BYKdb

Dataset for cluster tadcd of phylum proteobacteria

[Download (right click)] [Alignment] [Repertoires]

8156 sequence(s)

>gnl|bykdb|A0A009E7X8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter baumannii 348935] (length=671 residues).
DNKGASAALLGDLSNMIEQKSPAQAEIEILKSRLVLGSVINQLNLDLVISGTEDSIWNRLLKNHNYDIKYSTKSVLFKDN
QQSFDVRQFDIPNYYKNKNLLLSFDHNKYNLTDAETNDIIFTAPLNQTSQIQSRYGLWKVAIYSKDLLDSTYNIQKLTLP
AAVQRVLNDYSVAEKGKMTGVLGLNYQGQDKQHITQVLNAILTAYSQQNIERRSAESAQTLKFLDEQLPELSQQLDQVER
EFNQFRQQYNTVDLTKESELYLTQSIALETQKAELELKVAEASARYTEEHPVMEQMNAQLGAINSKIAALSNTLKQLPDL
QRRYLQLYREVEVKQQLYTGLLNTYQQLRIAKAGEIGNVRIVDTAVEPIEPIKPKKLQIIILSIFLGGFLGTLLALLRNM
MRSGIKDSAQIERELDLPVYATVPRSPLQESRVNLLKKKKSIPILAVKDSSDIAIESLRSMRTAIHFALSNAKNNIIALS
GPAPEIGKSFITTNLATILAQSGSRVLVIDGDLRRGYLNKYFNKEVQPGLSELLNHQNSYEDVVQNSQVNNLFFVTRGKS
PVNPSELLSTDKFKVFLDQASASFDYVLIDTPPVLAVTDGIIIAQYAGVNLLIARHGKTQIKELEITVTRFEQANVKVNG
VILNDVQKGPGNGYGYGYNYAYAYKTSKDGD
>gnl|bykdb|A0A009G8E9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter baumannii 118362] (length=728 residues).
MSQTSKTEDTIDLKELFFSLIAQWKLIVLCILISLVCALIYLRVTPNTYSVDALVQVEDTKSAASAALLGELSKMVDQKS
PAQAEIEVLTSRMVLGQVINNLNLDITIKNHDDTFFNRLLSQDKQNIDYKKDAVTFSNKDSYFSIQQLQIPSYYLDKPLL
LSFKDQRHFTFSYKDKVIFSGQLNSNNLVTAREGQWKVRINSTHAPSVEQQFTISKLALPTAVQKLGSTYGVAERGKQTG
VISLNYQGTDKEHITEVLNNILAVYHSQNIERRTLESKQTLDFLDKQLPDLKQQLEESERKFNQFREKYNTVDVTQEAEL
YLKQNIALETTKTELKQKQAELAAKYTNDHPLMAEINAQLAAVNKKSAELSDTLKRLPEVQRQYLQLYRDVKVNTELYTS
LLNSYQQLKIAKAGEIGNVRIIDTAVEPVNPIKPKTLIVLVLTIFIGGFIGILIALLRNMLRTGVKDSTQIENDLNLPVY
ATVPRSPIQETRMNILKKKKSIPILAVKSSDDIAIESLRSIRTAIHFALTTAKNNIIMIAGPSPEVGKSFISTNLATIFA
QSNKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQADLSQVLHKTQVANLDVITRGKSPTNPSEMLSSTQFKDLLEKF
QTQYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSHMKELELTINRFEQAGVKVNGFILNDIQRSSGGGYGYNYAY
AYKAQKED
>gnl|bykdb|A0A009GB14 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter sp. 1289694] (length=728 residues).
MNQQNTNTEDTIDLKELFFSLIAQWKLIALCVILSVVFALLYLRVTPDTYSVDALVQVEDSKGASAALLGDLSQMIEQKS
PALAEIEILKSRLVLGSVIKELHLNIQISSTENTLTHRLLSDTEYKTEYTKKSVLFQDDLKSFEVREFEVPNYYLDKNLL
LNFDKQSLRLTDPTTKEVILTLPLNKVSQVVGPHGRWKIAIFTKHQLDATYNITNLSLPAAVNSLSVNYSVAERGKLTGV
LGLNYQGQDKEHITKVLNAILATYSAQNIERRSAESAQTLKFLDEQLPDLKKQLDDAERQFNKFRQQYNTVDVTKESELY
LTQSITLETKKAELEQKQAEMAAKYTAEHPAMREINGQLAAINKQIGELNSTLKQLPDVQRQYLQLYREVEVKTQLYTAL
LNSYQQLRIAKAGEIGNVRIVDTAVEPVKPIKPRKLLVLILSLFVGGFIGTLVALLRNMLRTGIKDSGQIENELDLPVYA
TVPRSPIQESRIKILKKKKSIPILAVKNSDDIAIESLRSIRTAIHFALANAKNNIIMIAGPSPEVGKSFISTNLATIFAQ
SDKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQTDLQKVLHKTQVANLDVITRGKSPTNPSEILSSNQFKELLEQLQ
SQYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSQMKELELTLNRFEQAGVKVNGFILNDIQRASAGYGYGYNYAY
AYKAQKED
>gnl|bykdb|A0A009HB13 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter sp. 1295259] (length=727 residues).
MNQNTNTEDTIDLKELFFSLIAQWKLIALCIILSLVCALLYLRVTPDTYSVDALVQVEDSKGASAALLGDLSQMIEQKSP
AQAEIEILKSRLVLGSVIKDLHLNIQISSTENTLTHRLLSDTDYKTEYTKKSVLFKDDLKSFEIREFEVPAYYLDKNLLL
NFDKQSVRLTDPETEKVLLTVPLNQVNHVAGPHGLWKVAIFTKDQFEVTYNIKNQSIPVAVDAISGNYSVAERGKLTGVL
GLNYQGQDKEHITKVLNAILATYSAQNIERRSAESAQTLKFLDEQLPDLKKQLDDAERQFNKFRQQYNTVDVTKESELYL
TQSITLETKKAELEQKQAEMVAKYTAEHPAMREINGQLAAINKQIGDLNSTLKQLPDVQRQYLQLYREVEVKTQLYTALL
NSYQQLRIAKAGEIGNVRIVDTAIEPVKPVKPKKLLVLILAIFAGGFIGTLIALLRNMLRTGIKDSGQIENELDLPVYAT
VPRSPIQETRMNILKKKKSIPILAVKNSDDIAIESLRSIRTAIHFALTNAKNNIIMIAGPSPEVGKSFISTNLATIFAQG
NKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQADFQQVLHKTQVANLDVITRGKSPTNPSEILSSNQFKELLEQLQS
QYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSQMKELELTLNRFEQAGVKVNGFILNDIQRTSAGYGYGYNYAYA
YKAQKED
>gnl|bykdb|A0A009IND2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter baumannii 1295743] (length=728 residues).
MNQQNTNTEDTIDLKELFFSLIAQWKLIALCVILSVVCALLYLRVTPDTYSVDALVQVEDSKGASAALLGDLSQMIEQKS
PAQAEIEILKSRLVLGSVIKDLHLDIQVSSTENTFTHRLLSDTDYKTEYAKKSVLFKDGLKSFDIRQFEIPAYYLDKNLL
LDFDKQSLRLTDPDTEEVILTVPLNQANSVTGPYGVWKVAIFTNDQFESTYNIKKLSLPLAIKSISSDYSVEEKGKLTGI
LGLSYQGQDQEHITKVLNAILATYSAQNIERRSAESAQTLKFLDEQLPDLKKQLDDAERQFNKFRQQYNTVDVTKESELY
LTQSITLETKKAELEQKQAEMAAKYTAEHPAMREINGQLAAINKQIGELNSTLKQLPDVQRQYLQLYREVEVKTQLYTAL
LNSYQQLRIAKAGEIGNVRIVDTAIEPVQPIKPKKLLVLILSVFVGGFIGTLIALLRNMLRTGIKDSGQIENELDLPVYA
TVPRSPIQESRIKILKKKKSIPILAVKNSDDIAIESLRSIRTAIHFALANAKNNIIMIAGPSPEVGKSFISTNLATIFAQ
GNKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQADLQKVLHKTQVANLDVITRGKSPTNPSEILSSNQFKELLEQLQ
SQYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSQMKELELTVNRFEQAGVKVNGFILNDIQRASAGYGYGYNYAY
AYKAQKED
>gnl|bykdb|A0A009KVQ5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter baumannii 1419130] (length=728 residues).
MNQQNTNTEDTIDLKELFFSLIAQWKLIALCVILSVVCALLYLRVTPDTYSVDALVQVEDSKGASAALLGDLSNMIEQKS
PAQAEIEILQSRLVLGSVIKDLHLNIQVSSTENTLTHRLLSDTDYKTEYTKKSVLFKDDLKSFEVREFEVPAYYLDKNLL
LNFDKQSLRLTDPATEEVILTVPLNQANHVAGPHGLWKVAIFTKDQFDATYNIKSQSIPAAVNALSANYSVAERGKLTGV
LGLNYQGQDKDHITKVLNAILATYSAQNIERRSAESAQTLKFLDEQLPDLKKQLDDAERQFNKFRQQYNTVDVTKESELY
LTQSITLETKKAELEQKQAEMAAKYTAEHPAMREINGQLAAINKQIGELNSTLKQLPDVQRQYLQLYREVEVKTQLYTAL
LNSYQQLRIAKAGEIGNVRIVDTAIEPVQPIKPKKLLILILSVFVGGFIGALIALLRNMLRTGVKDSGQIENEMDLPVYA
TVPRSPIQESRIKILKKKKSIPILAVKNSDDIAIESLRSIRTAIHFALANAKNNIIMIAGPSPEVGKSFISTNLATIFAQ
SNKRVLLIDADMRRGYMHKYFDIDVKPGLSELLSGQADLQKVLHKTQVANLDVITRGKSPTNPSEILSSNQFKELLEQLQ
SQYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSQMKELELTVNRFEQAGVKVNGFILNDIQRASAGYGYGYNYAY
AYKAQKED
>gnl|bykdb|A0A009L0S4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter baumannii 146457] (length=727 residues).
MSQNTNTEDTIDLKELFFALIAQWKLIALCIILSLVLALLYLRATPNTYSVDALVQVEDSKGASAALLGDLSQMMEQKSP
AQSEIEILKSRLVLGSVIEALHLDLDITSPEDTFSHRLFKKTNYTTEYNPKAVTFHDEQKSFDIQQFDVPNYYLDKKLSL
SFKDQSFSLTDPVTGQVILTAPLNQLNQLSTQLGVWKIAIFTKDTFDTHYFVQKSSLPAAAQAIKSNYSVAEKGKLTGIL
GLNYQGQDKEHITKVLNAILAAYSAQNVERRSAETAQTLKFLDEQLPDLKKQLDDAEREFNKFRQQYNTVDVTKESELYL
TQSITLETKKIELQQQQADLAAKYTAEHPAMREINAQIAALDKQITELNNTLKQLPDIQRQYLQLYREVEVKTQLYTALL
NSYQQLRIAKAGEIGNVRIVDTAVEPVEPIKPKKLQILILSIFLGSFLGVVIAVLRNMLRTGVKDSAQIENEFDLPVYAT
VPRSPVQETRMSILKKKKSIPLLAVKHNDDIAVESLRSIRTAIHFALANAKNNIIMIAGPSPEVGKSFISTNLATIFAQS
NKKVLLIDADMRRGYMHKYFNLDVKPGLSEYLSNLAELSQVIHQTDVVGLSVIARGKNPANPSEMLSSEQFKALMEQLSQ
QYDHIIIDTPPILAVTDGIIISQYAGVNLLVARYAKSQMKELELSLNRFEQANVKVNGFILNDIQRSSAGYGYGYNYSYA
YKANKDD
>gnl|bykdb|A0A009NLI3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter sp. 1475718] (length=728 residues).
MNQQNTNTEDTIDLKELFFSLIAQWKLIALCVILSVVFALLYLRVTPDTYSVDALVQVEDSKGASAALLGDLSQMIEQKS
PALAEIEILKSRLVLGSVIKELHLNIQISSTENTLTHRLLSDTEYKTEYTKKSVLFQDDLKSFEVREFEVPNYYLDKNLL
LNFDKQSLRLTDPTTKEVILTLPLNKVSQVVGPHGRWKIAIFTKHQLDATYNITNLSLPAAVNSLSVNYSVAERGKLTGV
LGLNYQGQDKEHITKVLNAILATYSAQNIERRSAESAQTLKFLDEQLPDLKKQLDDAERQFNKFRQQYNTVDVTKESELY
LTQSITLETKKAELEQKQAEMAAKYTAEHPAMREINGQLAAINKQIGELNSTLKQLPDVQRQYLQLYREVEVKTQLYTAL
LNSYQQLRIAKAGEIGNVRIVDTAVEPVKPIKPRKLLVLILSLFVGGFIGTLVALLRNMLRTGIKDSGQIENELDLPVYA
TVPRSPIQESRIKILKKKKSIPILAVKNSDDIAIESLRSIRTAIHFALANAKNNIIMIAGPSPEVGKSFISTNLATIFAQ
SDKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQTDLQKVLHKTQVANLDVITRGKSPTNPSEILSSNQFKELLEQLQ
SQYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSQMKELELTLNRFEQAGVKVNGFILNDIQRASAGYGYGYNYAY
AYKAQKED
>gnl|bykdb|A0A009PG32 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter baumannii 625974] (length=731 residues).
MNQNSKTNEDSIDLKELFFSLIAQWKIIACCVILSLICALLYLRITTDTYSVDAMVQVEDSKGAASAALLGDLSKVTGGI
SQKSPADPEIEILKSRMVLGQVIHNLNLDIKIKDNQSGLIDKLISQDKSKIEYRHESVVYNNLNASLIIQEFKVPEYYFD
KPLKLEFKDTNQFTLMYKDQVVFNGQLNKKNILNSNKGLWQVQINAQGNLKDQSYTLTKLALLTAVNQFNSIYSVNEKGK
MTGVIGLSYLGQDPEHITQVLNNVLNVYHEQNIERKSLESKQTLAFLERQLPELRKQLEDSEIKFNQFREKYKTVDVNAE
SELLLKQNIDLEKLKIELQQKQAELSAKYTNDHPLIRQIDAQITDINKKIADLNNRLTQLPETQRLYLQLYRDVKVNTEL
YTSLLNSYQQLKIANAGEIGNVRIIDTAVEPVKPVKPKKLIVLILSIFVGGFIGVLIALLRNMMRSGVNDSTQIENELDL
PVYATVPRSPIQETRMSILKKKKSIPILAVKSSDDIAIESLRSIRTAIHFALTSAKNNIIMIAGPSPEVGKSFISTNLAT
IFAQSNKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQADLQKVLHKTQVTNLDVITRGKSPTNPSEMLSSTQFKDLL
EKFQTQYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSHMKELELTVNRFEQAGVKVNGFILNDIQRSSGGGYGYN
YAYAYKAQKED
>gnl|bykdb|A0A009R8B1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter sp. 809848] (length=728 residues).
MNQQNTNTEDTIDLKELFFSLIAQWKLIALCVILSVVFALLYLRVTPDTYSVDALVQVEDSKGASAALLGDLSQMIEQKS
PAQAEIEILKSRLVLGSVIKELHLNIQISSTEDTLTHRLLSDTEYKTEYTKKSVLFQDNLKSFEVREFEVPNYYLDKNLL
LNFDKQSLTLTDPETEEVILTVPLNQTNHVTGPHGLWKVAIFAKDQLDATYNITNLSLPAAVNSLSVNYSVAERGKLTGV
LGLNYQGQDKEHITKVLNAILATYSAQNIERRSAESAQTLKFLDEQLPDLKKQLDDAERQFNKFRQQYNTVDVTKESELY
LTQSITLETKKAELEQKQAEMAAKYTAEHPAMREINGQLAAINKQIGELNSTLKQLPDVQRQYLQLYREVEVKTQLYTAL
LNSYQQLRIAKAGEIGNVRIVDTAVEPVKPIKPRKLLVLILSLFVGGFIGTLVALLRNMLRTGIKDSGQIENELDLPVYA
TVPRSPIQESRIKILKKKKSIPILAVKNSDDIAIESLRSIRTAIHFALANAKNNIIMIAGPSPEVGKSFISTNLATIFAQ
SDKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQADLQKVLHKTQVANLDVITRGKSPTNPSEILSSNQFKELLEQLQ
SQYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSQMKELELTLNRFEQAGVKVNGFILNDIQRASAGYGYGYNYAY
AYKAQKED
>gnl|bykdb|A0A009RX04 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter baumannii 951631] (length=727 residues).
