALPPTFPSAPNLRKTVAISILLGLFLSFAMI
FLLVKLRHGIEDPDEIERALGIPVFGSVPFSNTQRKIAKRINRRKTRVRPLALEAPDDLAVESIRSLRTSLHFLLLEAGN
TILLITGATQGVGKSFLCVNLSLVLSQAGKRVLLIDADLRKGHLNRLLGVEAGKGLSELITGEAERDAVLVQMQPQGLDF
IATGARPPNPSELLMHERFSNLLHWGTKQYDYVVVDAPPILAVTDPAIIGTHAGASLLVARADINTLGQLDESVKLMKQG
GSNVRGIILNGILPQRGYRYGYRYGYRYGYRSEGKYVDTSESQR
>gnl|bykdb|V4Q8B7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas chloritidismutans AW-1] (length=532 residues).
MQIAQLDARPGTEFALVRNRPQTTALDYQNRLKVGEAGKDSGIIYMSLEDPDPQLANQVLDEISRLYVSQNIQRSSAEAA
QRLDFLRSQLPQVRKELEKAEAALNAYQTSSKSVDISIETKGVLDQIVALETQISELSLKRVEYDRLYTREHPTYRTLIT
QMNELQAQKAQLLKKVDALPMTQQELLRLQRDMEVTTQTYTLLMNQAQEQDILRAGTIGNVRIIDNAYSMIEKPSKPVKP
LVVAIAIFVGLLVSAAVILLRQAFYRGVESPDVIEKLGVPVYAGLPYSASQDQLNRSRKSRDGKTRLLSLTEPTDLAVES
LRSLRTSLKFAMLEARNKVLMITSPTPSVGKSFVSSNLAAVIAQTGQRVLLIDADMRRGYLHTLFGMAPRHGLSDALASG
LNLAEITNRTEQKNLHFISAGFSAPNPSELLMHDNFSRLLREAEKLYDFIIIDTPPVLAVTDAVLVAQQSGTNLLVARFG
LSTSSQIDASKRRLAQNGVLLKGVILNAVKRKASTSPYDSGAYGYYTYTQQA
>gnl|bykdb|V5C6R5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Methyloglobulus morosus KoM1] (length=256 residues).
MVDSSESDSLDKIRYSKTRITPLDAEVLQDNRIIMGLYNDQRADLFRVLRTNILKQLRENNWNSFFITSATPGAGKSWVA
TNLAIAIALEGNQTVLLVDADLRHPSICHHLGLNCKFGLIDYLSGVTSLEHILIHPKIENLVLLPGKESKVNYSELISSP
KMVEFIKDTKSRYESRIIIFDIPPLFIADDAMLYMSYCDAALLVVEDDKNTTDELQQSMQILEETNLLGTVLNKSRQQLP
SYKYGYGYGYSAKVSG
>gnl|bykdb|W1AYZ1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella pneumoniae IS22] (length=284 residues).
MLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARDSVKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTS
LHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLLIDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAA
KPTSIAKFDLIPRGQVPPNPSELLMSERFAELVKWASKNYDLVLIDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEV
ETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|W1DSK1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella pneumoniae IS43] (length=201 residues).
MLEARNNLLMISGASPNAGKTFVSSNLSSVISQTGKKVIFIDADLRKGYTHKLFNIKNTNGLSDYLSGRVALDKIINNLQ
TEGFDYISRGSVPPNPAELLMHNRLAELLEWANKSYDIVILDTPPILAVADAAIIGNYVGTTLLVARFEENTPKEIDISV
KRFQNSGVNIKGCILNGVVKKASNKYGYGYNYYDYSYSDKK
>gnl|bykdb|W4HJV8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Roseivivax marinus] (length=582 residues).
