BYKdb

Dataset for cluster tad of phylum proteobacteria

[Download (right click)] [Alignment] [Repertoires]

32 sequence(s)

>gnl|bykdb|A1ARV9 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Pelobacter propionicus] (length=499 residues).
MSDSEFDYKKYLELIVRKKELFVKLALLIMTIAIVTSYVLPKKYEASSTVFIEKNVISELVKGITVTPSMEDTIKVLTYA
ITSRTLLSKAAENLDMNVTRKGGADMEALYLTLQKNTVVKVKDKNLFTISYTDKNPQMARDFVNTLVRLYIEENTSSKRG
ESYDATKFLGEQIDTFREKLEKAEKELNDYKRDKGGVIAVDEAKLFEEINVSQQKLYDLELRRRQLEGMRRVTRKSGDPL
QARLSALQRRLDELRVQYTDSYPEVLQIKGDMETIRAQLKTRGTTFQPLDPQELEKIDSEVAAIRASESSLRRYISTNQS
LLRSLPSAKADLERLETAKNNQKNIYDQLFARHGQSEVSKQMEVQDKSTTFRIVDPALLPQKPVSPNRLRIMLLGFIGGL
AGSFGLLFLLDQMDGTVKDVDFLKQFGVPVLAVISRIRIQRDIELQRRRTKRLCLYAGAYFLFLLCFPLSELIGLTFMDT
LVDALRPANLVQNVKDQVR
>gnl|bykdb|A3K8W6 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Sagittula stellata E-37] (length=442 residues).
MSQFQSVGEVFAALRRRAWVILGIFLVGCVISVDYALMQQKVYEATAVVQIEDARVTSTATGTAADANEASRRLQLIEQR
LMSRDNLVSLMDKYDLFAEDPALNDGERIYMMRQAARITPITRPGPTFSAAAQAPSGLMISVMLPDPEKAAVVANDLMTK
VIAESRDRSAEQASETLAFYQTEEARVDAEIVALEDRIADYKKANSAQLPAGVAALRTELTTLRETELDLSQEIITIQGD
TARKRPEDLARQVAQLEDQRALVAARATEIEGQIASAPEVERQLGQLEREMDRLKDQYSVITRGKAEAEMGQALQDRQAA
GRYEVLETALVPDDPVTSSRKKIAGMGAVASLIAGLIVALVFEIMNPAIRTQKQMERVLGIQPVVVIPVISTRRDRTWGG
LKFLAKALGIVALVGGVAAWLTKISGLGALFGGGAPRRAVRG
>gnl|bykdb|A3W0H6 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Roseovarius sp. 217] (length=432 residues).
MSAIQSFPDLIRLLHRKLWLIVLVAVVGAILSIIVALNQPKVFQATAVIQIETPQVGSDLAGQTIATDANQRLQLIEQRL
MARDNLVKVIERHGLFANARDMPMAEKVHQLRISARITPITVGVPGMGPATTPSGLSVTVNLNDPVKAAEVANDFVETVI
AENRERRMALVRETFDFFSAEETRVSARIAEVEGVIADFKRANAESLPTSITPVREELRTLNETLLALDQQIITLETEAS
RQRQEVFARQIGQLTEQRALVAGRIAENEAALAAAPRVERELGALTRNLTQLQDQLSTITTSRVEAEMASVLESRQQQER
FEILETAIPPEFPVSASRKKLVIAGAVASLVAGIGFAVLLEIMNPAIRSAAQLEQELEITPVVTIPIVRLRHERRRRALK
IAGTVVMILLIVPILVRFAQERLMPLRMLSGN
>gnl|bykdb|A5G425 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Geobacter uraniireducens] (length=507 residues).