MNQNTNTEDTIDLKELFFSLIAQWKLIALCIILSLVCALLYLRVTPDTYSVDALVQVEDSKGASAALLGDLSDMIEQKSP
AQAEIEILKSRLVLGSVIKELHLDIHVSSTENTLTHRLLSDTEYKTEYTKNSVLFKDGTKNFDIRRFEVPAYYLDKQLVL
SFDQKSFKLVDPETDEVVLTAPINQNNQITGAYGVWKVAIFTKDQLDSKYNIKKLSIPAAVDNISSNYSVAERGKLTGIL
GLNYQGHDKEHITQVLNAILVTYGAQNVERRSAESAQTLKFLDEQLPDLKKQLDDAERQFNKFRQQYNTVDVTKESELYL
TQSITLETKKAELEQKQAEMAAKYTAEHPAMREINGQITAINKQIGELNSTLKQLPDVQRQYLQLYREVEVKTQLYTALL
NSYQQLRIAKAGEIGNVRIVDTAVEPVEPIKPKKLQVLILSLFLGGFIGTLIALLRNMLRTGIKDSGQIENELDLPVYAT
VPRSPIQESRIKILKKKKSIPILAVKNSDDIAIESLRSIRTAIHFALANAKNNIIMIAGPSPEVGKSFISTNLATIFAQG
NKRVLLIDADMRRGYIHKYFDVDVKPGLSELLSGQADFQQVLHKTQVANLDVITRGKSPTNPSEILSSAQFKDLLEKVQS
QYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSQMKELELTLNRFEQAGVKVNGFILNDIQRASAGYGYGYNYAYA
YKAQKED
>gnl|bykdb|A0A009TNH9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter baumannii 99063] (length=731 residues).
MNQNSKTSEDSIDLKELFFSLIAQWKIIACCVVLSLICALLYLRITPDTYSVDAMVQVEDSKGAASAALLGDLSKASGGL
SQKSPADPEIEILRSRMVLGQVIQNLNLDISIKDNQSSLIGKLVSQDQSKLEYRHDAVIYTNQNNNLIVKQLSVPEYYLD
KPLKLEFKDVNQFTLTYKDQVVFNGQLNKKNILNTNRGLWQVQLNAQGNLKEQSYTLTKLALPTAVKNFNDIYSVAEKGK
VTGVIGLNYLGQDPEHITQVLNNVLTVYHQQNIERKSLESKQTLAFLEKQLPELRKQLEDSEIKFNQFREKYKTVDVNAE
SELLLKQNIDLEKLKIELQQKQAELSAKYTNDHPLIRQIDAQITEINKKIADLNNRLTQLPETQRLYLQLYRDVKVNTEL
YTSLLNSYQQLKIANAGEIGNVRIIDTAVEPVKPIKPKKLIVLILSIFVGGFIGVLIALLRNMMRSGVNDSTQIENELDL
PVYATVPRSPIQETRMNILKKKKSIPILAVKSSDDIAIESLRSIRTAIHFALTSAKNNIIMIAGPSPEVGKSFISTNLAT
IFAQGNKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQADLTQVLHKTQVANLDVITRGKSPTNPSEMLSSTQFKDLL
EKFQTQYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSHMKELELTVNRFEQAGVKVNGFILNDIQRSSGGGYGYN
YAYAYKAQKED
>gnl|bykdb|A0A009ZA70 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter sp. 479375] (length=730 residues).
MSQNSTTTEDTIDLKELFFSLIAQWKIIALCIILSLICALLYLRVTPDVYSVDAMVQVEDSKSAASAALLGELSSVAGAV
GGQKSPADAEREILNSRLVLGQVIQNLHLDIQIKDTQDTLFNRLVSESKRKLDYSQSGVLFKENGQSFFVETFEVPYYFL
DKPLTLQFKQNQFSLSYKDSIVAEGHLNQDNLLTTNKGQWKIRINSTTPFKHEFKITKFALPTAVKNLTENYSVAEKGKM
TGVLGLTYQGQDQEEITQVLNNILVVYHAQNIERKSLESKQTLSFLDKQLPELRKQLEDSEKKFNQFREQHNTVDVTQES
ELLLKQNIQLETMRIELQQKQAELAAKYTPDHPLMAEINAQVATVNKKLGELNGTLKRLPELQRLYLQLYRDVKVNTELY
TNLLNSYQQLKISEAGEIGNVRIIDNAVEPIKPIKPKKLIVLILSIFVGGFIGVLIALTRNMLRTGIKDSAQIENELELP
VYATVPRSPVQENRLAVLKKKKNIPILAVKHSDDVAIESLRSIRTAIHFALSGAKNNIIMISGPAPEVGKSFISTNLATI
FAQGDKKVLLIDADLRRGYLHKYFNLETQPGLTELLTDQASLTQIMHSTEVPNLSFISRGKSPSNPSELLSSQKFQTLLQ
ELSQHYDHIILDTPPVLAVTDGIIISQYTGVNLIVARHAKTQMKELELTLNRFEQAGTKVNGFILNDIQRSASGSYGYNY
AYAYKAAKDD
>gnl|bykdb|A0A010IN47 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter sp. 1542444] (length=727 residues).
MNQNTNTEDTIDLKELFFSLIAQWKLIALCIILSLVCALLYLRVTPDTYSVDALVQVEDSKGASAALLGDLSQMVEQKSP
AQAEIEILKSRLVLGSVIKDLHLNIQVSSTENTLTHRLLSDTEYKTEYTKKSVLFKDGLKNFEIRQFEIPNDYLDKNLLL
NFDKQSLRLTDPKTEEILLTVPLNKANTVVGPQGLWKVAIFTKDQLDATYNIANLSLPAAVDAISANYSVGERGKLTGVL
GLTYQGQDKEHITKVLNAILATYSEQNIERRSAESAQTLKFLDEQLPDLKKQLDDAERQFNKFRQQYNTVDVTKESELYL
TQSITLETKKAELEQKQAEMVAKYTAEHPAMREINGQIAAINKQIGELNSTLKQLPDVQRQYLQLYREVEVKTQLYTALL
NTYQQLRIAKAGEIGNVRIVDTAVEPVEPIKPKKLIVLILAIIAGGFIGILVALLRNMLRTGIKDSGQIENELDLPVYAT
VPRSPIQESRIKILKKKKSIPILAVKNGDDIAIESLRSIRTAIHFALANAKNNIIMIAGPSPEVGKSFISTNLATIFAQG
DKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQADLQKVLHKTQVANLDVITRGKSPTNPSEILSSNQFKELLEQLQS
QYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSQMKELELTLNRFEQAGVKVNGFILNDIQRASAGYGYGYNYAYA
YKAQKED
>gnl|bykdb|A0A010JVA5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter sp. 1566109] (length=731 residues).
MNQNSKTSEDSIDLKELFFSLIAQWKIIACCVVLSLICALLYLRITPDTYSVDAMVQVEDSKGAASAALLGDLSKVSGGL
SQKSPADPEIEILRSRMVLGQVIQNLNLDINVKDNQSGLIDKLISQDKSRLEYRHESVLYSNQNNNLIIRELKVPEYYLD
KPLKLEFKGANQFTLTYKDQVVFNGQLNKKNILNTNRGLWQVQLNAQGNLKEQSYTLTKLALPTAVKNFNDIYSVAEKGK
VTGVIGLNYLGQDPEHITQVLNNVLTVYHQQNIERKSLESKQTLAFLEKQLPELRKQLEDSEIKFNQFREKYKTVDVNAE
SELLLKQNIDLEKLKIELQQKQAELSAKYTNDHPLIRQIDAQITEINKKIADLNNRLTQLPETQRLYLQLYRDVKVNTEL
YTSLLNSYQQLKIANAGEIGNVRIIDTAVEPVKPIKPKKLIVLILSIFVGGFIGVLIALLRNMMRSGVNDSTQIENELDL
PVYATVPRSPIQETRMNILKKKKSIPILAVKSSDDIAIESLRSIRTAIHFALTSAKNNIIMIAGPSPEVGKSFISTNLAT
IFAQGNKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQADLTQVLHKTQVANLDVITRGKSPTNPSEMLSSTQFKDLL
EKFQTQYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSHMKELELTVNRFEQAGVKVNGFILNDIQRSSGGGYGYN
YAYAYKAQKED
>gnl|bykdb|A0A010P567 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Alteromonas sp. ALT199] (length=730 residues).
MAVKITEDTDNNELIDLGHYLGIIKRYSLRILLLALAFTVLVAILVMKMTPLYTSSTTLLIEAEKANVVSIEEVYGIDTK
SKDYMATQFEVLKSRQIAEKTVESLSLYDNADFMPEENETSFVSEIAEVFPFLPQTEKVELTEEQKVAKLKRKATQILMS
ATDVSLIKGTQLVRISVTTETPSLSALIANTIAEVYIENYLQAKLDMTAKATSFLTDSIDGLKTKLDVAERNLVRFYETN
QVVNIDGVVGLASDELERLNIQLSEAEVELKLNSVIFNQIKDSKAIEDVARIPEVLNHPAVRDVRRDEGKALARVSELSK
VYGPKHPKMIAANAELTAIRDTLNTQITDLISSITTQYESSKQKVAQLQREVETSKAAFRSLAELDNKRKALEREVDINQ
QLYDSFFTRLKETDELGGLESANARVLDTALPSYTPSKPNKKLFIAAAFVLSVSFGIALAIVMETLNSGIRSVEDVEKKL
GQRMLGLIPWLAHKKKTDLPIRSFFDGKKHQFAEAVRTLRTSLSLLNIEKENQAILVTSSVPKEGKTTVSINLAFALGQL
DKTILIDADLRRPSIGKQFNIPSYQPGVANLVLKSHSFEECLVRDEESNIDILSAGTIPSNPQELLADKGFEELITKLKS
EYKYVVVDTAPTQAVSDSMIVANSCDSVIYVVRADSTSDKVINNGLSRFLQVGHRLDGVVLNQVNLRKSDVAQRYAGFYD
QYGYTSHKSS
>gnl|bykdb|A0A010UMH1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter sp. 263903-2] (length=728 residues).
MNQQNTNTEDTIDLKELFFSLIAQWKLIALCVILSVVFALLYLRVTPDTYSVDALVQVEDSKGASAALLGDLSQMIEQKS
PAQAEIEILKSRLVLGSVIKELHLNIQISSTEDTLTHRLLSDTEYKTEYTKKSVLFQDNLKSFEVREFEVPNYYLDKNLL
LNFDKQSLTLTDPETEEVILTVPLNQTNHVTGPHGLWKVAIFAKDQLDATYNITNLSLPAAVNSLSVNYSVAERGKLTGV
LGLNYQGQDKEHITKVLNAILATYSAQNIERRSAESAQTLKFLDEQLPDLKKQLDDAERQFNKFRQQYNTVDVTKESELY
LTQSITLETKKAELEQKQAEMAAKYTAEHPAMREINGQLAAINKQIGELNSTLKQLPDVQRQYLQLYREVEVKTQLYTAL
LNSYQQLRIAKAGEIGNVRIVDTAVEPVKPIKPRKLLVLILSLFVGGFIGTLVALLRNMLRTGIKDSGQIENELDLPVYA
TVPRSPIQESRIKILKKKKSIPILAVKNSDDIAIESLRSIRTAIHFALANAKNNIIMIAGPSPEVGKSFISTNLATIFAQ
SDKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQADLQKVLHKTQVANLDVITRGKSPTNPSEILSSNQFKELLEQLQ
SQYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSQMKELELTLNRFEQAGVKVNGFILNDIQRASAGYGYGYNYAY
AYKAQKED
>gnl|bykdb|A0A011JTX5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter sp. 723929] (length=677 residues).
MVQVEDSKGAASAALLGDLSKVSGGLTQKSPADPEIEILRSRMVLGQVIHNLNLDIKIKDNRLGLIGKLVSQDKSKLEYH
HDAVIYTNQNNSLIVKKLIVPEYYLDKPLKLEFKGESQFTLTYKDRVVFNGQLNKKNILNTDKGLWQIQLNAQGNLQKQS
YTLTKLALPTAVKNFNDIYSVAEKGKMTGVIGLSYLGQDPEHISQVLNNVLNVYHQQNIERKSLESKQTLAFLEKQLPDL
RKQLEDSEIKFNQFREKYKTVDVNAESELLLKQNIDLEKLKIELQQKQAELSAKYTNDHPLIRQIDAQIAEINKKIADLN
NRLTQLPETQRLYLQLYRDVKVNTELYTSLLNSYQQLKIANAGEIGNVRIIDTAVEPVKPIKPNKLIILALSILAGGFIG
VLIALLRNMMRSGVKDSTQIETELDLPVYATVPRSPIQETRMSILKKKKSIPILAVKSSDDIAIESLRSIRTAIHFALTS
AKNNIIMIAGPSPEVGKSFISTNLATIFAQGNKRVLLIDADMRRGYMHKYFDIDVKPGLSELLSGQADLTQVLHKTQVAN
LDVITRGKSPTNPSEMLSSTQFKDLLEKFQTQYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYIKSHMKELELTVNRF
EQAGVKVNGFILNDIQRSSGGGYGYNYAYAYKAQKED
>gnl|bykdb|A0A011NXH1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Candidatus Accumulibacter sp. BA-92] (length=754 residues).
MDNDQSQTTFNTPGAPGRSGAQAQTQSMQQLSSEDEDEGLALGEIIAVLMDYRWLIAAVSLFALVLGLAWVFVAKPVYRA
DGLLQVEEKSSGMGSLKALQPLLGEETSVSAELEILSSRMVLGRVVNKLKLDIVAVPRTLPLIGGAVARRYDGDEPSSPW
LGLSSFSWGGDRIQVDSLEVPAAALDQPLTLVAAGDDGGFEVLDRDDQVVLKGMAGTRASGEGYSIFVAQLKARPGTQFR
LAKLSRETAVENLRRNFSVKERGKKSSLLEVSLVGGDPERIGMVLDDIMNAYLRQNVERRSAEAEKTLAFLETQLPALKT
QVDSAEAAYNNYRQSRGSLDLSLETQGVLKSLVEVENAAVLLKQERDELRQRFTAEHPRIQAVDNKLQRLAERRKAFDAE
VEALPDTQQTVLRLARDVEVSNRLYTELLNTAQQLRVSKAGTVGDVRIIDSAVVARQAIGAKPIAILGIALLLGVLSSMV
IIWLLRALRVVVEDPEIIESQLGLPVYATVPHSKTELDLHRKAKSGVGALLAVSFPEDDAVESLRGLRTTLHFALLDAQR
NSLLITGSSPGLGKSFISKNLGVVLAQVGKRVVIVDADLRRGHIHKEFGKERALGVSEYVAGQAPLDAILKTTSVANLCV
VSTGQIPPNPSELLMHQRFALLLAELGERFDTVIVDAPPVLAVSDAAIIGRHVGATLMIARSGKHPIRELEQAIKRLNQA
GVEVKGFVFNDLNVSRQRYRYGYKGYVYRYSYKN
>gnl|bykdb|A0A011PEG0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Candidatus Accumulibacter sp. SK-11] (length=751 residues).
MDNDQSRLPPAASGVGMMPGTMQPMPHVTSEDEDEGLALGEIIAVLMDYRWLIAAVCLCALILGLTWVFVTKPVYRADGL
LQIEEKKGSGGVFKALEPLLGEDTTVSAEVEILSSRMVLGRVVAKLKLDTIAVPQTLPLIGGAVARRYDGDEPNSAWLGL
SSFAWGGEAIQVDSLDVPDAALDADLSLIAGEDGTFEILDEDDRVVLKGKAGVRASGQGYSVFIAQLKARPGTRFLLKKL
SAETAIDSLRRSYSVKERGKKSGVLELSLLGSKPPQIALILDDIMNTYVRQNVERRSAEAEKTLKFLDTQLPALKTQVDS
AEGAYNSYRQSRGSLDLSLETQGILKSLVEVENAAVLLKQERDELRQHFTPEHPRIQAVDNKLARLNERRKQFDADVSRL
PDTQQTVLRLARDVEVSNRLYTELLNTAQQLRVSKAGTVGDVRVIDTAAVGREPVGAKPVAILGIALLLGMLASLVIIWV
LRSLRVVVEDPEVIESQLGLPVYATVPHSKLEVDLHRKAQAGGGGELLAVAHPQEDAVESLRGLRTTLHFALLDAQRNSL
LITGPSPGLGKSFISKNLGAVLAQVDKRVVIVDADLRRGHLHKEFGIERSLGISEYVAGQASLDEVLKSTAVTGLTVVTT
GQIPPNPSELLMHPRFEVLLGELAAKFDTVIVDAPPVLAVSDAAIIGRHVGATLMIARAGKHPIRELEQAVKRLNQAGVQ
VKGFVFNDLNVSRQSYRYGYKGYVYRYSYKT
>gnl|bykdb|A0A011Q7V8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Candidatus Accumulibacter sp. BA-94] (length=753 residues).