MNMANRPKFRRRHRPAATGWDDGARVPARTTGPETSFDVQGTDAAEAGADTDTAFDPVRDGGRSTAKASGETPSNRESGP
PDTTSDEPDRGALAESEAPPPASVETGVPAGRVNATSLSSDSDSDSDSDSDSDSDSDSDSPEEDRSPEQATALAASDPSV
PTPSAAPENAAPAHDATVPAPNLAYATPDALASETSEEALPATDLRDAKPDARTAETSGHTPTSATETNIPHATPDAPAE
TSEDETSSEGLSGPDLSRSAADATARRTPADVAREVRGKTYAPGKTSGTRPSLPDTSASCSVNAVTPTDPTATDAATAFP
SLTDTPAGILPARTGDHSDPRDVAWDRLGAIPVDERALDRNRIVSASRYDPAHVQFDVLRTRLVQALAERNWSRVAITSP
TKGCGKTFTAANLGIALSRQSDVRTLVLDLDLRRPSLHKVFGRREGGAIGDMLRGRTAPETHLKKLGPNGFNAGRGIAFG
FNDTPEPYPAELLQDPRTAETLDELEAIYEPSVMLFDLPPALAADDVLALRPHFDAVLLVVGGGLTNQKEIREVERRLGE
DTPLLGIVLNRAEGANSKKYAY
>gnl|bykdb|W6VFG3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas sp.] (length=262 residues).
MEMFNPDTEKTEQQTSSKAMTPTAQSTGLNALSYVQTKVVPLRPDHLERNRIVAYNKNSSMSGAFDLLRTQVLKTMEENG
WRTLAITSPTPEAGKTVLAINLAMSIAHHTTKTALLVDFDLRRPKVGEYLGLPMDKSLNELLADEAELQEVLVNPTLPRF
VVLPTREPIPLSTEVLSSPAVSHLIADLRERYNSRIVIFDLPPLLSSDDVINVLPRFDCVLLVVANGLNSRKEIEESLHH
LGTANLIGTVLNKAEPENRSYY
>gnl|bykdb|W7Q5J0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Halomonas sp. BC04] (length=674 residues).
NTSAEIQILQSRMVLGHAVDRLGQENIIRPVTMPIIGDYVVRQGIQRPDFPIMLPYISDYVLSSGIPQPSFMQRQPYVWG
GENLEVARFVLAEHRRSHVVVVERDSEERYRVMLNEQHIGDGHIGQLHTFLDGEMELLIDEFNAAPGAQFRLAKRNRNGD
IRSLGGRLQIAEVGGGRGSSTGVLRLSMTGPDTQEIVRSLDAVADTFLTQNVERQSAQAEQSLVFLEEQTPELRHQLTTA
EERLNRYRAELDSVDLSSEAQAAVQRYIDIERRINELEFQEAELAQRYTTSHPSYQTLLRQKRHLQAEKTQLNNRVNELP
TAQQEVLRLTRDVEVTQAIYVNVLNKVQELQVAKAGTIGNVRIIDRAEIRGMVAPQQSRITVLATLLGATLAVGLVLLRA
LFKRGVETPDQIESAGMPVYATIPLSNQQQRLARRVKRWKNKRNTGQDIVVGVLAERDPTDSAVEAIRGLRTSLHFAMLE
GRNHRLMISGPSPGVGKSFVSINLAAVAAQAGMRVLLIDADLRKGQNHHAFRLRSEQGLADYLAKQLELDDIIKETSIDN
LSLITRGMVPPNPSELLMQPRFTEALVQLDKRYDLIILDTPPVLAVTDASVVGKHCETSLLVARFEKNPIREIQAAKRRL
ENNGFDVQGVILNAIERKAATASSHYGYCYYNYR
>gnl|bykdb|W7Q8F9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Halomonas sp. BC04] (length=575 residues).