MSTTNELDYKKYLMLIDKKKKLFIITALAIMTVITIVSYFLPRKYEAKSTVFIEKSVISDLVKGIAITPSMDEKIKVLNY
AITSRTLLLKVIDDLDLNVNKQNDAQLEELVAKFQKNTVIKLKNDENFFIISFTNENPRLARDYVNTLVRRYIEENVSSK
REESYGATKFLSEQIEVYKEKMDKAEAEVNNFKIGKMGVIATDPATLQKEINDAQQKIDDMRLKRAQLESLRIQIKKNNP
LQQKMLSLQKKLDEMLVEYTESYPEVIRVKTELQAVKEQLRNRNTGFDMSPAETPDLDRVEAELKALKAAEANQYVIISS
TRSLLHNIPVAKATLEQLERDKNNQKNLYEQLVTRHGQSEVSKQMEVQDKATTFRIVDPAIMPINPVSPNRVNIILMGIG
AGLVIAFCLLMLLDYLDQSVKNVDALKSFGLPILAIIPKMQNPVELLLQKKKNVKLYVIASVYFSLILTVLLLEVLNSSL
SNTFIDSIEIKQYLPDLMSQIKYHGGN
>gnl|bykdb|B5EA80 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Geobacter bemidjiensis] (length=499 residues).
MQSPETEYKKYLQLLISNKERFVVIALLLMTVAFVVSFVLPRKYEASSTVFIEKNVISELVKGITVTPSMEDTINVLTYE
ITSRTLLTKVMDSLDLNLGKSDSETEELIKQLQLSTKVKVKDKNLFTISFTHTNPRIARDYVNTLVRLYIEGNISSKRGE
SYDATKFLSEQIDTFNAKLQKVESEVNAYKRDKGGVIAIDEGKLFQEINVAQQKLYDLELRRHQLEGMRQITRRTGDPLQ
SRLAGLQKRLDELLVEYTDSFPEVVKVKGDIETVKAQISERRGQPSQPLDPGELAKIESEISAIKITESGLRRYIDTNRA
LLQTIPSAKAGLEKLELEKKNQKNIYDQLFARHGQSEVSKQMEVQDKSTTFRVVDPALLPVKPSSPDRLKLMLLGMVGGV
AGSFALLFLVDHLNITVKEVEFVKGLGVPVLAVIPRLQDPEVEAKRRRRSRLILGCALVYFLVLMVFPGMELLGLPYMDK
VLDLLSGPEARLRIKGLLQ
>gnl|bykdb|B9M2X7 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Geobacter daltonii] (length=500 residues).
MPTTNDFDYKRYLNLVKQRKTLFLVTALAVMTITVIVSYVLPEKYEAKCTVFIEKALINELVRGFAVTPSMEDKIKGLNY
AMASRPLLQKVVSDLDLNLGKNGDTDTLISQFQKDTKVELRDKENLFTISYTGENPKRARDYVNTLVRRYIEENSSSIRA
ESYGASKFLSEQITVLKEKMDKAEAEVSRFRMEKGSVATADPAALEREISGAQQRIDEIAFRKAQLEASRNQLKKHNPAQ
MRLQTLEKKLEEMRVEYTDRYPEVMRLKSEIESVREQALASSGQARLGGAEMQELERIDAELRVLRSAESKQYANIASSR
AMLRNIPAARAELEQLERDKANQKQVYDQLVTRHGQSEFSKQMEVEDKGTTFRIVDPAVLPVKPISPNRIAIILGGIAGG
LAVAFGLVLLLDYYDESVKSLDGLKALGLPVLAVIPKMQIPAEIKLQKAHDVRLYAISACYFSLILIVLLLELLQIPLFS
SSLNSLQLKQYLSQAVGQFK
>gnl|bykdb|C0QCJ1 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Desulfobacterium autotrophicum] (length=548 residues).
MQQIQQNQLPITPAQIIDILIRRRWIIVIPLCITLTVGLYLALTSPRTYMAETSILVQAQTVPGNYVKSIVSSGISSRIS
TISQQIMSMSNLEKIIDQFGLFEEEGAKDMYLEDKIEAMRKRIKVTLSSARSGADAFTISYKGSDPDKVMRITNTLTSFF
MDENLKLREAQAIGTSEFLDAELEKTRKKLVDREEQLSSYRAKNMGGLPDELDSNLRTLDRLQLQLTDKQAMLRDAKNAI
NTLSAQIAQASKMGSQGMDDQFDFSDFGEEVGMGGEDEATLAEAEKRLDAMLLRYTRQHPDVRRLEAVIEKLRAKIEAAQ
AQEAAETLEPLETENLDVVEPGMNFAVMQQKTQLAQMNREIQALNAEIKSIQEKMVVYQKRVEDTPKKEQDLLSLKRDYA
NIQSVFNSLLDRKLEAELSVNMEKKQKGEQFRILDHARIPEKPISPDVRKMLVFSLAAGLGVAGGIIFLLEVLDFSIRRD
EDIEKLGLLVLASIPPLKNPGDRLKKRLEMIFLSLAATYALVMLAAFIVLNDKGLDRVVNFIKSFING
>gnl|bykdb|C6DZX6 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Geobacter sp.] (length=499 residues).