MEHDQLRPPTYTAPGMSASGPQQAYATPAVTTPEDEEGLALGEIIAVLMDYRWLIAATCLFALIIGLAWVVVASPTYRAD
GLLQIEEKKGSGGVLKALEPLLGDTTTAPAEVEILGSRMVLGRVVSKLRLDIIARPRTFPLIGSAVVRRYEGDQPASPWL
GLSGYAWGGERIQVDSLDVPQQALDEAHTLVAGAGGSFEIFNDDDELVLSGTAGTRATNKGYSVFIAQLEARPGTRFRLV
KLSAETAIESLRKNYSVKERGKKTGVLELSLVGKRADEIVQILDDIMNTYVRQNVERRSAEAEKTLKFLDTQLPALKTQV
DSAEGAYNSYRQSRGSLDLSLETQGILKSLVEVENAAVLLKQERDELRQNFTPEHPRIQAVDSKLARLNERRKQFDGEVS
RLPDTQQTVLRLARDVEVSNRLYTELLNTAQQLRVSKAGTVGDVRVIDTAAVGREPVGAKPVAILGIALLLGMLASLVVI
WVLRSLRVVVEDPEVIESQLGLPVYATVPHSKLEVDLHRKVQAGAVGELLAVAHPQEDAVESLRGLRTTLHFALLDAQRN
SLLITGSSPGLGKSFISKNLGAVLAQVDKRVVIVDADLRRGHLHKEFGIERAVGISEYVAGQALLDDVLKSTAIPGLTVV
TTGQIPPNPSELLMHPRFEVLLGELAAKFDNVIVDAPPVLAVSDAAIIGRHVGATLMIARAGKHPIRELEQAVKRLNQAG
VQVKGFVFNDLNVSRQSYRYGYKGYVYRYSYRT
>gnl|bykdb|A0A011Q8B8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Candidatus Accumulibacter sp. BA-93] (length=753 residues).
MDNDQSQTPFNAPGVPGRSGAQAQTQSLQQTSPEDDDEGLALGEIIAVLMDYRWLIAAVTLFALVLGLAWVFVAKPIYRA
DGLLQVEEKSSGMGSLKALQPLLGDETSVSAELEILSSRMVLGRVVKKLKLDIVAVPRTFPLIGGALSRRYDGDDPNSPW
LGLSSFSWGGDRIQVDSLEVPARALDDQLTLVAGDEGGFEVMDGDGQSVLKGQVGKRAIGQDYSIFVAQLKARPGTRFRL
MKLSAETAVDDLRRNYSVKERGKKSSLLELSLTGGDPEQIGIVLDDIMNTYLRQNVERRSAEAEKTLAFLETQLPALKTQ
VDSAEAAYNNYRQSRGSLDLSLETQSVLKSLVEVENAAVLLKQERDELRQNFTPEHPRIQAVDNKLQRLNERRKAFDADV
AALPDTQQTVLRLARDVEVSNRLYTELLNTAQQLRVSKAGTVGDVRIIDSAAVGRQPVGAKPIAILGIALLLGVLFSMVI
IWLLRALRVVVEDPEIIESQLGLPVYATVPHSKMEIDLQRKSKSGVGELLAVSFPEDDAVESLRGLRTTLHFALLDAQRN
SLLITGSSPGLGKSFISKNLGVVLAQVGKRVVIVDADLRRGHIHKEFGRERALGVSEYVAGQATLDAVLKTTSVANLCVV
STGQIPPNPSELLMHERFATLLRELGERFDTVIVDAPPVLAVSDAAIIGRHVGATLMVARSGKHPIRELEQAVKRLNQAG
VEVKGFVFNDLNVSRQRYRYGYKGYVYRYSYKT
>gnl|bykdb|A0A011TEN2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Aquamicrobium defluvii] (length=790 residues).
MFDRHRQIGPEHPGSGAVAVPGAWYDPRLHIQDYAYEPPQQEEGIDILRLFLYVVHYRWLLATLVAVGIVCALAVTMMMT
PQYRATARLEVLVPSAKVFQDIEVTSEGSDMRSYLTAREKLKSRSLAQRVVFNLGLGEREDFLFPRPSFSPLNILNRAFG
RSPGGDISQYSADERANMAVDRVLANLSVDPITNTSLLSISYSDQQPRYAYEIANQVAQSFIDQRVDQASDTSSQARKFI
QEQVLQVKERLQQSEEALVDYAKSAGITITGSDSSLIAANLTEINKALALAMQESLDYGRLVQQIDNGQGASLEQVLKSE
GLEKLRGKLAELNAEYQQKLAFFKPGFPEMQQLRSQIREIENQLNLGIAAVTDSIRIKHTETLAKVQDLRNKLAELEAEQ
VAYQDKNIRYTILKREVDSNRSQYENLIAKLNEVAVGSELRNQNAAVVDMAVMPRSPYSPRLPVNLAIGLVLSMVIGAAA
VYVLELLNNTFTNPEQVEKELRLPILGILPAIDDREFGQAVADPRSGLSESYRSLRTSLQFSGEQGAPRVLLVTSSEPSE
GKSTTVFKLAEDFGALGAKVLVVDADLRKPVVHRIFKVDNIVGLSNVLTNTIRRDDLPKLIKPVGGNVSVMTAGMIPPNP
ADLLSSSRMGLLLQKLSRSYDLVLIDSPPIIGLSDAPILSRLTEATLLVVSSNQVTRKAARAALKRIQAAGSNVLGVAMT
KFAVRKLDYNYSYKYLSYNYYSYGDETPKLESKGGEGGSSTHAKNWSLASVSGRVRKHLRDLGDRIKSAS
>gnl|bykdb|A0A013S8Q5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter sp. 742879] (length=728 residues).
MNQQNTNTEDTIDLKELFFSLIAQWKLIALCVILSVVCVLLYLRVTPDTYSVDALVQVEDSKGASAALLGDLSQMIEQKS
PAQAEIEILKSRLVLGSVIKDLHLNIQVSSTENTFTHRLLSDTDYKTEYDKKSVLFKDGLKSFDIRQFEIPAYYLDKNLL
LEFDKQSLRLTDPDTEEVILTVPLNQANSVTGPYGVWKVAIFTKDQFDSTYNIKKLSLPLAIKSISSDYSVEEKGKLTGI
LGLSYQGQDQEHITKVLNAILATYSAQNIERRSAESAQTLKFLDEQLPDLKKQLDDAERQFNKFRQQYNTVDVTKESELY
LTQSITLETKKAELEQKQAEMAAKYTAEHPAMREINGQLSAINKQIGELNSTLKQLPDVQRQYLQLYREVEVKTQLYTAL
LNSYQQLRIAKAGEIGNVRIVDTAIEPVQPIKPRKLLVLILSVLVGGFIGTLIALLRNMLRTGIKDSGQIENELDLPVYA
TVPRSPIQESRIKILKKKKSIPILAVKNGDDIAIESLRSIRTAIHFALANAKNNIIMIAGPSPEVGKSFISTNLATIFAQ
GDKRVLLIDADMRRGYMHKYFDIDVKPGLSELLSGQADLQNVLHKTQVANLDVITRGKSPTNPSEILSSNQFKELLEQLQ
SQYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSQMKELELTLNRFEQAGVKVNGFILNDIQRASAGYGYGYNYAY
AYKAQKED
>gnl|bykdb|A0A013T436 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter baumannii 573719] (length=727 residues).
MNQNTNTEDTIDLKELFFSLIAQWKLIALCVILSLVCALLYLRATPNTYSVDALVQVEDSKGASAALLGDLSNMIEQKSP
AQAEIEILKSRLVLGSVIKDLHLNIQVSSTENTFSHRLLSDTNYKTEYTKNSVIFKDGLKSFEIRQFEIPAYYLDRTLQL
NFDKQSLRLTDPTTEEVILTLPLNQLNQVTGPQGTWKVGIFTKDQFEATYNIKNLSIPAAVNAISANYSVAERGKLTGVL
GLNYQGQDKEHITKVLNAILATYSAQNIERRSAESAQTLKFLDEQLPDLKKQLDDAEREFNKFRQQYNTVDVTKESELYL
TQSITLETKKAELEQKQAEMAAKYTAEHPAMREINGQLTAINKQIGELNSTLKQLPDVQRQYLQLYREVEVKTQLYTALL
NSYQQLRIAKAGEIGNVRIVDTAVEPIEPIKPKKLQILILSIFLGGFIGTLIALLRNMLRTGIKDSGQIENELDLPVYAT
VPRSPIQESRVKILKKKKSIPILAVKNSDDIAIESLRSIRTAIHFALANAKNNIIMIAGPSPEVGKSFISTNLATIFAQS
DKRVLLIDADMRRGYMHKYFDIDVKPGLSELLSGQADLQKALHKTQVPNLDVITRGKSPTNPSEILSSNQFKELLEQLQS
QYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSQMKELELTLNRFEQAGVKVNGFILNDIQRASAGYGYGYNYAYA
YKAQKED
>gnl|bykdb|A0A013TFK0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter sp. 826659] (length=727 residues).
MNQNTNTEDTIDLKELFFSLIAQWKLIALCIILSLVCALLYLRVTPDTYSVDALVQVEDSKGASAALLGDLSQMIEQKSP
AQAEIEILKSRLVLGSVIRDLHLNIRVSSTENTFTHRLLSNTEYKTEYNKNSVVFKDGLKSFEIRQFEIPAYYLDKTLHL
NFDKQSLRLTDPTTEEVILNVPLNQLNQVTGPHGTWKIALFTKDQFDATYNITNLSVPAAVNAISANYSVAERGKLTGVL
GLNYQGQDKEQITKVLNAILATYSAQNIERRSAESAQTLKFLDEQLPDLKKQLDDAERQFNKFRQQYNTVDVTKESELYL
TQSITLETKKAELEQKQAEMAAKYTAEHPAMREINGQITAINKQIGELNSTLKQLPDVQRQYLQLYREVEVKTQLYTALL
NSYQQLRIAKAGEIGNVRIVDTAVEPIEPIKPKKFQILVLSLFLGGFIGTLVALLRNMLRTGIKDSGQIENELDLPVYAT
VPRSPIQESRIKILKKKKSIPILAVKNSDDIAIESLRSIRTAIHFALANAKNNIIMIAGPSPEVGKSFISTNLATIFAQG
DKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQADLQNVLHKTPVANLDVITRGKSPTNPSEILSSNQFKELLEQLQS
QYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSQMKELELTLNRFEQAGVKVNGFILNDIQRASAGYGYGYNYAYA
YKAQKED
>gnl|bykdb|A0A013VNY5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingobium sp. Ant17] (length=697 residues).
MMTPILTERDLDATPGHGRAARVTAAARRGWLVLRRHRVILFVTMALCLLAAVLAILMSTPDYRATASVEIEDVPAGAAG
AGTTPRAATDNIEAMMQTELEVLRSRALAEAVAQDLALVGTPTFFQRMGHKRPTGGAGSLSQRQVEHDQVVALLRDNLEV
ELPGKSRVLRISFISADPVLSARVANSYADNLIRADLKRGFESGVQARRFLLGELDGARRELARAERELAVYAARLGTEP
GQAAPPSEGTIATRLAQLNGFRAQALADRIAAQKTWESARRASAETLPEVLSNGAMQTLMAERAQARAALVEERQFRKDA
HPEMREARARLAALDDQAQEMANRIRASLKERYDVAVHGETQIAAEIADLERQGQAAQGRDVQLGIYERSVDTYRMLHDS
LLQRYRDMASQAGFQAGRIQPLDRAAVPTKPFSPRIGVTLLLAAIGGLLLGLLLVAARHIFDDAVTSADTLAERVGLPLL
GAVPVTGDNPQPPEIFAPIASSLLLASAGGLPRSILVTSAQEGEGKSLTLHALALALGRMGKRVLVIDGDMRRPVQHSLF
RLTPARGISEVLTGQASAEETIIDSSVPGVFLLPCGAVPPNPAELLATPALDALLASVRDAYDTVLIDAPPILGLGDTPL
LAARVQASLLVVEWGRNHHGGLRAAVERLRQAGGTLIGAILTKQQGRMMEYDYHRGG
>gnl|bykdb|A0A013X0W1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingobium sp. Ant17] (length=700 residues).
MNSAASEGKEVRLSDNVLALKGVLRRRWVTLALVTGVIFAVAAVLILLMTPSYQATARLQIDPNRDPLARSRGNYTPDLD
SEAIETEVTLLNSQEVARAVVQRLNLQNDPEFAKDVEAGASVSPADRMDSLVRAVKGNLNVGRDKLTYVINVGFESTDPR
KAADIANAFAEEYIRAKIGTRMGTAETQAAFFERRLTELGNEVRAAEAAAAQYRAQTGMIGRDAGTIVDQQVGPLSSQLA
TAESSAAEARANLNAARAQIARGGLDAVSEVRSSQVVSDLRRQRAEVVRSKGEVDARYGPLHPETVKVQDQLKQLDRQIA
EEAERAVASLQAASQAADARVASLRGSLRQLEGQQATNTRASVTGDSLEREAASKRAAYDQMAKLSVDSVQGQRSEIATA
TIIDRATPPTSPTAPKRSLLLAMALIVAFAGGSATIITQELLVPGIRNVSDLESELGLTVLAAVPKVKGKESPANLIADK
STSLFGESMRIARASILGVRSSEPIKIIAITSTVPAEGKTTTALAFARTLAVSGSRTLLIDCDIRRASLRQTTGIAGDAG
LVEILDKQAPVEAAIIADTTEKLDLLPVLRPHYSSEDVFGGDTMAQLLKDLSSRYDHIVLDLPPLLGLADGRFLAALADA
VVLVVRWGKTPMRPVAAAVQQLRADDAHLIGAIFAMVDPSSEAIGGLYYSQQYAAYYRAG
>gnl|bykdb|A0A014CLB5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter sp. 25977_2] (length=731 residues).
MNQNSKTSEDSIDLKELFFSLIAQWKIIACCVVLSLICALLYLRITPDTYSVDAMVQVEDSKGAASAALLGDLSKASGGL
SQKSPADPEIEILRSRMVLGQVIQNLNLDISIKDNQSSLIGKLVSQDQSKLEYRHDAVIYTNQNNNLIVKQLSVPEYYLD
KPLKLEFKDVNQFTLTYKDQVVFNGLLNKKNILNTDKGLWQVQLNTQGNLKGHSYTLTKLALPTAVNQFNKIYGVAEKGK
MTGVIGLSYLGQDPEHITQVLNNVLNVYHKQNIERKSLESKQTLAFLEKQLPELRKQLEDSEIKFNQFREKYKTVDVNAE
SELLLKQNIDLEKLKIELQQKQAELSAKYTNDHPLIMQINAQIAEINKKIADLNNRLTQLPETQRLYLQLYRDVKVNTEL
YTSLLNSYQQLKIANAGEIGNVRIIDTAVEPVKPVKPKRLIVLILSIFAGGFIGVLIALLRNMMRSGVNDSTQIENELDL
PVYATVPRSPIQETRISILKKKKSIPILAVKSNDDIAIESLRSIRTAIHFALTSAKNNIIMIAGPSPEVGKSFISTNLAT
IFAQSNKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQADLSQVLHKTQVANLDVITRGKSPTNPSEMLSSTQFKDLL
EKFQTQYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSHMKELELTVNRFEQAGVKVNGFILNDIQRSSGGGYGYN
YAYAYKAQKED
>gnl|bykdb|A0A014CNL6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter sp. 25977_8] (length=731 residues).
MNQNSKTSEDSIDLKELFFSLIAQWKIIACCVVLSLICALLYLRITPDTYSVDAMVQVEDSKGAASAALLGDLSKASGGL
SQKSPADPEIEILRSRMVLGQVIQNLNLDISIKDNQSSLIGKLVSQDQSKLEYRHDAVIYTNQNNNLIVKQLSVPEYYLD
KPLKLEFKDVNQFTLTYKDQVVFNGLLNKKNILNTDKGLWQVQLNTQGNLKGHSYTLTKLALPTAVNQFNKIYGVAEKGK
MTGVIGLSYLGQDPEHITQVLNNVLNVYHKQNIERKSLESKQTLAFLEKQLPELRKQLEDSEIKFNQFREKYKTVDVNAE
SELLLKQNIDLEKLKIELQQKQAELSAKYTNDHPLIMQINAQIAEINKKIADLNNRLTQLPETQRLYLQLYRDVKVNTEL
YTSLLNSYQQLKIANAGEIGNVRIIDTAVEPVKPVKPKRLIVLILSIFAGGFIGVLIALLRNMMRSGVNDSTQIENELDL
PVYATVPRSPIQETRISILKKKKSIPILAVKSNDDIAIESLRSIRTAIHFALTSAKNNIIMIAGPSPEVGKSFISTNLAT
IFAQSNKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQADLSQVLHKTQVANLDVITRGKSPTNPSEMLSSTQFKDLL
EKFQTQYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSHMKELELTVNRFEQAGVKVNGFILNDIQRSSGGGYGYN
YAYAYKAQKED
>gnl|bykdb|A0A014DHW0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter sp. 25977_4] (length=731 residues).