MVVERDSEERYRVMLNEQHIGDGHIGQLHTFLDGEMELLIDEFNAAPGAQFRLAKRNRNGDIRSLGGRLQITEAAGGRGS
PTGVLRLTMTGPDPQEIVRSLDAVADTFLTQNVERQSAQAEQSLAFLEEQTPELRSQLTAAEERLNSYRAELDSVDLSSE
AQAAVQRYIDIERRINELEFQEAEMAQRYTHSHPSYRTLLRQKRHLQNEKSQLNDRVNELPAAQQEVLRLTRDVEVTQAI
YINVLNKVQELQVAKAGTIGNIRIIDRAEIRGMVAPQRSRITVLATLLGLTLAVGLVLLRALFKRGVETPDQIESAGMPV
YATIPLSNQQQRLARRVKRWKNKRNSGRDIMVGVLAERDPTDSAVEAIRGLRTSLHFAMLEGRNHRLMISGPSPGVGKSF
VSINLAAVAAQAGMKVLLIDADLRKGHIHHAFRMRGEQGLADYLAKQLELDDIIKETSIDNLSFIPRGRVPPNPSELLMQ
PRFVEGLLQLDKRYDLIIFDTPPVLAVTDGCVVGKHCETSLLVARFEKNPVREIQAAKRRLESNGVDVQGVILNALERKA
STAASHYGYYQYNYR
>gnl|bykdb|W9VVY5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Imhoffiella purpurea] (length=276 residues).
MDRARAERQAALSGSAAPQRQDKIATVSRLEPAQPKPPATDVKVDYTRTATVRIDADELRERRIFLSDGLDPVTDAYKVL
RTHVLQRMRANGWRTLAVTSPGVGEGKTITSINLAISLAREVNQTVLLVDLDLRRPSIGRYFSEGPTLGISDYLTHGTDL
ADMLINPGVDRLVILPGHDSFTHSSEMLSSPRVVQLVSELKGRYEDRLILFDMPPLFAGDDVIAFLPYVDAVMLVVEDGK
VSKAELEQADHLLSQNNLIGMVLNKAEPLGEPAGYY
>gnl|bykdb|X7F6S5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Roseivivax isoporae LMG 25204] (length=380 residues).
MAAGPRFRRRKGRAAPAEDDLRPVPPLASREERLARRAEDMSATESRSAAAEEARARDGQAAEAERARHAAEAEAETERL
RIERDAERARIARELAEAREAERARAAEAERPLLLRAAEPAREPAPAPEAPPSVPGDGSAAAWERLARFSVDERELDRHR
VVTASRHDPAHVAFDVLRTRLLQALAERGWSRVAVTSPTQGCGKTFTAANLGISLARQENARTVVLDLDLRRPTLHKVFG
LREVGSMGDVLRGRTPPEAHLRRLGPNTFHAGGCIAFGFNDAPETYAAELLQDRRSRAALDLLEARFAPDVVLIDLPPAL
ASDDVLALRPAFDAVLLVVGGGLTTQAEIREVQKRLGEDTPLLGVVLNRAEGVNTRKYAY
>gnl|bykdb|Z2EKW7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio parahaemolyticus V-223/04] (length=528 residues).
YIDANFEAKLVVTQNAATWLTNNSQKLEERLKKSEHALQEFLLKEGLIDINGIDDIYANELEELNRKLNTAVNKRIEAQT
LIQLLKRKSSQNLDSLLSIDEFANQAQIRDLKLSEAQAAKNVSELAQRYGPKHDRMVQAKAQLASIQERTQQLIREISFS
KQQDLLAAKAQEDMLREELDRKKSDFQSLGSQKARYEQLKREVESNKDLYEAFLNREKETSATSDYKNVTARFTDKAIIP
LFPVAPQRMKLVLIATFFGFAIACALVIILETLREVIRTSNDVQDKLGVTCLGVIPMVKKRTLRKNGVSYTAYLDKDEKL
FSEACRSVRTSLLLRLTNTKQKILPFTSAIPEEGKTSTSINMAVSFSTMEKVLIIDCDLRRPSLAKRFNIPESQPGLTNI
LTMDTAIKDCIVRIDDANLDVLPAGLIPPNPQELLASNRFKKLLDHFQDKYDRIIIDTPPLLSVSDALILGQYANGLITV
IRSESTKASLVNVALSKQIQHSIPSLGVLITQAKAKEGETLYVQKYAY
© 1998-2019