MQSPETEYKKYLQLLFSNKERFVVIALLLMTVAFVVSFVLPRKYQATSTVFIEKNVISELVKGITVTPSMEDTINVLTYE
ITSRTLLAKVVDNLDLDLGKNDSETEELIKQLQLNTKVKVKDKNLFTISFTHTNPSIARDYVNTLVRLYIEGNISSKRGE
SYDATKFLSEQIDTFNEKLQKAENEVNAYKRDKGGIIAIDEGKLFEEINIAQQKLYDLELRRRQLEGMRQITKRTGDPLQ
NRLAGLQKRLDELLVEYTENFPEVVKVKGDIETVKAQLSARRGQQSQSLDPAELAKIESEISAIKITESGLRRYIDTNRS
LLQTIPSAKAGLEKLELEKKNQKNIYDQLFARHGQSEVSKQMEVQDKSTTFRIVDPALLPVKPSSPDRLKLMLLGMVGGV
AGSFALLFLIDQMNNTVKEVEFVKGLGVPVLAVIPRLQDPEVEAKRRRRSRLILGGALMYFLVLMVFPGMELLGLPYMDK
VLDLLSGPEARLRIKGLLQ
>gnl|bykdb|C7LPS4 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Desulfomicrobium baculatum] (length=489 residues).
MNHELYQQFERYARILLQRKRVVVVVALLVMTLGVITSYVLPRKYEAQSTVFIEQSVISELVKGIATTPSMEAKIKVLTV
AMLSRETLFKVMRILDKDVEFASDMDREAYIKDLRERISIRLDEKRGIFFISFQDSDPRYARDFVNTITQVYIESNTASK
RDESLEATRFLSEQIESFKKRLDAVEDEINQYRAEHGLQLATDETTIRFEIADAERKLEAIRARKLELETKLQLMPSGGG
RSAHLADMERQLATLLTAYTDQHPKVVRLQGQIRAVKSSPSGGMTGNSGAAAKTLVQAEIEAATLQEKAQLATIEEKTEL
LRRIPTLRTGLNELLRKKDNETLIYSQLVTRYGQSEVSKQMEMENKSMNFRVVDPAVMPDTTVSPKRVPIMLLSALAGIG
IGMAVIMVPYLMRGSVESLADLRSLNQRVLAVLPAISKPKEERQRVRGDRIFMSGAALYFLMLVTIGVMEALGNSPLDVL
FERALGPWL
>gnl|bykdb|D0D9W1 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Citreicella sp. SE45] (length=441 residues).
MNQFQSVGELWAALRRRAALIALVALIGCAISLWVAFNQTKVYETTAVVQIEEGQVPDSLAGPSAQGQDASRRVRLIEQR
LMSRDNLLRFMEEHQLFTADPTMTLNERVFQMRKAVQIEEIRAAGNSYQPMRDAPSGLLITVTLDDPQKAADLANELMET
VIRQSRDRSVDRARDTLAFFEEEAARVEASIEAQELRIAGFKQDNAAALPNGLTALREQLTTLQDNELELDREIVAMEGS
PTRQREEVQARQVALLKEQKVLVQNRIAQIEETIRNAPEVERALSGLERELTQLQEQYNVITRRKADAEMGQMLEDRQQM
ERFEVLETALVPEVPASSSRKNLAAMGAVASLIAGLVAGFVAELANPAIRSAAQMERALGIQPVVAIPPIRTSRDRRGKG
LRRLGLFALLAAALWAGLHFFGSLVPWQGLFGKWLPRAAQG
>gnl|bykdb|E7T802 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Shigella flexneri CDC 796-83] (length=186 residues).