MNQNSKTSEDSIDLKELFFSLIAQWKIIACCVVLSLICALLYLRITPDTYSVDAMVQVEDSKGAASAALLGDLSKASGGL
SQKSPADPEIEILRSRMVLGQVIQNLNLDISIKDNQSSLIGKLVSQDQSKLEYRHDAVIYTNQNNNLIVKQLSVPEYYLD
KPLKLEFKDVNQFTLTYKDQVVFNGLLNKKNILNTDKGLWQVQLNTQGNLKGHSYTLTKLALPTAVNQFNKIYGVAEKGK
MTGVIGLSYLGQDPEHITQVLNNVLNVYHKQNIERKSLESKQTLAFLEKQLPELRKQLEDSEIKFNQFREKYKTVDVNAE
SELLLKQNIDLEKLKIELQQKQAELSAKYTNDHPLIMQINAQIAEINKKIADLNNRLTQLPETQRLYLQLYRDVKVNTEL
YTSLLNSYQQLKIANAGEIGNVRIIDTAVEPVKPVKPKRLIVLILSIFAGGFIGVLIALLRNMMRSGVNDSTQIENELDL
PVYATVPRSPIQETRISILKKKKSIPILAVKSNDDIAIESLRSIRTAIHFALTSAKNNIIMIAGPSPEVGKSFISTNLAT
IFAQSNKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQADLSQVLHKTQVANLDVITRGKSPTNPSEMLSSTQFKDLL
EKFQTQYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSHMKELELTVNRFEQAGVKVNGFILNDIQRSSGGGYGYN
YAYAYKAQKED
>gnl|bykdb|A0A014DNW8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter sp. 25977_10] (length=731 residues).
MNQNSKTSEDSIDLKELFFSLIAQWKIIACCVVLSLICALLYLRITPDTYSVDAMVQVEDSKGAASAALLGDLSKASGGL
SQKSPADPEIEILRSRMVLGQVIQNLNLDISIKDNQSSLIGKLVSQDQSKLEYRHDAVIYTNQNNNLIVKQLSVPEYYLD
KPLKLEFKDVNQFTLTYKDQVVFNGLLNKKNILNTDKGLWQVQLNTQGNLKGHSYTLTKLALPTAVNQFNKIYGVAEKGK
MTGVIGLSYLGQDPEHITQVLNNVLNVYHKQNIERKSLESKQTLAFLEKQLPELRKQLEDSEIKFNQFREKYKTVDVNAE
SELLLKQNIDLEKLKIELQQKQAELSAKYTNDHPLIMQINAQIAEINKKIADLNNRLTQLPETQRLYLQLYRDVKVNTEL
YTSLLNSYQQLKIANAGEIGNVRIIDTAVEPVKPVKPKRLIVLILSIFAGGFIGVLIALLRNMMRSGVNDSTQIENELDL
PVYATVPRSPIQETRISILKKKKSIPILAVKSNDDIAIESLRSIRTAIHFALTSAKNNIIMIAGPSPEVGKSFISTNLAT
IFAQSNKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQADLSQVLHKTQVANLDVITRGKSPTNPSEMLSSTQFKDLL
EKFQTQYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSHMKELELTVNRFEQAGVKVNGFILNDIQRSSGGGYGYN
YAYAYKAQKED
>gnl|bykdb|A0A014E2D8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter sp. 25977_7] (length=731 residues).
MNQNSKTSEDSIDLKELFFSLIAQWKIIACCVVLSLICALLYLRITPDTYSVDAMVQVEDSKGAASAALLGDLSKASGGL
SQKSPADPEIEILRSRMVLGQVIQNLNLDISIKDNQSSLIGKLVSQDQSKLEYRHDAVIYTNQNNNLIVKQLSVPEYYLD
KPLKLEFKDVNQFTLTYKDQVVFNGLLNKKNILNTDKGLWQVQLNTQGNLKGHSYTLTKLALPTAVNQFNKIYGVAEKGK
MTGVIGLSYLGQDPEHITQVLNNVLNVYHKQNIERKSLESKQTLAFLEKQLPELRKQLEDSEIKFNQFREKYKTVDVNAE
SELLLKQNIDLEKLKIELQQKQAELSAKYTNDHPLIMQINAQIAEINKKIADLNNRLTQLPETQRLYLQLYRDVKVNTEL
YTSLLNSYQQLKIANAGEIGNVRIIDTAVEPVKPVKPKRLIVLILSIFAGGFIGVLIALLRNMMRSGVNDSTQIENELDL
PVYATVPRSPIQETRISILKKKKSIPILAVKSNDDIAIESLRSIRTAIHFALTSAKNNIIMIAGPSPEVGKSFISTNLAT
IFAQSNKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQADLSQVLHKTQVANLDVITRGKSPTNPSEMLSSTQFKDLL
EKFQTQYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSHMKELELTVNRFEQAGVKVNGFILNDIQRSSGGGYGYN
YAYAYKAQKED
>gnl|bykdb|A0A014E5S9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter sp. 25977_6] (length=731 residues).
MNQNSKTSEDSIDLKELFFSLIAQWKIIACCVVLSLICALLYLRITPDTYSVDAMVQVEDSKGAASAALLGDLSKASGGL
SQKSPADPEIEILRSRMVLGQVIQNLNLDISIKDNQSSLIGKLVSQDQSKLEYRHDAVIYTNQNNNLIVKQLSVPEYYLD
KPLKLEFKDVNQFTLTYKDQVVFNGLLNKKNILNTDKGLWQVQLNTQGNLKGHSYTLTKLALPTAVNQFNKIYGVAEKGK
MTGVIGLSYLGQDPEHITQVLNNVLNVYHKQNIERKSLESKQTLAFLEKQLPELRKQLEDSEIKFNQFREKYKTVDVNAE
SELLLKQNIDLEKLKIELQQKQAELSAKYTNDHPLIMQINAQIAEINKKIADLNNRLTQLPETQRLYLQLYRDVKVNTEL
YTSLLNSYQQLKIANAGEIGNVRIIDTAVEPVKPVKPKRLIVLILSIFAGGFIGVLIALLRNMMRSGVNDSTQIENELDL
PVYATVPRSPIQETRISILKKKKSIPILAVKSNDDIAIESLRSIRTAIHFALTSAKNNIIMIAGPSPEVGKSFISTNLAT
IFAQSNKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQADLSQVLHKTQVANLDVITRGKSPTNPSEMLSSTQFKDLL
EKFQTQYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSHMKELELTVNRFEQAGVKVNGFILNDIQRSSGGGYGYN
YAYAYKAQKED
>gnl|bykdb|A0A014EEL0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter sp. 25977_1] (length=731 residues).
MNQNSKTSEDSIDLKELFFSLIAQWKIIACCVVLSLICALLYLRITPDTYSVDAMVQVEDSKGAASAALLGDLSKASGGL
SQKSPADPEIEILRSRMVLGQVIQNLNLDISIKDNQSSLIGKLVSQDQSKLEYRHDAVIYTNQNNNLIVKQLSVPEYYLD
KPLKLEFKDVNQFTLTYKDQVVFNGLLNKKNILNTDKGLWQVQLNTQGNLKGHSYTLTKLALPTAVNQFNKIYGVAEKGK
MTGVIGLSYLGQDPEHITQVLNNVLNVYHKQNIERKSLESKQTLAFLEKQLPELRKQLEDSEIKFNQFREKYKTVDVNAE
SELLLKQNIDLEKLKIELQQKQAELSAKYTNDHPLIMQINAQIAEINKKIADLNNRLTQLPETQRLYLQLYRDVKVNTEL
YTSLLNSYQQLKIANAGEIGNVRIIDTAVEPVKPVKPKRLIVLILSIFAGGFIGVLIALLRNMMRSGVNDSTQIENELDL
PVYATVPRSPIQETRISILKKKKSIPILAVKSNDDIAIESLRSIRTAIHFALTSAKNNIIMIAGPSPEVGKSFISTNLAT
IFAQSNKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQADLSQVLHKTQVANLDVITRGKSPTNPSEMLSSTQFKDLL
EKFQTQYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSHMKELELTVNRFEQAGVKVNGFILNDIQRSSGGGYGYN
YAYAYKAQKED
>gnl|bykdb|A0A014EX04 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter sp. 25977_3] (length=731 residues).
MNQNSKTSEDSIDLKELFFSLIAQWKIIACCVVLSLICALLYLRITPDTYSVDAMVQVEDSKGAASAALLGDLSKASGGL
SQKSPADPEIEILRSRMVLGQVIQNLNLDISIKDNQSSLIGKLVSQDQSKLEYRHDAVIYTNQNNNLIVKQLSVPEYYLD
KPLKLEFKDVNQFTLTYKDQVVFNGLLNKKNILNTDKGLWQVQLNTQGNLKGHSYTLTKLALPTAVNQFNKIYGVAEKGK
MTGVIGLSYLGQDPEHITQVLNNVLNVYHKQNIERKSLESKQTLAFLEKQLPELRKQLEDSEIKFNQFREKYKTVDVNAE
SELLLKQNIDLEKLKIELQQKQAELSAKYTNDHPLIMQINAQIAEINKKIADLNNRLTQLPETQRLYLQLYRDVKVNTEL
YTSLLNSYQQLKIANAGEIGNVRIIDTAVEPVKPVKPKRLIVLILSIFAGGFIGVLIALLRNMMRSGVNDSTQIENELDL
PVYATVPRSPIQETRISILKKKKSIPILAVKSNDDIAIESLRSIRTAIHFALTSAKNNIIMIAGPSPEVGKSFISTNLAT
IFAQSNKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQADLSQVLHKTQVANLDVITRGKSPTNPSEMLSSTQFKDLL
EKFQTQYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSHMKELELTVNRFEQAGVKVNGFILNDIQRSSGGGYGYN
YAYAYKAQKED
>gnl|bykdb|A0A014N794 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Erwinia mallotivora] (length=727 residues).
MNIKSKASSASHEESTGWDLAHIVGQLVDHRWIIVAVTALFMLLGTLYSLFATPIYSADAMVQVENKNVNTVLNDLQSMM
PNAQPMSATEVEIVTSRMVIGKTVKDLGLDALVQQNYLPVIGKGLSRLLGNKPGEVDVTQLSVPLSWEKPQLSLEVTGAD
SYTVSKDGDELFKGKVGQLENHGGVTMMVKSIVGVKPDTSFTVTKLTDLQAISLVTNNLTVADKGKDTGVLGLEYLGEDP
VQISRVLNQIVTNYVDQNIDRKSAEAQKSLEFLKIQLPDVRAKLDEAEDKLNTFRRQNDSVDMSMEAKSALDSSVSIQSQ
LNELTFREAEVSQLFTKDHPTYRALLEKRQTLVDEQKRVNQKIGQMPQTQQEIVRLTRDVQSGQEIYMQLLNRQQELNIS
KASTVGDVRIVDPAETAAAPVAPKKLLVVLASMILGMMVSVGVILLKALFHHGIERPDELEERGINVYASVPLSEWQSKR
DGDMLARRTGHGKVDATNSLLALGNPTDLSIEAIRSLRTSLHFAMMEAKNNILMITGASPGIGKTFICSNLATLVAKADQ
KVLLIDGDMRRGYTHQLLGANNKTGLSDVLSGKTEFSSELVQKGAWGFDFLPRGQVPPNPSELLMHNRMNELLHWASMNY
DLVLIDTPPILAVTDASIIGKLAGTSLMVVRFETNTLKEVEFSYRRFMQNGIDIKGVILNAVVRKASNAFGYGYDYYDYS
YKQDAKS
>gnl|bykdb|A0A017T1W1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Chondromyces apiculatus DSM 436] (length=745 residues).
MPALNIVLAWRTVRKHWVIALVTAVAVFLLVAFYTLGQKKIYQATATIQFDPNPPRPLGRGVDTVVEMGTGSYWNNREYY
ETQYKIIQSMRVALAVVRDLNLHNDSAFLENLPPGKPGPSKAVSPEEAAEVLRERLTVDPVKESRLAIVRFTDADSQRAQ
RVLSVLVNTYVEQNLDDVLTSTDSAVEWLRTQLDKLKGDLESSEMALHDYKIDKNILSVAIDDQSNMLREEMKQLNEALT
ATRAKREEVRARRDELAKMKASEPADLPSSELLQSHTLQGLRERHDEVVREYKALLGEGKGARHPDVRAAEERVTAAKAA
LMAEVKNIRGALERDVDVVSRQEAGLAALFERAQKQAFELNLLEIEYNRLRRSKDNNEKLYALVLERTKEADLTRMMRVS
NIRVPDPPLAQKKPVRPRVPMNLAAGLLAGVGLGVAAALGRAMLDRTLKTPDDVEQELGLPFLGLLPEISPEERQAGKRA
ERRGGRPRRGARGGAGSRELIVHEQPFSGAAEAARAVRTNLLFMAPDNPYRVLLITSAGPSEGKTTVVCCIATAMAQAEQ
RVVMVDCDLRRPRLHRVFGKSTNVGVTTALLEGKLPDEELMRTEVPNLWVLPAGPLPPNPAELFHSERFKVLLEQLTARY
DRVIIDSPPIVAVTDAAILSTLAEGTVLVTRAFKTQRELARHGVRSLLDVGGKAAGVVLNAVDLDRDEYRYYHYYSYKKE
GFYGQDDPRADAPADERPGDSAAAS
>gnl|bykdb|A0A021XFN8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Shinella sp. DD12] (length=785 residues).
MHHRTVPYGSLFRREPDTSDSFIDLNRLMTILMRRARLIALSVVVALALGVLYLVFATPLYTAMTQILLDEDLSRYAEEA
ETTPQSSQQADTRLASAIEILKSGRLALRVVDDLDLSQNETILNPPQSPVSLAKGWVKSLASLGSGGAAPSAEAEAEGRR
QKAAAMLQQGLGVERVARSSVVAVSFRSPDPQLSATIAKAYAEAFFAEQLSANVHASEQASAWLQERLADIQQRSQAAAL
EVERYRNENGLTAARGELMSEQQLADLNSQLIVAQADAASASARYNQFRAIVEQGPERAVANATIPARQGDNSIVQDLRG
RYNAVVKREGEITRSFGADHPQATALRAEKEDLARQIYQELQQLTASYRNDYDVARSREISLRESIEKVAGSNAEANRSS
VQLRTLEQKATALKTLSDAYLARYEQATQQQSFPIAKARVISDAGVPTAASSPSRTLTIGLSLVLGLMGGGALTFLQEMR
ERSFRVGNDIRAVLGLRPLGYLPLVGARKERAQPARPEDGGADEGDVIPFERMTRIVLDAPGSAFAETLRHARLASDMML
HGRESRVIGIVSALPQEGKSTVAINFAALLAASGKRTLLIDADLRRPSLTGMLNPAPQAGLVEVLLGQAAWNQAIKVDRR
SKLAVLPAGGRMRGGEVHHPNELMASAGMKRLFDELRQTFDYVIVDLAPLAPVVDVKTFEPLADGFLFVVEWGKTPSPLV
RDLLTAESRIEAKIVGVVLNKTDMTALPRYSDFGAAEKYRSLYDQYCTDSVPPVPARQKSAPTQG
>gnl|bykdb|A0A022FT53 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Cupriavidus sp. SK-4] (length=747 residues).
MNQNPTYPSPAAPAEDEIDLVKYLDVLLASRWMIISIAAVVLALGVAYAFLARPEYEADILVQVEDSPTDAKSLLGDVSN
LFDVKTDAAAEMEILRSRMVVDRAVEALRLYIEAKPRYFPVVGEWIASRAKRLSEPGLFGLGGFAWGTETIQVATFDVPV
DLEDGKFKLTAMGDGRFRLEQGDLDQPIEGRVGEALESRQEVGSIRLLVTELKGKPGTVFKLIRRSKLQTLEDLQAALQI
DEKGKQSGVIGAALRGKDPKLTAATLNEIGDEYVAQNIKRKAAEAEKSLIFLGDLLPQLKSELEQAEVRYNTLRNNRGTF
NLSEEGRAYLQESVAAETSLLELKQKKAELLTRFRPEHPSLKAVDGQIAALSGKVGGLAKQMKSLPNLEQDALRLMRDVQ
VNNDLYVGLLNNMQQLKLVKAGKVGTVRLVDNARLPEEPVKPRKPLLIALAAILGLMLGVIVAFIRDALYGGITDPQDIE
QHAGLTVYGTVPHSTQQLVLSEEIRSRKGGMHLLASLAPNEPSIESLRSLRTALQFAMLDAGNNRVLLTGPTPGVGKSFV
SANLAAIMAAGGKRVLLLDADMRKGYLNQYFGKDRTPGLSDVLAGKARMEDVIHQNLIDGLDFVSTGTLPPNPAELLLNT
RMVELLDRFNERYDLVMIDTPPVLAVADTAILAARCGTVFLVTRFEKSTIGEIAESAKQLSHANVDVSGVIFNGLDPNAF
RYGYGSKYGRYRYAYYGYSTQGAQSHK
>gnl|bykdb|A0A022GEN0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Cupriavidus sp. SK-4] (length=746 residues).