MTTKNMNTPPGSTQENEIDLLRLVGELWDHRKFIISVTALFTLIAVAYSLLSTPIYQADTLVQVEQKQGNAILSGLSDMI
PNSSPESAPEIQLLQSRMILGKTIAELNLHDIVEQKYFPIVGRGWARLTKEKPGELAISWMHIPQLNGQDQQLTLTVGEN
GHYTLEGEEFTVNGMVGQRLEKMALR
>gnl|bykdb|E8WSZ4 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Geobacter sp.] (length=496 residues).
MQESEYKKYTQLIARRKEFFVVAALLIMTLVFLVSYLLPRKYESSSTVFIEKNVISELVKGLAVTPSMDDTISVLTYAIT
SRTLLNKVVESLDMNLGKDGNEELIRDLQKNLTVKVKEKNNLFTISFVHTDPRIARDLVNTLVRLYVEQSTSSKRGESYD
ATKFLSEQIQAFNRKLQSAEAEVNAYKRSKGGVISIDEGKLFEEINTAQQKLYDLELRRRQLEGMRLVTRKANDPLQAKL
ASLQKRLDDLRVQYTDSYPEVLTVKGDIETVKEQMKLRKGAASQPLDPQELARIDSEIAALRITEDGLRRHVATNRQLLQ
SIPDAKAGLAKLEVERENQKKIYDELYSRHGQSEVSKQMEVQDKSTTFRIVDPAMLPTRPASPNRLLIMLLGIFGGAAGS
LFLLVLRDQMDTTAKEVDFVKSLGGPVLAVVPRMQIPEEVARLHRKSLGVFALSAFYFLLLLVFPTMELMGLPYMDQVLD
RVSSSGITQGVKGILH
>gnl|bykdb|E9TE87 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Escherichia coli MS 117-3] (length=520 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQNSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDNK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHARPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEEEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGVKRYKQSQLLAVGIQPIWRLKPSAVCVPVCTSR
>gnl|bykdb|F0G6H6 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Burkholderia sp. TJI49] (length=433 residues).
MSHLTMPESRGGPTARPPHPFRRYWGMLYGGRRTIVASALICVAAGALYALCARPVYRSDVLFQVEQSPTDTKPASPTGD
PSSMFDLKTDAATEIEVLKSRAVMARAVDTTKLYIEARPRYVPLIGWRLVNGADGLSSPLPGGYVYGTERIDVAAFDVPK
RLYDKSFALTVGRGGAYTLQRTGLFGRKGPVWQGRIGEPLHAETPDGNIDLLVRGIDGEPGARFDLTRHGEAETTAWLQK
NVLISERGKQSNIIGATLDGSDAAHISSILNAVGDAYLAQNTQRKSEAADKLIRFMDAQLPQLKAQLEAAEGRFNAYRAS
HGSVNTSDEALALRQQSVDIETRILTLQQQRQELLTRFMNKHPAVVAVDAQLADAQRSLAAVREQIQKLPAVEQGVLQLQ
RDVTVDTALYTNLLNARQQMMLARASKTGTVRI
>gnl|bykdb|F0JCB9 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Desulfovibrio desulfuricans ND132] (length=505 residues).
MTDNKLETPGAEASFDVMHYVQLVGNHRGLFVFIVLLAMFIAIVTSYVLPKKYEAKSIVFIEQNVISDLVKGIAVTPSMD
TKIKAIKVTMLSRNMLSKVINALDLDVDLKNEISLDSTIKSLRGRIKIGLDEKRGVFDIRFADTDPVLARDVVNTLTRVY
IEDSVSNKRKESYEATRFLADQIEVFKKRIDEAKKEIEDYKVASGKVLTTNEYAVRREIEKGEDQIKDIDIRISTLESSR
TMLLSNSPSRSRLRQQEQLLDDMLARYTENHPRVRQLENAIAETKRQIAHNSEEELSLIYSSPEYQHLKVQIRALNTQKA
NIEEEMASNKALLDQIPRAQAELQELKRKEKNEVIIYEKLVSRYGQSEVSKEMELQDKAVSFRVLDPAVIPTIPSSPNRP
LIMLAGMAIGVAFGLGVIFLMDLIDPSIKNVDDLREFGIPVLAVIPKLKNVEEERKTSRRNLRIYVIVAVGLMIFLAFLG
SEFLGLGLVDKLIAKGALVVQQWRM
>gnl|bykdb|F3CAY8 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Pseudomonas savastanoi pv. glycinea str. race 4] (length=88 residues).