MRTITNRDDAIEEAADQDKSVDLTAYLDILVRYRWTFLGTAIFVVTLGLLYAMVASPVYRTDIVVQVEESNGPLGGSASK
LSTSISPILDIKPAATAEMELLRSRMVVGKAVASLHLDVEAHPRYFPLIGQTIAHLKRELSNPGLFGWGGYAWGSESIAV
KELDVPASMEDRRIDLTATGNGGYSVSLNGGDVKASGKVGAPLSIATPAGAVRLVVSELDARPGVRFELRRLPRSTAIER
LQGRLVITERGRQSGVIGISLEGDNPAMVAATLNEIGNAYVEQNVLRKAAEAEKSLAFLEQQMPQLKQQVETSENRYNAM
RNQRGTVDLPEESKLMLNQSVQLQTKLQELRQKRQELDARFMPNHPVISLIDAQIASVNAQINGLAGRIQKLPDVEQNVL
RLMRDVKVSTEMLQSLLNDVQQLRLMKASKVGNSRLVDAAEVPIGPIRPNREVIATLAVVLSLIAGLAAVVLRHAFNGGV
ADADEIERRTGLVVYTTIPFAPQEAQTQDAANGGGLLVREQPDDPAVETLRSFRTALQFALAGNKNRTVVITGPAPGVGK
SFICANFSVIAASGRRVVLIDADLRRGSLHRRFGAQRTPGLTELLLGAPFEQVVQREVAPGLDFISTGSEPPHAADVLLS
PAMETLLDTLTKRYDLVLIDTPPILAATDAGILAGKAAAVFLVALAEKTTVNELQASYRALRQSGADVKGVLLNGLRIEG
RWYRAHYYFGKYRYLGEYSAKPPKRA
>gnl|bykdb|A0A022I9Z7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter sp. 1000160] (length=727 residues).
MSQNTNTEDTIDLKELFFALIAQWKLIALCIILSLVLALLYLRATPNTYSVDALVQVEDSKGASAALLGDLSQMMEQKSP
AQSEIEILKSRLVLGSVIEALHLDLDITSPEDTFSHRLFKKTNYTTEYNPKAVTFHDEQKSFDIQQFDVPNYYLDKKLSL
SFKDQSFSLTDPVTGQVILTAPLNQLNQLSTQLGVWKIAIFTKDTFDTHYFVQKSSLPAAAQAIKSNYSVAEKGKLTGIL
GLNYQGQDKEHITKVLNAILAAYSAQNVERRSAETAQTLKFLDEQLPDLKKQLDDAEREFNKFRQQYNTVDVTKESELYL
TQSITLETKKIELQQQQADLAAKYTAEHPAMREINAQIAALDKQITELNNTLKQLPDIQRQYLQLYREVEVKTQLYTALL
NSYQQLRIAKAGEIGNVRIVDTAVEPVEPIKPKKLQILILSIFLGSFLGVVIAVLRNMLRTGVKDSAQIENEFDLPVYAT
VPRSPVQETRMSILKKKKSIPLLAVKHNDDIAVESLRSIRTAIHFALANAKNNIIMIAGPSPEVGKSFISTNLATIFAQS
NKKVLLIDADMRRGYMHKYFNLDVKPGLSEYLSNLAELSQVIHQTDVVGLSVIARGKNPANPSEMLSSEQFKALMEQLSQ
QYDHIIIDTPPILAVTDGIIISQYAGVNLLVARYAKSQMKELELSLNRFEQANVKVNGFILNDIQRSSAGYGYGYNYSYA
YKANKDD
>gnl|bykdb|A0A022J9M1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter sp. 1564232] (length=727 residues).
MNQNTNIEDTIDLKELFFSLIAQWKLIALCIILSLVCALLYLRVTPDTYSVDALVQVEDSKGASAALLGDLSQMIEQKSP
AQAEIEILKSRLVLGSVIKELHLNIQVSSTEDTLTHRLLSDTEYKTEYTKKSVLFQDDLKSFEVREFEVPNYYLDKNLLL
NFDKQSLTLTDPETEEVILTVPLNRANHVTGPHGLWKVAIFTKDQLDATYNITNLSLPAAVNALSVNYSVAERGKLTGVL
GLNYQGQDKEHITKVLNAILATYSAQNIERRSAESAQTLKFLDEQLPDLKKQLDDAERQFNKFRQQYNTVDVTKESELYL
TQSITLETKKAELEQKQAEMAAKYTAEHPAMREINGQLAAINKQIGELNSTLKQLPDVQRQYLQLYREVEVKTQLYTALL
NSYQQLRIAKAGEIGNVRVVDTAVEPVKPIKPRKLLVLILSLFVGGFIGTLIALLRNMLRTGIKDSGQIENELDLPVYAT
VPRSPIQESRIKILKKKKSIPILAVKNSDDIAIESLRSIRTAIHFALANAKNNIIMIAGPSPEVGKSFISTNLATIFAQS
DKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQADLQKVLHKTQVANLDVITRGKSPTNPSEILSSNQFKELLEQLQS
QYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSQMKELELTLNRFEQAGVKVNGFILNDIQRASAGYGYGYNYAYA
YKAQKED
>gnl|bykdb|A0A022KQ43 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter sp. 478810] (length=733 residues).
MNQNSKTSEDSEDSIDLKELFFSLIAQWKIIACCVVLSLICALLYLRITPDIYAVDAMVQVEDSKGAASAALLGDLSKVS
GGLTQKSPADPEIEILRSRMVLGQVIHNLNLDIKIKDNRLGLIGKLVSQDKSKLEYHHDAVIYTNQNNSLIVKKLIVPEY
YLDKPLKLEFKDQNQFTLSYKDQVIFNGMLNQKNVLNTEKGLWHIQLNAQGDLKKQSFTLTKAALPTAVKNFNNIYGVAE
KGKMTGVIGLSYLGQDPEHISQVLNNVLNVYHQQNIERKSLESKQTLAFLEKQLPDLRKQLEDSEIKFNQFREKYKTVDV
NAESELLLKQNIDLEKLKIELQQKQAELSAKYTNDHPLIRQIDAQIAEINKKIADLNNRLTQLPETQRLYLQLYRDVKVN
TELYTSLLNSYQQLKIANAGEIGNVRIIDTAVEPVKPIKPNKLIILALSILAGGFIGVLIALLRNMMRSGVKDSTQIETE
LDLPVYATVPRSPIQETRMSILKKKKSIPILAVKSSDDIAIESLRSIRTAIHFALTSAKNNIIMIAGPSPEVGKSFISTN
LATIFAQGNKRVLLIDADMRRGYMHKYFDIDVKPGLSELLSGQTDLQQVLHKTQVANLDVITRGKSPTNPSEMLSSPQFK
ELLEQLQTQYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYIKSHMKELELTVNRFEQAGVKVNGFILNDIQRSSGGYG
YNYAYAYKAQKED
>gnl|bykdb|A0A022PSX1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Photorhabdus luminescens BA1] (length=715 residues).
MTTSDKSSHTHTDSDEIDLGRLLSALFDYRWVIGGITLLFTVIGLCYSLIATPIYKANSLLQVEKRSRVLPLIGDMADML
SGRPSDTSAELELLTSRMILGKTVKDLNLDVQVSADYFPVIGKGIARLRGMPKPDIVIKHFAVSPEYMNKGIKIYVDDSE
NYRLLFDDQIFLGQVNKVFDTDGINLLISNISASPGQNFTLVKRGQLGVIRGLQQTLRVKEKGNNTGIISLEIEGDDRAR
IKSILDSIGKNYLQQNVTRKTEEAESSLNFLKNHLPKVKIELNRSEELLNQYRQANESIDLSLEAKSALETLVQIEKQIN
ELTFKEAELQQLYTKQHPAYVALLDKRKTLVDTKKELNQSIKRLPKTQQEILRLTRDVQVGQEIYVQLLNKQQELNILKA
GTVGNVRIIDEAIVENSAVKPKKSLIVGSMMVLGFILSAGLICIRVMFRKGIESPEQLEEIGVSVYATIPLSGTQIKLEQ
QQKKRTHRHKLRLLAIQDPTDLAIEALRSLRTTLHFSMMESANKIILLSGSASELGKSFISVNLAAVLALSNKRVLLIDA
DMRRGRLHKVLESPQSQGLSEYLAGQHQIKQIITRTYLTELDFVNRGVIPPNPSELLMHNRLKELLSWAEEHYDYVLVDT
PPILAVTDAAIIGRYAGTSLLIARYHKTRVKEVNVAIRRFRQNGIHIKGVLLNAVEKKSGLYYDYGGCHQYSYKE
>gnl|bykdb|A0A023CCT2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas extremaustralis 14-3 substr. 14-3b] (length=740 residues).
MRSAPAFISQNTEETDLDFMMLLGTLLDHKWLIGGISMVFMALGATYALLSPPVYQATALVQVEPKKSDMLGFSDVGSLL
GKESPTVTEIELIRSRITIGTAVDNLNLDLEVKPRYLPLVGDFIARRFKPAEPHAVASPWFGLDSFAWGGEALTFSQLKL
PTELLGQELTLTAGSGNSFTLSDQDDHVLLIGQVGRFYDSNGIKLQVATLQANPGTQFRVVRSPRLTSILRYQKLLDVAE
RGKESGIIGLALESTQPAAAIQVLNEVMRIYVRQNIDRTSAEAAQSLAFLKGQLPQVRKDVEQAEAALNQFQIRNKTIDI
SLEAKAILDQIVALDASISELKMQQAEIERKFTPQHPVYRALLTQLAELTARQDDLAKKVESLPTTQQELLSLTRDLKVS
TEIYTQLLNKYQELDVMRAGTVGNVRLIDAADVDLRNPVRPQKALIVVIATLLGAFVAIALVLFRKALNRGITNPNDLEK
LGLPVYAAIPFSALQKDVDQRNHRSGKSDAMQLLSVSNPTDLAIEGLRSLRTSLHFAMLEAGNNRLMISGPSPQVGKTFI
SANLAAVVAHSGQRVLLVDVDMRKGYLHKVFGVSAENGLSDLLAKSCDLSAAIHHTAVDNLDVIGRGHIPPNPSELLMHA
NFTAFLEQVSALYDLVILDTPPFLAVTDATIVGRQSGTNLIVARFEMNSVREVELTMRRYEQNGIELKGAIFNGIEKRSS
AKYGYGAYSYYNYEYKSDSV
>gnl|bykdb|A0A023JM50 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella pneumoniae subsp. pneumoniae] (length=718 residues).
MSSLINKTSSRDSEGIDLGRLLGEFIDHRKLIISVTSLCTLIALIYAIFATPIYQADALIQVEQKQGNAILSNLSQMLPD
SQPQSAPEIALIQSRMILGKTVDDLNLQANITQKYFPLFGRGFARISDAKPAEITISRLFVSGSDNETPELLLSVTGEKD
FLINFDGHSFKGKLGELIERNGISLKIDDINAPPGTEFIIKYVSRLKAISELQDKLTVNDQGKDTGILNISLTGDNPVLI
EKIVNSIADNYLAQNIARQAAQDAKSLDFLNKQLPEVRSELDIAESKLNEYRRQSDSVDLSLEAKSVLDQIVNVDNQLNE
LTFRESEISQLYTKEHPTYKALLEKRKTLQDEKAKLNKKVSSMPETQQEILRLSRDVEPGRAVYMQLLNRQQELSIAKSS
AIGNVRIIDNAVTQPKPVKPKKILVLLIGVVIGLIISIGLVLLRVFLRRGIESPEQLEELGINVYASIPVSETFAKKTTQ
KNSWKGKDDIQGFLAIENPADLAIEAIRGLRTSLHFAMLESRNNILMISGGSPNAGKTFVSSNLAAIIAQTGKKVLFIDT
DMRKGYTHKLFNIPNDNGLSDVLSGKKDFSSSVKHIPMLGFDVIPRGMVPPNPAELLMHKRFGELMSWADQNYDMVILDT
PPILAVTDAAIIGNYAGTTLLVSRFELNTAKEIDISIKRFEQSGVPVKGCILNGVVKKASSYYGYGYNYYGYSYKDNK
>gnl|bykdb|A0A023NQH6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Dyella jiangningensis] (length=733 residues).
MTIIQYPSMQPDGEIDLSEVVGTVKDHKWTILGITCFFVLLAIAYALVATPVYQATAMVQVEQQVQNLPQLSALSQTLAG
ASPEATTETNLITSRMVIGAAVDKLNLTVETSPRRFPVIGSFYAHRFAKNNPGKVASPLLGMSDYDWGGSKLEVFRLEVP
DDLLDKPLRFIAGEGGLYVLQDDDGNILVIGRVGQEAKAHGVTIDVKSLAANPGTRFRVFKRRELTVINGLQRQINVTEQ
GKESGILGMTYNNASPVMATSVLEQVAELYVRQNVERNSAEAANSLKFVRDQIPNVRHELERATAALNEFQNKAQSVDIN
MQTQTLLNQSVSIDTNLEQLRLQLADVQRQFTPAHPQYQALMKQIGQLQAQKGAIEKKVGGLPDTQQQLLKLTRDVQVSN
ETYTSLLNQAQQLDIARAGTIGNVRIIDRAAVDVTQPVWPRTTLILMGSALFGGFVALLYVFIRQMLNRGIEDPAVIEKL
GLPVYATIPVSPRERALQSKRMRPDGREHVLVEDSPKDLAAEALRSLRTSLHFARLEAKNNVLMISGASPGAGKTFVSAN
LAAVVAQTGQRVLLIDGDMRIGVVHKILGGRAEIGLSELISGQVDMAGAIRQAESPSTLHYITRGKIPPNPSELLMNARF
SALLDHLKPKYDLIIIDTPPILAATDAAVIGHHSGTGLLVARFGLSQTRELALAKQRFEQNGVSIKGAIFNAVEKRSRGY
YAYAYYSVEKAVS
>gnl|bykdb|A0A023RLX8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Aeromonas media WS] (length=722 residues).
MTTSSVSSRQSSAAVENDEIDLGRLLGYLIDGRWWIVTITALFMVLGVAYALLATPVFKANALLQVEKKASGAALLGDMA
DVLGGEQPDAAAEIELLTSRMVLGRTVQELHLDTVVTPNFFPLVGRGLSRLMGHPYPKMAVSRFEVAPELLGTPLTLTVS
ADKHFTLEVEGRVLEGQVGKLLEKEDVTLLLSDVAADEGQVFTLVKQPVLDVIAELQSGLQVSEKGKNTGIISLALEGED
KGRIRAVLDNISQNYLQQNVVRKTEEAQKSLDFLQVHLPQVKDELNRSEELLNVYRQQNESVDLSLEAKAALDTMVGLEK
QLNELTFREAELQQLYTRQHPAYIALMEKRQTLMNTKNTINKSIKRLPKTQQEILRLTRDVQVGQEIFVQLLNKQQELNI
MKAGTIGNVRIIDDAAVETRAVKPKKPLIVVLATLLGGMLSVGLILVRAAFHRGVESPEQLEEMGLSVYATIPYSEEQAK
IEQQKKRRQAMPLNEALLAARNPADLAMESLRSLRTSLHFAMMEAKNNIVMISGPGPDLGKTFVSTNFAATLAMGGKKVL
VIDADLRKGYMQKVMGQEMGAGLSAYLGGQTEMMQVISKTGFDGLDFVCRGAVPPNPSELLMHPRFKALLDWASERYDFV
IVDSPPILAVTDAAIVGQHVGASLLVARFAQTAVKEVEVAIRRFEQNGVVIKGILLNAVEKKASSYYGNYGYYQYSYLIT
HD
>gnl|bykdb|A0A023WRJ5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas stutzeri] (length=738 residues).
MTTMPRPIYETKEDKDIDLAHLFDTFINNRVLIMSITGFFAALGIAYALLATPVYLASAMIQIEPKSGLPSLTDVVNTNP
PVSPAQTEIALLKSRSVVGGAVSKLNLDISITPHHFPIIGGFMARRFEPSEEGELGWHPAGLGGYAWGGETLKVTQLEVP
DKVHGKELTLEAAENNGFILRDKDGEVVVQGVVGEPVENEGYRVTVGELNARPGTTFTVVKNRTYNTTESFQQRLSAAER
GKQSGIVNVTLEDTDPAHAIRVLEEVANLYVEQNIARNAAEATQSLEFLNEQIPTVRRNLEAAQTALNKYQTGSRSVDIT
AETQSVLDRIVDMERQISEQNLKRTEMERRFTRQHPNFQALMNQINQLQVQKEELEKQIGTLPSTQQELLRLTRDVEVSS
ETYSMLLNKTQELDIIRAGTVGNVRIIDHAAADLENPVKPNKPLVVIVATLLGALLATAFVYVREALKRGVENPEDIERT
GTPVYASIPFTEKQAALEKRLANFKRDKSTASYLLTINDPADLATEAMRSLRTSLHFAMIEAKNNVLMITGPSPAVGKSF
VTTNLAAVVAQSGKRVLLIDADMRKGYLHKVMRCDGDKGLSDILSGRITLFDAIQKTQLNNLHVITHGQLPPNPSELLMH
ENFSRFVKEISHMYDLVIFDTPPILAVTDAALVGSQAGTTLMVTRYGLNGLKEIEAAKRRLEQNGLLVKGVIFNAVVRKA
STYGEYGYYQYEYASTTK
>gnl|bykdb|A0A023WU91 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas stutzeri] (length=736 residues).