MTVMNRPSLDFHQDSRIDLAAVLRMLFDHKALILWTVSLFFLIGLGYAILATPVYQATAMIQIEPRKIGIEGTPEVRRQA
IVSVAGDH
>gnl|bykdb|F4SM98 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Escherichia coli H736] (length=177 residues).
MPLIKNKKLDKDADEIDLGRIIGELIDHRKLIIAVTALFTFISLLYALFATPIYQADALLQVEQKQGNAILNSLSQMLPD
SQPQSAPEIALLQSRMILGKTVDDLNLQAIAEKNYFPIFGRGWARLIGHKPENLTITRLYLPSSDKELPELNLTVKDKLH
YTVEYNGKKLTELLVFY
>gnl|bykdb|G5LQM7 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Salmonella enterica subsp. enterica serovar Alachua str. R6-377] (length=204 residues).
MTEKVKQSAAATGSDEIDIGRLVGTVIEARWWVLGTTAIFALCAVIYTFFATPIYSADALVQIEQNAGNSLVQDINSALA
NKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVTKNTFPLFGAGWERLMGRHNERVKVTTFTRPETMSGQIFTLKVLGDKR
YQLVSDGGFSAQGVVGQPLNKDGVTMRVEAIDARPDTEFTVSKK
>gnl|bykdb|G5Q4J1 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Salmonella enterica subsp. enterica serovar Montevideo str. S5-403] (length=211 residues).
MTEKVKQSAAVTGSDEIDIGRLVGTVIEARWWVLGTTAIFALCAVIYTFFATPIYSADALVQIEQNAGNSLVQDINSALA
NKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVTKNTFPLFGAGWERLMGRHNERVKVTTFTRPETMSGQIFTLKVLGDKR
YQLVSDGGFSAQGVVGQPLNKDGVTMQVEAIDARPDTEFTVSKPVLIQNLR
>gnl|bykdb|G5SDT9 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Salmonella enterica subsp. enterica serovar Wandsworth str. A4-580] (length=214 residues).
MTEKAKQSAAVTGSDEIDIGRLVGTVIEARWWVLGTTAIFALCAVIYTFFATPIYSADALVQIEQNAGNSLVQDINSALA
NKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVTKNTFPLFGAGWERLMGRHNEMVKVTTFTRPETMSGQIFTLKVLGDKR
YQLVSDGGFSAQGVVGQPLNKDGVTMRVEAIDARPDTEFTVSTVSKFSTLGILR
>gnl|bykdb|G7EJX5 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Pseudoalteromonas sp. BSi20652] (length=118 residues).
MNQTNQNLKSDDEVIELGIYINVIKRAKWRILSFAIVVTLLAIMVTLTLVPKYTATATLLIEAEQTKAVSFEEVYGLDSN
KKEYYLTQFEVMKSDSIAREVITKLNLKTTPILLQSPQ
>gnl|bykdb|G7QCG0 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Desulfovibrio sp. FW1012B] (length=500 residues).
MSAFLKEFHHYKQLIYLYKELFLAVSLLIMTGAIAVGYLSPKKYEAKSTIFIEQNVITDLVKGIAISPSMQQKIQNLAVS
LTSRNLLLPVIKQLDKDITLKTAYDQEVYIKDLQRRIMVNLNERQGLIVLNFSDKDPRFARDFINTMARVYIERNTSTKR
EESTEATKFLAEQIETFKKRVDAADEAINAFRSERGMLLSSDGAFIRSEIKAAEQKLEELSLRRAQLEAQRKMLASGKGP
AKASRASSGGNPREAELRRLLAVYTEKNPKVIKARAAAKAWRPSGGGGGESAGEGVAEGTRNAQILQYQLDSIKAMEDYQ
NKIIGENKGALRDLPRVKATLAELVNKKDQEAAIYNQLVNRYGQSEISKEMELKDKSVMFRIVDPAVIPEVPVSPNRPVI
ILIGIVLGLGAGAGATYLADRFNHSIRSLHELRTLGLPVFAVIPRISSEKEIRRQARRDHLVMAVAGGYFALVVGVLVLE
TLRAQGVGTAWLQKIAHSIL
>gnl|bykdb|G8AU95 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Azospirillum brasilense Sp245] (length=387 residues).
MNSSIGKGGTLPGHEAHASVLPDSLLQSGAAESSDVRSRQEATVFATLAVLWRRKLLLLTIILLGTATITYVMQSLKPMY
RATAMVQLDSRRVELAEFKSVVSNLTPEAPAVRSEVSIVGSRALAERVVEKLGLLNDPEFNPSLKAPDGTDDHWLKRVTK
AGVGALPPEGNDVLRQIVQQATALFRADDGPVARDPNQARLLTIDTLLRRIEARNDDRSFTIIIEASSVDPAKAAAIANA
FGQAYLDYRTEMNRDMTERVNQWLGGRLIEAREAVRGAEEAIRSFRKENSLLELPPDGRNMVQQQMNELATQLTAAQAQK
AAAEARVRQARDQTAANNAAAIPEVLASPLIQKLREAEAMLERRLAELQQGLWRQASGHRESSPRRR
>gnl|bykdb|H8YYB8 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Thiorhodovibrio sp. 970] (length=592 residues).
MEEQLLSLDDYIAILKRRKWQLIIPAVLLSIVGMITAVVLPPTYRSTATILIEQQEIPDELVRSTVTSYAAQRVQTISQR
VMTTENLGKIIESYQLYPELMQRYGLVSAVEQMREDIELEMISADVIDPRSGRPSEATIAFSLSFESESPTVAQRVANDI
TSLFLSENLKDRQESAKETTAFLQKELAKLTDKLSLLEARLAQFKEEHGQSLPELKSLNMQLIQRSEDQLRDTEQSIRTL
VERKIYLEGQLAQIDPYSELFSADGRRVLGPADRLKALEAEYATVAARYSSQHPERMRIEREIATLRQQVGQSANARAEL
ERSLKEQQEELAGLRERYSTEHPDVKAQTGAIAITQRQLAQARQGGSANSPGVIDADNPAYIQLQAQLQAAVVELASLQE
SREEIRSKLADLEERIAKGPRIELEYQALTRDHENAMSSYSEVKQRLVAAELGEAMEAERKGERFSLIEPPRLPEQPAKP
NRLAIAFLGLVLAFGGGVGNLALQEALDKSVHNARDVELITMGPPLAVIPFIETEADVHRRTRRRLIAVLGSILGVVLAT
AAVHQFVMPLDVLWIKVLDRAGLLHTETPNPS
>gnl|bykdb|I1AYC4 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Citreicella sp. 357] (length=438 residues).
MNQFQSVGEVLAALRRRVLLMIAVILLGSALSLYIATQQVKTYETTAVVQIEESQVPDTLAGSAAQSQDAARRVQLIEQR
LMSRDNLVRIMQEHQLFSDDPDMSLNERVFHMREAVRIDEIRSNPDAYAATQEAPSGLLISVTLGDPQKAADLANELMNT
VIEQSRDRSVSRARETLDFFESEEARVEAEIQAKEAEVARFKQDNGDALPAGLGSLRDQLTTLRDNALTLDREIVALEAN
SSRQREEVLGRQIGLLREQKTLVENRIIAINETIQRAPEVERALSGLERELTRLQEQYNVITRRKAEAEMGQMLQDRQHM
ARFEVLETALVPEFAASGSRKKVLAMGVVASVIAGLAATFIAELMNPAIRSAAQMERALGVQPVVSIPTIRTRGERRITG
MRLFSLLGLLFAAMWAALSSVTDWSALLGRFLPRAVRP
>gnl|bykdb|I2Q342 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Desulfovibrio sp. U5L] (length=507 residues).