MTALTRSSLEYDADNRIDLAGIMRTAYDHKALIIAITGFFAALGVLYAVIATPIYQATAMIQIEPKKAAITGVPEISPRP
DSVSQAVTEISLLKSRAVLGKAVEELKLYIVAKPRYFPVFGAFMARNHDPATDGALATPLFGLTGYAWGGEKLEVFQLDV
PDAYLGMDLTLVAGTAGNYSLYDDEQQLILRGQVNQAVESQGFKVQIAELEARPGTEFKLIRSRPQTTALNYQDRLKVGE
AGKDSGIIYMSLEDADPQLASRVLDEISRLYVSQNIQRSSAEAAQRLDFLRSQLPQVRKELEKAEAALHDYQTSSKSVDI
SIETKGVLDQIVQLETQISELSLKRVEYDRLYTREHPTYRTLMTQMNELLAQKAQLLKKVDALPMTQQELLRLKRDMEVT
TQTYTLLMNQAQEQDVLRAGTIGNVRVIDNAYSMTEKPSKPVKPLVVALAIFIGLLVSAAVILLRQAFYRGVESPDVIEK
LGVPVYAGLPYSASQDQLNRSRKSRDGKTRLLSLTEPTDLAVESLRSLRTSLKFAMLEARNKVLMITSPTPSVGKSFVSS
NLAAVIAQTGQRVLLIDGDMRRGYLHTLFGMAPRHGLSDALASGLSLAEITNRTELKNLHFISAGFSAPNPSELLMHDNF
TRLLREAEKLYDFIIIDTPPVLAVTDAVLVAQQAGTNLLVARFGLSTSSQIDASKRRLAQNGVLLKGVILNAVKRKASTS
PYDSGAYGYYTYTQQA
>gnl|bykdb|A0A023Y3V2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Stenotrophomonas rhizophila] (length=738 residues).
MTSQESRATPSDEADEIDLRQLLGTLIDHKWWIAGITGLCLAVAASYALLATPIYRADAVVQVESKMPSLPGLSDLSQSL
GMGTGSAEASTEIALITSRSVLGSAVEELKMDIEIEPNRFPIIGAYLARRAERSAPDQLAEPRFGMSRFGWGGDKLEIFQ
LNVPSRLIDTDLTLIAGPKVGQYSLYDADGNLILKGVVGQPAKSGGVVIQVASLNANPGMKFWVSKLRTLSVVGDLQKQV
GVTEVGKDSGVLSLSYENSDPVLAQEFLQQVAQAYVRQNVDRNSAEASAQLSFVREQLPSVRIQVDAAQDALSAYQTRAN
SVDISLQTKGLLDQEVAVETSIQQLRMQQAEMDRKFTRDHPAYQALMRQISGLQGRKSGFQSQVRQLPDAQQELLKLTRD
LKVSNEIYTGMLNQAQQLDVAKAGTVGNVRIVDAAAVDATTPIKPRKPMIVLIGTIFGALLSIGIVLLKQMLNRGVEDPS
QIEELGLPVYASIPVSPKQETDSVRGSFRADGKLHLLAVKDPADLAIEAVRSLRTSLHFARLEAKNNVVLISGSSPNAGK
TFVSSNLAAVIAQAGQRVLIIDADMRKGTLHKAMGVKQTPGLSDVLVGKVSATDAIQVLPGLEHLSFITRGDVPPNPSEL
LMHENFTRLLETVARDYDLVIIDTPPILAVTDAAIIAHHAGTCLLVARFGLNQPKELALAKKRFEQNNVKLKGAIFNAVQ
RRATGYYSYGYYEYKSTE
>gnl|bykdb|A0A023YUU5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli O145:H28 str. RM12581] (length=726 residues).
MTTKNMNTPPGSTQENEIDLLRLVGELWDHRKFIISVTALFTLIAVAYSLLSTPIYQADTLVQVEQKQGNAILSGLSDMI
PNSSPESAPEIQLLQSRMILGKTIAELNLRDMVEQKYFPIVGRGWARLTKEKPGELAISWMHIPQLNGQDQQLTLTVGEN
GHYTLEGEEFTVNGMVGQRLEKDGVALTIADIKAKPGTQFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDDPQ
LITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDNQL
NELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISK
SSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEHGISVYATIPMSEWLDKRT
RLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSD
QKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDH
YDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGY
SYSEKE
>gnl|bykdb|A0A023YZ70 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli O145:H28 str. RM12581] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQSSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDDK
NYTLSSDGGFSARGQAGQMLTKEGVTLMVEAIHARPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDQDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGVKRYKQSQLLALGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A024EI12 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas mandelii JR-1] (length=742 residues).
MQLPSVVSTRDKDRDEIDLLGLLGTLIDHKWLIGAITGAFMVTGAAYSILSPPVYLANALVQVEPKKNDMLGFSDISSML
GGQSPAATEIGIIKSRAVIGKTVDDLHLDIVITPNTFPVIGGFLARRYKSGPAESVSPPRFGMNSYAWGGERLYIEQLDL
PAELLGKKLMLVAEERNRFKLYDDNGGLLAEGATGEAIAQEGVEVLIASMAANPGTKFEVVRNPRIVTIQNYQDALDVSE
QGKESGIISLALASTDYTLAVKILNKISRLYVQQNVQRTSAEAAQSLEFLQAQLPQVKEDLVKASNALNSYQTHGNTVNI
SLETKSVLEQMVVLDTRISDLKLQQADMDRKFTREHPAYRALMAQMGDLNKQRQGLEKKVQGLPATQQELLNLTRDVEVA
TQIYTQLLNKSQELDIVRAGAVGNARLIDTADVDITTPVKPRKALIVLIATLLGGFVGVALVLVRKSLSRGLEGPEAIEQ
LGLPVYASIPYSTLQQEEDTKKVRQGDGANSQSFLLALRNPTDLSIESIRSLRTCLHFAGLDATNNRIMISGPSPQVGKT
FVSSNLAAVIAQSGQTVVLIDADMRKGHLHKTLATPISNGLSDLLTKRCSIEQAINKLEVDNLHFISRGQVPPNPSELLM
HANFRELLAELSELYDVVIIDTPPLLAVTDAAIVGREAAINLIVTRFGVNPAKEIELTIRRFAQNGIELKGAIFNGVEKR
ASSYYGNGSYGYYNYEYASDKS
>gnl|bykdb|A0A024GWE4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella pneumoniae] (length=718 residues).
MSSLINKTSSRDSEGIDLGRLLGEFIDHRKLIISVTSLCTLIALIYAIFATPIYQADALIQVEQKQGNAILSNLSQMLPD
SQPQSAPEIALIQSRMILGKTVDDLNLQANITQKYFPLFGRGFARISDAKPAEITISRLFVSGSDNETPELLLSVTGEKD
FLINFDGHSFKGKLGELIERNGISLKIDDINAPPGTEFIIKYVSRLKAISELQDKLTVNDQGKDTGILNISLTGDNPVLI
EKIVNSIADNYLAQNIARQAAQDAKSLDFLNKQLPEVRSELDIAESKLNEYRRQSDSVDLSLEAKSVLDQIVNVDNQLNE
LTFRESEISQLYTKEHPTYKALLEKRKTLQDEKAKLNKKVSSMPETQQEILRLSRDVESGRAVYMQLLNRQQELSIAKSS
AIGNVRIIDNAVTQPKPVKPKKILVLLIGVVIGLIISIGLVLLRVFLRRGIESPEQLEELGINVYASIPVSETFAKKTTQ
KNSWKGKDDIQGFLAIENPADLAIEAIRGLRTSLHFAMLESRNNILMISGASPNAGKTFVSSNLAAIIAQTGKKVLFIDT
DMRKGYTHKLFNIPNDNGLSDVLSGKKDFSSSVKHIPMLGFDVIPRGMVPPNPAELLMHKRFGELMSWADQNYDMVILDT
PPILAVTDAAIIGNYAGTTLLVSRFELNTAKEIDISIKRFEQSGVPVKGCILNGVVKKASSYYGYGYNYYGYSYKDNK
>gnl|bykdb|A0A024HBX9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas knackmussii] (length=742 residues).
MQQQPAIAMQDHDDDEIDLLGLLGTLIDHKWLIAGITAGFMAVGVAYALLAPPIYRSDAIVQVEPKKPTIPGLSDMGDLL
GAQSEAITEIQLLTSRAVIGKAVDNLKLNIVVKPSRFPLVGGFIARHFQPETTTEVAAPLFGLSRFGWGGEELKIFQLEV
PEVLLEKDLTLIAGENGGFTLLDDDDNVLVEGKVGQAYDQNGVKLQVEKLQANPGTHFNVVRERRLTTILDYQDNLNVSE
TGKESGIISLSLENDEPDRALQVLDEISKLYVRQNVERASAEAASSLEFLRGQLPDVRRDLEKAEDALSSYQTRAKSADI
SLETKALLDQIVALDTNISELKLQQAEMDRKFTRQHPAYQALQKQIGELTSKQNGLSRKVEGLPATQQELLGLTRDVQVS
TAIYTQLLNKAQELDVMRAGAVGNVRIIDTADVDTTKPVKPKKPLVVLVATLLGLFFAIGLVLLRKALNRGIETPDAIEQ
LGLPVYASIPYSVLQKAEEDKRDKGRGRAAKAAPLLAISHSTDLAIESLRSLRTSLHFAMLEAGNNRLMISGPSPAVGKT
FVSSNLAAVIAQTGQRVLLVDVDMRKGYLHKVLNSGEENGLSDLLVKRCDFATAVRTTDIEGFHFIPRGQIPPNPSELLM
HPNFTAFLEEASKQFDLVILDTPPLLAVTDAAIVGRQSGTNLIVTRFGLNPAREIDLTIRRFAQNGIELKGAIFNGVEKR
ASAYYGYGGYGYYHYEYKSDKA
>gnl|bykdb|A0A024IWS2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhizobium radiobacter] (length=760 residues).
MLQRHDPLTMTDYDKSGLTADFIDIDAALAMIRRQWRIVLAAIVVAGAIGLAFAATAVPIYSATATLLIDRNNSQIVEQL
STIGGVIEDEASILSQVEVLQSETIGLAVVDSLNLTENQEFRATRASLLSSIFSTVRSLVNVSQWFSPVKKETVIDDGTL
KRSLSDRLLQGLSVKRIGRTYALELTYNSTSPVLAAQIVNAVASAYLVDKLNSKYEATKRASDWLSDRIAELRQRALETD
LAVQKFRAEHNLIETGTSGLLSDQQLAASNSALILAQSDTARARARVQRIEYILATDDVDAVVTDILDSAVANDLRKKYL
ESSKLEAEITSRLGSNHVQAVRLRNEMQEYRRLMFQEISRIAQSYKSDLEVSEAREKSLAESVAKATNVSTSASQTQVQL
RELQREAETYKNMYQTFLQRYQEAMQQQSFPVTEARVISKAMPPYTPSKPNKTMILALFMIMGAAAGGGIAVFREFRDRF
FRTGEQVRDVLGLEFLGNTPLVQGKPGADTLKDQGDASSATRPSSVARYAVDHPLSSFAETLRSTRLAMDLGIASKHGAR
VVGVVSALPSEGKSTISINLAQLLAGQGARVLLLDADIRNPGATRALARHATEGLLEVLLEGRNIRDVLLHDEKTRLAFL
PTVVKQRVPHSSELLTSPQMHKLLAEAGSVFDYIIVDLPPLGPVVDARAMASRIDGFVFVTEWGKTARRAVRNTIENEVH
IRKKCLGVILNKVDTEKLKLYRAYGSSEYYHSRYTRYYHD
>gnl|bykdb|A0A024IY09 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhizobium radiobacter] (length=782 residues).
MHHKTFKSNIGFPESGKDSDTFIDLDRLWAAVVRRANVIAASVIAAVVLAGLYLVLATPVYTAMTQVLLDESLSRYAEEE
SPVPAAQIVDNRIASAVEILKSKEMALTVVDKARLYENDTIVNPPMSPVELVKSSVRGILDLVLPGDPPVSEAAIRAGRR
EKAAAVLQQSLTVERVGRSSVIAISTRSTDRQLAAQIAKTYAQAYLTEQLNANFDASERASVWLQERMTDLNQRAQAAEL
AVQKFRSDNNIVSSRGELMSESQLADLNGQLIAAQADAATASARYNQYKSIIDRGPETAVDNAVVSARDTDNSVIQDLRK
RYITISDRQRGIVQQFGADHPQAAALDAEKKEVSQQIFQELQQLTGSFKNEYDVANSRVQSLRDNIDKVAGRNSEANITM
VKLRELEQRATALRTLYQSYLGRFEEASQKQSLPIAKARIISEAGLPTSPSSPKKTMTMALSVILGLMLGGGIAALLEFR
DRFFHTGNDVRDNLRMRFLGYLPFIGERGVENAKTGNSAATPGGENATLDESGQVSFQKMLRLAVDSPRSSFAETLRNVK
LTADVVIQERQCRVIGVISCLPNEGKSVVALNLAGLIASTGKRTLVVDADIRNPGLSRMLTTRQSAGLVEVVLDEVPWTQ
AVKVDTRTKMGILPVSTSNQFAHSSELLSSSGMRKFIDSAREACDYIIVDLAPVVPVIDAKAFAPQVDGFVFVTEWGKTP
IQMVQNLMANEPQIANKTLGIVLNKTDMTELQRYAGPGGSEHYHEKFSAYYGDAKPPVKEDA
>gnl|bykdb|A0A024L581 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=726 residues).
MTTKNMNTPPGSTQENEIDLLRLVGELWDHRKFIISVTALFTLIAVAYSLLSTPIYQADTLVQVEQKQGNAILSGLSDMI
PNSSPESAPEIQLLQSRMILGKTIAELNLRDIVEQKYFPIVGRGWARLTKEKPGELAISWMHIPQLNGQDQQLTLTVGEN
GHYTLEGEEFTVNGMVGQRLEKDGVALTIADIKAKPGTQFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDDPQ
LITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDNQL
NELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISK
SSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEHGISVYATIPMSEWLDKRT
RLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSD
QKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDH
YDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGY
SYSEKE
>gnl|bykdb|A0A025CAW1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli O145:NM str. 2010C-3526] (length=726 residues).
MTTKNMNTPPGSTQENEIDLLRLVGELWDHRKFIISVTALFTLIAVAYSLLSTPIYQADTLVQVEQKQGNAILSGLSDMI
PNSSPESAPEIQLLQSRMILGKTIAELNLRDMVEQKYFPIVGRGWARLTKEKPGELAISWMHIPQLNGQDQQLTLTVGEN
GHYTLEGEEFTVNGMVGQRLEKDGVALTIADIKAKPGTQFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDDPQ
LITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDNQL
NELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISK
SSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEHGISVYATIPMSEWLDKRT
RLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSD
QKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDH
YDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGY
SYSEKE
>gnl|bykdb|A0A025CDF5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli O145:NM str. 2010C-3526] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQSSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDDK
NYTLSSDGGFSARGQAGQMLTKEGVTLMVEAIHARPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDQDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGVKRYKQSQLLALGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A026UYC2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli O174:H8 str. 04-3038] (length=726 residues).
MTTKNMNTPPGSTQENEIDLLRLVGELWDHRKFIISVTALFTLIAVAYSLLSTPIYQADTLVQVEQKQGNAILSGLSDMI
PNSSPESAPEIQLLQSRMILGKTIAELNLRDIVEQKYFPIVGRGWARLTKEKPGELAISWMHIPQLNGQDQQLTLTVGEN
GHYTLEGEEFTVNGMVGQRLEKDGVALTIADIKAKPGTQFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDDPQ
LITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDNQL
NELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISK
SSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEHGISVYATIPMSEWLDKRT
RLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSD
QKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDH
YDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGY
SYSEKE
>gnl|bykdb|A0A026V0I6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli O174:H8 str. 04-3038] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQNSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDDK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHARPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEEEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGIKRYKQSQLLAMGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A027ZN09 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli O69:H11 str. 08-4661] (length=726 residues).
MTTKNMNTPPGSTQENEIDLLRLVGELWDHRKFIISVTALFTLIAVAYSLLSTPIYQADTLVQVEQKQGNAILSGLSDMI
PNSSPESAPEIQLLQSRMILGKTIAELNLRDIVEQKYFPIVGRGWARLTKEKPGELAISWMHIPQLNGQDQQLTLTVGEN
GHYTLEGEEFTVNGMVGQRLEKDGVALTIADIKAKPGTQFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDDPQ
LITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDNQL
NELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISK
SSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEHGISVYATIPMSEWLDKRT
RLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSD
QKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDH
YDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGY
SYSEKE
>gnl|bykdb|A0A027ZTZ7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli O69:H11 str. 08-4661] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQNSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDNK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHARPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A028E5K3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli O118:H16 str. 2009C-4446] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQNSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDDK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHARPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEEEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A028E5X7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli O118:H16 str. 2009C-4446] (length=726 residues).