MSAFLKEFHHYKRLIYLYKELFLAVSLLIMTGAIAVAYLSPKKYEAKSTIFIEQNVITDLVKGIAISPSMQQKIQNLAVS
LTSRNLLLPVIKQLDRDITLKTAYDQEVYIKDLQRRIMVNLNERQGLIVLNFSDKDPRFARDFINTMARVYIERNTSTKR
EESTEATKFLADQIETFKKRVDTADEAINAFRSERGMILSSDGAFIRSEIKAAEQKLEELSLRRAQLEAQRKMLVSGKGP
ARGPAKAGRASSGGNPREAELRRLLALYTEKNPKVIKARAALRAWRPSGGGGGGGGESAGEGVAEGTRTVQILQYQLDSI
KAMEDYQTKVIGENKGALRELPRVKATLAELVNKKDQEAAIYNQLVNRYGQSEISKEMELKDKSVMFRIVDPAVIPEVPV
SPNRPVIILIGIVLGLGAGAGATYLAERFNHSIRSLNELRTLGLPVFAVIPRISSEKEVRRQARRDHFVMAVAGGYFALV
VGVLVLETLRAQGVGTAWLQKIAHSIL
>gnl|bykdb|I5B297 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Desulfobacter postgatei 2ac9] (length=542 residues).
MADPFQSQTQIKPDYIIDVLIRGRWFLIVPLCISLTLGLGMTLTANKTYEAGTMILVQPQRVPINYIKSVVSSSIGERIS
TISQQVLSRSNLEQIIEQFGLYENSSGMYQEEKIEALRKRIKVKIEHSRGGSEAFSISFTGSEPQRVMRIANTLASYFMD
ENLKVREAQAIGTSEFLDSELEKTKKRLEEKEQKLAAFRAKYLGGLPDELESNLRTLDRMQKQVTDKAMLLREVNNSISQ
LDSQISSMAATGGSGSGGDDFLSFDFDDSQEGDDSALQAAQEKYDALLLRYTEKHPDVKKLKRIIEKLKQNLEAAKEEEE
LPSAESEEDILPDMGMDPVAPLKAQRAQLVAEANNIQAEVSAIQEKMKIYAQRVEDTPKRELELQSLTRDYSNIQNVYNS
ILDRKLEAELSVNMEKKQKGEQFRILDHARLPEKPISPNVKLMFLLSIAGGLGLGGGILFLKELLTFSVIRRDDQIDTLL
GLPILASIPPLEKPNGRTKKKIEWAMFICCCSYSAVFLAFFAILNHKGLDRTMNFIKTTLNL
>gnl|bykdb|Q0FMP1 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Pelagibaca bermudensis] (length=441 residues).
MNQFQSIGEVLSALKRRALLILLVTVLGSAASVWLALNQIKVYEATAVVQIEEGQMPDSLAGASAQNQDGSRRVRLIEQR
LMSRDNLLALMEEHGLFDGDTGMSVGQRLFRMREAVSIQEIRTNSNSFAAQQEMPSGLRISVVLPDPQKAADVANEMMYQ
VINQSRDRSLSSARDTLAFFESEEARVETEIEAMEAKIATFKRENAEALPSGTGALRSQLTTLEDSQLALARDIVEMEGN
STRQREEVLARQLGLMREQQSLIEQRISEIEETLLQAPEVERELSALERDLERLKDQYSVITRRKADAEMGQMLEDRQQT
DRFEVLETALVPEFSASSGRKKIVLAGVVASVLAGVVIAFVAELLNPAIRSAAQMERVLGLQPVVSIPVVEARRDRRSRQ
LRSVTAVGLLAALMLGLYRLFTDILPWQGLLDRFLPRMARS
>gnl|bykdb|Q314L4 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Desulfovibrio alaskensis] (length=502 residues).
MNTMLDDVEAGGGLDILRYIRLLWEHALAFWLMAAVVMLAALGFAYSLPKIYQAKSTVAIEQNVINDLVRGIAITPSMGA
KIRILNVSLLSRSSLLSVMKELDMDLGLSGPALEERITSVRRKVSVGLDEKRGLFFISYESSNPVLARDFVNTLTRHYIE
QSTSDKREESFEATRFLADQIEVFRKRIEAVQAEIDSFKASRGQILNMSEPALRREIQMAQEELQALRIRKTDLLAQRGV
MLRNTPLRNRLETLEAQLAAMLVSYTEKHPAVIRTKQEIEGLRREVARKGEEERKIIYGTSEYQRIKVELTAVEQQEAQL
VSKIADNERLLREIPSVATELADLENRKRKESLIYEQLVGRYGQSEVSKQMELQDKAVSFRIIDPAVLPSVPVSPKRWLI
LLAGMAAGLGGAFGVLFLFDLLNPRVRSVEDLRRLGFHVMAVVPSISDVAEERRIFRRRAAVTACGVLLCGGVVAVAAAE
FLQLRFMENFIAGAVFTVKSWF
>gnl|bykdb|Q39U16 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Geobacter metallireducens] (length=518 residues).
MVSKTEELNKYLKMLMKRRYLFIVVSLVVMSVIAWGSFFLPKKYEASSTVFIEKSVIKDLVKGITFTPSVEDKVRILRYA
MLSRTFVTNVLKSLDADTKVKNDKEMEGLVEDFQKRTQISIKGNDLFIVSIRDKDPKLATDYVNTLVRKYVEENVSSKRQ
DSFGADRFISEQLKTFKDKLDESENKIVAFRQKRGVSVGIDEALLVNDIRQYQGELDSMRIKRNELTATRDALRRQLKSI
KPTTVALSSRENSSEVEMLERRLKQLSANYTDNYPEVIRIKSIIASLKKKQEPGHQADTGAKEEFSTANPVYQNLEQQLY
QVEAELEAVNAKQRQLHATIGGKEHELRNVPADQKTLTDLIKERDANRQLYEQLLTRQGQAQLTKEMEVEDKATTFRVVD
PAIVPMKPVSPDRVKMIIMGIIMGFVAGAASVFVMEMFDSSVKDVTSLKKLGFEVLAVIPTIFNQEEASKVAKKDRKIYL
VAGCYFALICLMLTHELLGLTLIEKVLTKLGLDQFIMS
>gnl|bykdb|Q74BQ7 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Geobacter sulfurreducens] (length=490 residues).
MQQSEFDYRHYLTLIVARKRLFVVVALAVMAAAVVYSYVLPKKYEARSTVFIEKNVISELVKGIAVTPSMEQAIKGLSEA
ITSRTLVTKVINDLDLDVTTKSNAEIEARVRAIQQNITIKLKGDNIFTISYVDKDPRVARDFVNTLVRRYVEENISSKRE
ESYGAIKFLSEQIDTFRGKLEEAEGELNRYKTEKGGVIAIDEAKLFEEINVAQQKLYDIQLRRRHLEGLRPVTRKAGDPL
QVKLVALQKQLEELRVSYTDSYPEVLRVRGEIETLKEQMKNRSPQQETVVDPQEYEKAEAELQALKVSEDGLKRYIATNQ
ALLRNIPSAKAGLEKLELEKKNRKDLYDQLMARHGQSEVSKQMEVQDKTTTFRIVDPAVTPSSPISPNRVKIMLMGIVAG
LGCALGLIVLLDRLNNSVHSVDALKETRIPVLAVIPKIRTIEAVARERSENIRVFAAAGACFMVILAFLVMELLNISPVD
RIISRLHGML
>gnl|bykdb|S9QRP2 [Bacteria] Adaptator of bacterial tyrosine kinase [Proteobacteria][Salipiger mucosus DSM 16094] (length=442 residues).
MTQFQSIESVFAALRRRAWIIILVTVVGCALSVWVALNQDKAYEATAVVQIEEARVPERLTGGAAQNADAARRVRLIEQR
LMSRDNLMRIMEEHDLFTDAPEMTMNERVYQMRMAARIEEIRSNSGSFQASQEVPSGLTITVRLGDPQKAADVANELMTT
VIEQSRSRSASSARDTLEFFEKEEARIGAEISEQESRLADFKRANAEALPGGITSLRSQLVTLEENELELDREIVALRTN
SARQREDVLDRQVALLQEQKALIAQRSETIRDTLRRAPDVERELNEMERQLGSLQEQYSVITRRKAEAEMGSMLEDREQT
DRFEVLETALVPEVPASQSRRKLAMAGGVASLLAGLGIAFLAELMNPAIRSAAQMERSLGIQPVIAVPVIRSRGHHRRRG
LGLLALVALLAGAVWAGLRFVGDLGPLQGLLERILPRSVQSS
© 1998-2019