MTTKNMNTPPGSTQENEIDLLRLVGELWDHRKFIISVTALFTLIAVAYSLLSTPIYQADTLVQVEQKQGNAILSGLSDMI
PNSSPESAPEIQLLQSRMILGKTIAELNLRDIVEQKYFPIVGRGWARLTKEKPGELAISWMHIPQLNGQDQQLTLTVGEN
GHYTLEGEEFTVNGMVGQRLEKDGVALTIADIKAKPGTQFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDDPQ
LITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDNQL
NELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISK
SSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEHGIRVYATIPMSEWLDKRT
RLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSD
QKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDH
YDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGY
SYSEKE
>gnl|bykdb|A0A029HYQ8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli 2-005-03_S4_C3] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLIGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQSSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDNK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHARPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEEEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGVKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A029ISR3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli 2-005-03_S4_C2] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLIGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQSSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDNK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHARPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEEEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGVKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A031G1R7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas sp. RIT288] (length=742 residues).
MQLPSVIANRDNDQDSIDLLGIFGSLIDQKWLIGAFTGAFMAAGVAYAVLATPVYLANALVQVEPKKNDMLGFSDLSSML
GGQSPSVTEIGIIKSRAVIGKTVDDLRLDIDVTPNAFPLIGGFLARRYRGETEFSVAPPRFGFNSYAWGGERLEFTRLNL
PKELLGKKLTLVAGEQQHFQLLDDNDNLLVEGVAGEAFAQDGVEGLIERLQANPGTRFEVVRNPRIVTIQGYQDALDISE
QGKESGIIRLALASADAAEAVKILNKIAALYVDQNVRRTSAEAAQSLAFLQSQLPQVKRDLAKASDALNAYQTHGKTVNI
SMETQSVLGQSVALETRISELKMQQAEMDRKFTKQHPAYRALMSQIGELTQQQKSLEGKVGDLPATQQELLNLTRDVEVA
SQIYTQLLNKSQELDIVRAGAVGNVRLIDPADVDLSSPVKPKKALIVLIATFLGAFVGVALVLLRKSLSKGLEGPEAIEQ
LGLPVYASIPYSALQRDEDTKKGRVKSTAETPAYLLALRNPTDLSIESIRSLRTCLHFAALDSTNNRIMISGPSPQVGKT
FVSSNLAAVMAQSGQRVLLIDADMRKGHLHKTLNVPITNGLSDLLVKRCSIEQAVNTVEIDNLHFISRGQVPPNPSELLM
HANFRDLLAELSQRYDVVIIDTPPLLAVTDAAIVGREAGISLIVTRFAVNPAKEIEATIRRFAQNGIELKGAVFNGVEKR
AASYYGNGSYGYYNYEYASDKS
>gnl|bykdb|A0A031HX56 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. RIT328] (length=714 residues).
MNKMSALAETEEASRFDQSRHVGRRAVTLRSVGDAIRRRWIVVVATAVLVFAAALGAALMLTPKYDAFAKVRITPNAASP
LDFGNTNEQPADQTAVNTEVQVIGSRGTARKVVTQLGLDRDPEFAGKGPANTAIERATSGVLDHLKINRDDKSYLVMIGI
RSVDGAKAARIANTYAATYVAGTADNLMGTAAKQSQSIQDRLRELGAEVQAADARLASYRAQSGISQSGEGGTITDQQIA
PLSMQLATAESEAAAARSALSVAERQNATGGTDAISAVLSSGVIADLRRQRTEAEKRRAELSSRYGPRYPLSIQVAEQIE
SLDQQIRQEAQRVVGGLRSQALSAEARAASLRGRLNTLQRGVARDDQASVMAGSLERDAEAKRTAYTRLAQAAQQSSQAQ
RVSTPQANIIENATIPTKPTFPQVKAFAAAGLLIGLVFGLAGVLLFEGLSSTIRKPEDIETLLGLSFVASVPRLPTPWKL
RAHRVTNPATTLVAKPMTVYAEAYRAIRAFVVTRNQTQPTKVIALASTLPGEGKTTSALSLARVMAMSGDRVLLIDCDVR
RAGVLRALNRSVDTGLADVLEGRSTMAQAVIPDEVDGLDLLLVQGSLFTPIDLFGGGRMEAMLEAARSRYDFIILDTPPL
LGIADARTLVGLADAVMLVIKWNATPIAAVDAALAGLEHSHGEVLGAVLTMVDHRSEAMGGLYYSARYSSYYNE
>gnl|bykdb|A0A031I299 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. RIT328] (length=733 residues).
MNMVIPLSGSGGGVASTMPSDRTPVLRHYLRIAMRWRYVIGGAVTTCILAGIIVTLLMTPKFTAQSTIEISRESDVITGI
QSVQREATAADQEFYQTQYGLLRSRSLAERVASQLRLVDDPKFFRLFRDSSSLPAFELVNGRYPASGRSDRQRRAGEILL
KNLGIEPTRLSRLVEVRFTSPEAALSAKIANAWAENFIQTNLERKVQATSYGRNLLQRQLGQLKERLDASQRQLVGYASS
ERIINLPSQPGPGGAAGERSIVADDLAAINSALAQATADRIQAQARYEQAGNRGASPEALRNQAINTLRQRRAELSADYQ
RLMTQFEPGYPTAVAIKAQLEQLDRAIGNEEGRVSGSLLADYKQAQERERGLQQRVEQLKANYLDLRRRSIQYNIYQQEV
DTNRALYDGILQRYKEIGVAGGVGVNNISIVDLADVPQKPSSPRLILNLALAILAGLIIGAGLALALEQIDEAIADPEEV
GRRLGLPLLGSVPKLDSGTPKEALIDRKSDMVDAYLAVQTNLAFTTAHGVPRSFAVTSTRPAEGKSTTALALATTLARSH
RKVILVDGDMRSPSIHHLGGVGHDAGLSNFLSGQDDITPLVFHMDELGFTAMSSGPIPPNAAELLTGTRLSILIERLLET
YDHVVIDSPPVMGLADAPLIASYVEGVIYAVESHGIRSSMVKTALSRLAGAHAHVVGVVLTKFEAKKAYIGYGYEYGYGY
GRTSGKNNGTKRA
>gnl|bykdb|A0A031J1W8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Novosphingobium resinovorum] (length=689 residues).
MLIGTILLGTIVAGVVLTLLITPKYKANAQVLIEDQADQIIEGSELQKVDAGWDTNRFLQTQLGIIRSRSLARIVIQSGG
FDKKPEFFEALGTTMPDDDKLKGPQLATARQDTAVNVLLENLEVDLPRDSRIATITVTSRDSELAARIANLYADRFIEYN
LNQKYQSSAYARRFLGDQLSEARAKLTQSERDLNQYARAAGLIRVSSQGDSGTQETALSVTNNTLIQLNDAASKAVAERI
TAEDRWNTLARQPALSVPEVNANQAIQQLVGEKTKIEGQLAEEQSRHLDDYSTVKSKRAQIAELNRRILTLAETLKKTAY
LDYVTALEREKSLTAQVNTLRNAALGEQDRGVQYSVLKREADTNRALYETLLSRYNQISAMAGASNNNLTIVDRAEVPRI
PASPKLAVNLVVSFILGLMFAAAAVFMREIFDDAIRTPDDVERKLNMRLLGLIPKVKDGEDIDEAITDHRSGASEAYRSL
VTNLRYSTATGVPQILCVTSSREGEGKSTTARTIARDIAGIGKRVLLVDMDLRRPTLHRKLEMTGASGLTDLLTGNKSFD
DVLLRSEIDNLDFITGLPTPPDPALILSGEGVPAFLTQARERYDVVIIDSPPLLGLSDAVILATHADGVLFVIDGSAFHR
GAVKSALRRLALINANILGVVLNRFEPRVGDDQYAYYAYNYYNYGSDGK
>gnl|bykdb|A0A031J7F7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas paucimobilis] (length=698 residues).
MATIAPNQITQRPRRDDDGGSEGIDIDFPAIWNLLRRNVHLIGGVVAIALLIGVVIVMRAERLYRATATVQIEEQSAKVL
NSEDGRQASGSQEAERFLQTQLSLLNSRAMAQLVVKKLNLASRIPPGPDGRILSPQEREEAAIAKLQSSMSLTLPRDSRV
AQITITDRDPRFVADAANAYAEEFIQYNLGRRFGETSYARTFLENELGKAKKRLEASEVAVVDYARRTRLIDATGGKGTE
DGVRMLTSSNLMDINSALGRAKVERIEAERRWRQAQATPALNMPEVMTNPAVQQLVEKRALSTADYSRDREKFREDYPGM
RDRATELTALNNEVQKIAQTIRGGLRNNYEIAVNQERALASQLESLKTRTVEEQNKSIGYNILRREVDTNRLMYDGLLQR
FKEVSAAAGVTANNISIVDRAEVPNRPFTPRTTMTLLSSLASGFALALVLVGVRSRLDDIIRSPEDVASALDLPVLATIP
SHPSRLSMTEVIEGSSLSEAFWSLRLAVERTSSGGVPRSLLFTSSRSSEGKSTCAYAVALNFARSGRRVLFIDADLRRPT
LHRAIGLPNDKGLASVLAGETTLNDAIRYGVADRLDVLTGGQPTRNPAELLAQPVLASIIAAAEQSYDLVVIDSAPVLLL
ADAIALASAAGATVFVVEANGARAREARAAVQRLDENGARLCGAVLTKYDRELMQYRY
>gnl|bykdb|A0A031JAH8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas paucimobilis] (length=706 residues).
MSFTKMGLEGREEDRAQMIDLRHIVMTIRRRKLWIAATILMVILLTIIAYITAERRYSATASLALDRRVDEIVAQQDQPL
STDSSSVDTEVQVLTSPRLVEEVVDKLKLASRPEFADGPATTPVQARKRTVKKVLNNLDATREGTSYAIAVTYTSPDRHL
AANVVNTVVDQYIEDKLLGRSDERSREVSLLRSRLASLRNEVIRSEAAVARYRAATNLIDVQKDSTSVQQEISALNGQLA
AAQAEAAAAQARLGAMRANGAGSTDAASSTLLRDLRSQQATLGVQRADLAGRYGTLHPDLARIDRQLADIDRSIEQETRR
INASAAEDARVAQGRASSIRSSLNQATAGLRAGNSATVQLNELERSAESARTLYQTLLDRYNKAITGQGTDRSNAYVIAH
AMTPGSPVSPNLPIYIAGGVIAAVFAAAGLVIVLELLENGFQSRGDIEAQLGVPVVGTVPDLATMPNVTLPKGDPMGPPD
YLVANEGSFYSEAFRSIRTALQLGQSQHRVLSVSSALPGEGKTTLSISLARSAALAGQRVLLIDCDLRRRASSKSMTSSV
ENGLIEVLKGDVQLDEALHRDTSTNVWILPQTEAGSTNYDLVASPAMGALLDQVRPAFDLIILDTAPVLPLAEARALASI
ADGVLLVVRWRTTPVQAAQMAIDLLGRSGARILGVAMTIVNMKQHARSGYGDEMAYYHRFKEYYSG
>gnl|bykdb|A0A031JDL4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas paucimobilis] (length=700 residues).
MAGSSIRIDPGVAPAVEEGRAARAVRAARGAWTAVRRHRVILFGTMALCVLAGVIFILLSTPDYKATASVEVEDVPAGAA
GAAAAQRPQAPSDNEALMQTELEVLRSRSLAEEVARELALVGNRTLFDAMKAKRPDRGSGSLSQRQVETEAVIRLLRDNL
EVELPGKSRVIRISFTSADPVLSARVANSYADSLIRADLKRGFESGVQARRFLLGELDGARRDLERAERDLAVYAARTGT
QGEAQDRGPGSAEGSSAARLAQLNAFRAQATADRIAAQKRWESARLSSVETLPEVLNNGAMQQLMAQRAQARAEVVQERQ
FRKDAHPEMREARARLAALDDQAQAMANTIRASLREQYEVAVHGEKQIESEIADVERQALAERGRGVQMSILERSVDTYR
LLHDSLLQRYRDMASQAGFQAGRIQPLDRAAVPPRPSSPHIGTTMLLASLGGLALGLLLVAGRHLFDDAVTSADTLAERA
NLPLLGTVPASDRPAVETFVPIASSLLLASSAGLPRSILITSAQEGEGKSSTVHALALALAKLDRRVLVIDADMRRPRQH
SLFGIAVERGISEVMTGQAKAEDVIVAASAPGVSLLPSGAIPPNPAELLSTPSLDVLLAGLQDRYDTVLIDAPPILGQPD
TSLLAAKAQATVLVVEWGRNHHGGLRVAADRLRRAGGAIIGAILTKQEGRAFEYDYHRGG
>gnl|bykdb|A0A031JZD3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Novosphingobium resinovorum] (length=717 residues).
MNQPIVLAPPPGVIVPPVRPGAAETPDRIDPGILIAFLRRRWPIMLGMLLASLASGFALTATRTPTYLATAEITLDPKVE
PIAPLTDEDRLAAQGGMGETWIDTQVEVITSSDNVAAVVDRLALPRRFARDDRTAAQARQAAIDYVAGGVSAFRSGATYT
LSVSFESEDAQEAARIANAFAAQYTEGGVTEKEAADTRALREIGARMAKASTQASADAAVLSHYRLAHDLPSTSDRSLTE
QEISAYNQEVTSARAQAAEDAARLATARQQLGSGSSGEDVGESLGSPVIASLRQQQSAYAAEIASLSSKYGPRHPDLQRA
RSRLASVDAQIAEEIGRVVSNLSAKAAVSQRRLGSLSGSLRASEGALRRDNVAMVDLQDLEQRAQASRQLYESYLGRYKE
LAARIGIRQPQARVLHPAQPSDRPARPDILLNMVLAGAIGLGLGLACAIAAELMFSGFTTGEEIERRLGLRYLCSIPELG
SVASRKARGDPVDAVVEQPRSAFAEAFRNLRASIAFAVESPRIIAVTSALPAEGKTTVALCLARSMAGASDAILLIDCDV
RRRGVSRWIGGTREIGLLEVLRGDARLEDAIVIDPRTGLSILPLSAAREEDHALLTGPAMDALLAAAGQGFDAVIMDTAP
VLPMADARLLLGKADAAVIAARWRRTPEAAIRSLLRLLPEGAVGLAGAILTRVDVRKQAAFGLDENAFYKAYKDYYA
>gnl|bykdb|A0A031K0W8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Novosphingobium resinovorum] (length=718 residues).
MSNRIHGAAADEISVRATARLFPEASEIGALFFRRRWAFASAFVITLTIAATILALLPRTYTATSTLLLEPRQAEPVKIN
DRGFVAPADDNLIDTAVQVVRSPALTLDVVRQLGLARTREFGGKIDTAASAAERERRTAEILLAQSHVRRVGVTYLVEIS
VSSTDPVNAARIANALAGRYIQLDSTKKQLRNSQSARYVEGQASTLQRQAVADDAALQNYMIRNNLMSAQGATMAEQEVS
ELNRQIADSQAQLAEQRGKLSAAQTQIARGGGGADTGSALASETVRQLRQQEAQASARLAQLDARYGALHPDVVEARDEL
ADVRSQLGAELTRIISGLRGDVQIAESRLGSLLASRAQAKGSLAQNSSAQVGRLELERRAEASRAIYNAYLTREKETAQV
GALPNADATIASVARVPDTPSSPRYLLGALAGLAAAAIAACLTMAVAEYLEDTVATRADIETGLGAVYAGAIPTLSSATR
AKAESILPQDYVTMRPMSLFTESLRNLATYLGLTMSDGTAKVLTITSALPREGKSTTSMCLARTLAIGKQRVVLVDADVR
HHSTSDALLPGRNAEGLFRVLDGTIRIDEALVREDRTGLHILPTLGQRSSEDQITEDAMARLIAGLREGFDIIIIDSAPV
LGVAETRMVSRLSDKTLVIARWRRTPEKAVRTTLDLLAQGGGKVGGVALSLVNIKEFASAGLTDAFGYHKKFKGYYVD
>gnl|bykdb|A0A031K2N6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Novosphingobium resinovorum] (length=713 residues).
MNSAHQIISAGPDPRDLALAPGQSLMLPSARVDLGGSMAFFRRRSGLIALVTGAALAIGAAVTFSMPITYTAEAVVSLLA
PTDTPEAAASAGRQAGPSPNSSYVDTQVETLKSRDLAQRVASALGVLDGKSAAQQAEIVTTYQNNVSAVRSGESYALKVA
FKAPNGQDAAKVANMYAQQFTQIEVKAAHESNTETAKLVAPRLEQLRQQAHADTERLQRYRIANGLLSTSGASLTEQEIS
SYNQEVTKARAEAAESQARLATAQAQLRSGSAGDDVGEALGSGVIGSLRARESQIGGEVANMQARYGPNHPQLVRSRSEL
AEVRSDIRNEITRIMSNLQAQRDVADQRLASLSSSLGAARGNLARNNAAMVGLDELERTAQSSQAMYETYLNSYRQLIAQ
DGTQRPNARVLSLAEVPLLPSSPNIPMNMLLALVIGLGAGLAAAYVAEALFRGVTTSDEVEQGLGSRYLGAIPLLASVSR
KSRREVPAITQEPRSAFAESFRSLRTSIEQAVYGPAQIIAVTSALPKEGKTTVASCLAQTLAVSGRGAILVDCDLRGRGV
SKLLRLSPEHPGLIEVLEGKVSLADALVTGESGLCVLPVKPSDLAHDTLLTGETFTRLLQELRACFDYVVLDLPPVLPIA
AGRTLAGMADATVLVVRWRKTMKGAARSALGMLPRESVNVVGVTINRMDMRRKRLFGYSDPAYFYREYKAYYA
>gnl|bykdb|A0A031LPJ2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter sp. Ver3] (length=730 residues).
MSQTANTEDTIDLKELFFSLIAQWKLIALCVILSLVCALLYLRTTPDTYSVDALVQVEESKGTSAALLGDLSSMIEQKQP
AQAEIEILKSRLVLSSVIESLNLDLRVSGTQNSFFDRLFSPHDYSTSYSRQSVIFNDDEKSFAIPHFDIPQKFRDRALAL
NFTEKQFTLTDLRTEEVVLKGSLNQLNQRSTRDGVWKVEIRTQDQLNDRYIITKQSLPAAMKSLLANYSVAEKGKMTGVL
GLNYQGQDKEHITKVLNTILNAYSQQNVERRSAETAQTLKFLDEQLPELKQQLDVAEREFNKFRQGFNTVDVTKESELYL
TQSVALETQKAELEQKVAEAGAKYTNEHPIMQQMNAQLGAINKKINELDGTLKQLPDLQRRYLQLFREVEVKQQLYTALL
NSYQQLRIAKAGEIGNVRIVDTAVEPIEPIKPKKIQILILSIFLGGFLGTLLALLRNMMRSGIKDSSQIENELDLPVYAT
VPRSLVQESRMKMLKKHKKIPILAIKNSDDIAIESLRSMRTAIHFALSSARNNVIMISGPAPEVGKSFISTNLATILAQA
DKRVLIIDADLRRGYLHKYFNIETQPGLTDYMTDQHSLQNIIRDTEVAGLSVITRGKSPSNPSEILSSKKFKQLLEQLST
QFDHVIIDTPPVLAVTDGIIISQYAGVNIVIARYAKTQMKELEITVNRFEQAGVKVNGFILNDIQRNAAGYGYGYGYNYA
YAYKASKDND
>gnl|bykdb|A0A031MA75 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas bauzanensis] (length=790 residues).
MFDRHRQIGPEHPGSGAVAVPGAWYDPRLHIQDYAYEPPQQEEGIDILRLFLYVVHYRWLLATLVAVGIVCALAVTMMMT
PQYRATARLEVLVPSAKVFQDIEVTSEGSDMRSYLTAREKLKSRSLAQRVVFNLGLGEREDFLFPRPSFSPLNILNRAFG
RSPGGDISQYSADERANMAVDRVLANLSVDPITNTSLLSISYSDQQPRYAYEIANQVAQSFIDQRVDQASDTSSQARKFI
QEQVLQVKERLQQSEEALVDYAKSAGITITGSDSSLIAANLTEINKALALAMQESLDYGRLVQQIDNGQGASLEQVLKSE
GLEKLRGKLAELNAEYQQKLAFFKPGFPEMQQLRSQIREIENQLNLGIAAVTDSIRIKHTETLAKVQDLRNKLAELEAEQ
VAYQDKNIRYTILKREVDSNRSQYENLIAKLNEVAVGSELRNQNAAVVDMAVMPRSPYSPRLPVNLAIGLVLSMVIGAAA
VYVLELLNNTFTNPEQVEKELRLPILGILPAIDDREFGQAVADPRSGLSESYRSLRTSLQFSGEQGAPRVLLVTSSEPSE
GKSTTVFKLAEDFGALGAKVLVVDADLRKPVVHRIFKVDNIVGLSNVLTNTIRRDDLPKLIKPVGGNVSVMTAGMIPPNP
ADLLSSSRMGLLLQKLSRSYDLVLIDSPPIIGLSDAPILSRLTEATLLVVSSNQVTRKAARAALKRIQAAGSNVLGVAMT
KFAVRKLDYNYSYKYLSYNYYSYGDETPKLESKGGEGGSSTHAKNWSLASVSGRVRKHLRDLGDRIKSAS
>gnl|bykdb|A0A031MAZ6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas bauzanensis] (length=741 residues).
MQNITSPYRNQSSTDEIDLAVLFGALIDGKWIIAGLTLGFALLGMTYAILTTPIYQANALIQIEEKSGGLAGMSELSDVF
GGPSKAVTEIELIKSRAVIGQAVTNLKLDTVAAPNYFPVFGEWAARRFQPEFAGELALPWFGLVEYAWGGEELEIFQLHV
PTAYLDTPLTLVAGAHDYFSLYDGNDEQLLTGQVGQQVEQNGFRVQIARLQARPGTRFTVARNRLLNTIMYFQSELDASE
RAKDSGIISLSLQHADHQYAIRVLDEVSRLYVRQNVERNSAEAAQSLQFLREQLPQVRSELERYEQALNDFQMSSRSVDI
SIETQSVLNQIIELDTLISEQELKRTELQRRFTGEHPSYQILLEQTQQLQRQRNELSKKVDELPETQQELLRLSRDVAVT
TEVYTAMLNRSQELDVLRAGTVGNVRIIDAADASVSRPVKPRKTIVTILATLFGGFLGVALVLLRQMHNRGVENPELIEQ
LGLPVYAAIPFSKDQEHLEKQMRSNSRAAQRDSLILALKNPADLAVESLRRLRTSLHFAHAEAMNNVLMISGPSPSVGKS
FVAVNLAASMAQTGQKILLIDADMRKGYLNKVFRLPARDGLSDLLTARIDIDTAIQRTEMDNLHLMARGRIPPNPSELLM
HENFRRFLREIDDRYDLIIIDTPPVLAVTDASIVGREAGISLLVTRFGQNSAKEIEAAKRCFEQDDIQLKGAIFNAVIKK
SPAYGYSQYGHYFYEYKSEKA
>gnl|bykdb|A0A031MK69 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas bauzanensis] (length=739 residues).
MQNTPAVAPPKSSDEIDLLALLGALLDNKAIIIACTAFFAVVGIAYAVLSTPVYQANGMIQIEEKSSGVGSLLGDSEMFA
TSSPAVTEIELLKSRQVIGQAVDNLKLTIVAEPKLFPVIGPFMNRRFQAEPEQPVADAFLGFDSFAWGGERIDIFQLEVP
PALEGEPLVLVTGENGAYTVFNEDSQELVAGTVGEAVDVDGFKVQVAELTARPGTEFDVVKRGRLSTILGLQREIAASER
GKDSGIMTVALQHTKPAFAMAVLDEVSRLYVRQNVERKSAEAQQSLEFLTDQLPKVRKDLEQAENALNAYQATSGSVDIT
IETQSILEQVVELEAAISELTLKREELQRRFTRDHPSYQALISQMGQLEGRRDRLLDEVGGLPETQQELLRLARDVQVST
EIYTQMLNKSQELDVMRAGTVGNVRIIDNAAVDTSAPVKPKKALIVVLATLLGGMLGVAIALLRHALNRGIENPELIEQI
GLPVYASVPFSKDQEVMERGFKGKPSHVQGSHLLAATNPADLSIEALRSLRTSLHFAMMEAKNNILMISGPSPGVGKSFV
SANLAAIVAQSGQKVVLVDADMRKGYLHKLVNMNPEPGLSGLLVHTHTLADVMHKTEVEGMHFISRGTIPPNPSELLMHS
NFQALLDQLSSMYDLVIVDTPPILAVTDAALVGRLAGTSLIVTRFGLNPVKEVELTVQRFRNNGIEIKGAIFNAVQKKAA
AYGYGNYGYYQYEYKSDAK
>gnl|bykdb|A0A034TF73 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio sp. JCM 18904] (length=722 residues).
MTTQTIKQSRQADDEIDLGKLFGIILDAKWLILCTVVLFSIIGVGVAILSTPIYKADALIQIESKSSGGISAMVGDMGEL
FSAESSATTEIEIIKSRMILGGTVDKFNLTTVVSPNYMPIIGKGLARLQGEQISLSVSRFNAPSYAVGVPLTLEVIDSEK
QTFRLLEDDNNVILEGKVGELLEKNGYQFLATELVAQTGDSFTVSKISKLDAINKLQENLSISERGKQTGIISLSFSGED
RAKIQDILNDISQNYFLQNVQRNSAEAEQSLEFLKGHLPDIKTKLTASEDVLNRFRQENESIDLGLEAQSTLKVMVELEA
QLNELTFKESEISQRFTQDHPAYKSLLDKRETLLKEKERLNKQVQKLPKTQREVLRMTRDVEVNQQIYIQLLNKVQELNI
IKAGTVGNVRILDNAQSFSKPIKPKKALIVVLATLLGGMAGVAFVLIRAAFHRGVETPDQIEQIGMPVYASVPKSIQQLE
FANKLKRNKGSNNELVLLAEANPADLSIEALRSLRTSLHFAMMEAKNNVLMISGPAPSIGKTFVSTNFAAVAAKTGQKVL
LIDADMRKGYLQQCFGLRWDNGLSDYLSGKTSLSNIIKSTSIDNLDVVTRGQVPPNPSELLMHPRFKSFVDEMSAQYDLV
IIDTPPVLAVTDPSIVGALAGTTLMVARFDQTTLKEIEVAQGRFEQSGVEVKGVILNAVEKKASNSYGYGYGYYNYAYKS
ES
>gnl|bykdb|A0A034TFG1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio sp. JCM 18904] (length=716 residues).
MNKVELIRFGHHFKAIKKNWLSIAAFTLLFSLTCTWYIYSKASIYQATATLLIQEEQKSALSIEEVYGVDTTKKEYFQTQ
IAILKSNHIADKVIRELNLTQLPEFTSSGGVNKKIDQIKSIPFVQDLLNVAPSPKETAQFSESYYQALQAFRSKLDIEPV
RNTQLVRIRFRSTDPKLAMTIANAVGQAYIDANFEAKLVVTQNAATWLTNNSQKLEERLRNSEQALQEFLLKEGLIDING
IDEIYANELEELTRKLNIAVNKRIEAQTLIQLLRRKSSQSLDSLLSIDEFANQAQIRDLKLSEAQAAKNLSELAQRYGPK
HDRMIQAKAQLAEIQSRTQQLIRDISFSKQQDLLAAKAQEDMLRAELDNKKSDFQSLGSQKARYEQLKREVESNKALYEA
FLNREKETNATSDYKNVTARFTDKAIIPLFPVAPQRIKLVLIATFFGFAIACALVIILETMREVIRSTADVQEKLGVTCL
GVIPMVKKRNLRKNGVSYSAYLDDEEKLFSEACRSVRTSLLLRLTNTKQKILPFTSAIPEEGKTSTSINMAVSFSKMEKV
LIIDCDLRRPSIAKRFGIAESSPGLTHILTMDTPIKDCVTHIKEANLDVLPAGLVPPNPQELLASDRFKKLLEHFQNKYD
RIIIDTPPLLSVSDALILGKYANGLITVIRSESTKSSLVNLALSKQIQHSVPSLGVLITQAKAKEGETLYVQKYAY
>gnl|bykdb|A0A034TR42 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio sp. JCM 18905] (length=722 residues).
MTTQTIKQSRQADDEIDLGKLFGIILDAKWLILCTVVLFSIIGVGVAILSTPIYKADALIQIESKSSGGISAMVGDMGEL
FSAESSATTEIEIIKSRMILGGTVDKFNLTTVVSPNYMPIIGKGLARLQGEQISLSVSRFNTPPSYAVGIPLTLEVIDSE
KQTFKLIEDDNNVILEGKVGELIEKNGYQFLATEMIAQDGASFTVSKVSKLDAINALQQNLSISERGKQTGIISLSFSGE
DRAKIQAILNDISQNYFLQNVQRNSAEAEQSLEFLKGHLPDIKTKLTASEDVLNRFRQENESIDLGLEAQSTLKVMVELE
AQLNELTFKESEISQRFTQDHPAYKSLLDKRETLLKEKERLNKQVQKLPKTQREVLRMTRDVEVNQQIYIQLLNKVQELN
IIKAGTVGNVRILDNAQSFSKPIKPKKALIVVLATLLGGMAGVAFVLIRAAFHRGVETPDQIEQIGMPVYASVPKSIQQL
EFANKLKRNKGSNDELVLLAEANPADLSIEALRSLRTSLHFAMMEAKNNVLMISGPAPSIGKTFVSTNFAAVAAKTGQKV
LLIDADMRKGYLQQCFGLRWDNGLSDYLSGKTSHSNIIKSTSIDNLDVVTRGQVPPNPSELLMHPRFKSFVDEMSAQYDL
VIIDTPPVLAVTDPSIVGAIAGTTLMVARFDQTTLKEIEVAQGRFEQSGVEVKGVILNAVEKKASNSYGYGYGYYNYAYK
SE
>gnl|bykdb|A0A034TVH4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio sp. JCM 18905] (length=727 residues).
MNGTHPNNLQMNKVELIRFGHHFKAIKKNWLSIAAFTLLFSLTCTWYIYSKASIYQATATLLIQEEQKSALSIEEVYGVD
TTKKEYFQTQIAILKSNHIADKVIRELNLTQLPEFTRSGGLNQKIDQIKSISFVQDILNVSPSPKETAQFSESYYQALQA
FRSKLDIEPVRNTQLVRIRFRSTDPKLATTIANAVGQAYIDANFEAKLVVTQNAATWLTNNSQKLEERLRNSEQALQEFL
LKEGLIDINGIDEIYANELEELTRKLNVAVNKRIEAQTLIQLLRRKSSQSLDSLLSIDEFANQAQIRDLKLSEAQAAKNL
SELAQRYGPPKHDRMIQAKAQLAEIQARTQQLIRDISFSKQQDLLAAKAQEDMLRAELDNKKSDFQSLGSQKARYEQLKR
EVESNKALYEAFLNREKETNATSDYKNVTARFTDKAIIPLFPVAPQRIKLVVIATFFGFAIACALIIILETMREVIRSTA
DVQEKLGVTCLGVIPMVKKRNLRKNGVSYTAYLDDEEKLFSEACRSVRTSLLLRLTNTKQKILPFTSTIPEEGKTSTSIN
MAVSFSKMEKVLIIDCDLRRPSIAKRFGIAESSPGLTHILTMDTPIKDCVTHIEEANLDVLSAGLIPPNPQELLASDRFK
KLLEHFQNKYDRIIIDTPPLLSVSDALILGQYANGLITVIRSESTKSSLVNLALSKQIQHSVPSLGVLITQAKTKEGETL
YVQKYAY
>gnl|bykdb|A0A037UQM4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhodomicrobium udaipurense JA643] (length=759 residues).
MQDTFRGGADDHPRGSQALVRAEAYAVAPARLGYASVGYGAAPEEEEKLAVSFRRYAHLLGKHKWVIMGMILMSCVLGAI
HTLLKTPLYAANVRIQIEREGAKIVESGTTSPTETGSADFLRTQYELLKSRAMAERVTSALYLYKDDSFFKPRDVSTLGL
ITGYFSRPTSSQASKVATAADILMNAVTIKPVPGSRLVDIRYLDPNPQRAQIIANGYADAYIASNLNRRFEANAYAKTFL
DDQIKQLQIRLQESEQALIDFAEKEGMVEVNDKASIAENSLAAANTAAGQLISERIKNEQLWRQVESTNAINLPQLLTNQ
VVDTLRGQRKALETEYQEKLENFKPSYPEMVQISNKIKEVYRQLAAEVKAIRNSLKAAYQSSLAQEVEMKGRIEELRAEV
IDLQKKGIRHNILKREVETNRNLYNSLLQRLKEVDVAGGVGANNIFIVDRAVAPNFPSEPSLSRALFLAFGFGLIIGIGF
SLLLEMLDDRVRASEEVEEISGLPTLGIIPRDESEMELNLVLKDPRSHVAEAYRSFATALQFSTDTGLPRSIAVTSAGAG
EGKSTTAVAIARHFAQMGLKVLLIDADLRRPSLHIKLNLDNSIGLSNYLTGSSMPPDLVQRTDHPNLAFMASGPLPPNAA
DLLSGPRIYSLISLGSDVFNLIVFDSPPVLGLADAQLLSSASAATVFVVGAGDNRKGALRAALRRMSMARVTLLGTLLTK
LDSKSVGYAYGQGYDYKYGYHMNDDEADGSTQTPQLARY
>gnl|bykdb|A0A037UVU3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhodomicrobium udaipurense JA643] (length=763 residues).
MRDSQRDLGDERRALVPSQSAAIAQLKGDNYGPQGYGQSPGEEESDLAVVLRQYLYMVLKRKWLILGTALVSTVLGSVFT
LLKTPLYSASVRIQIEREPAKILEGGTTSPTEAGTTDFLRTQYELIKSRAMAERVVSMQRLYDDVGFFKPRDVSALGLLG
AALFSSSKKELPLPTARQGWAVGIVLSNVAVLPVANSRLVDVRYSDPSAVRAQQIANGYADAYIASNLDKRFEANSYAKT
FLDDQIKQLKIRMEEAEKALLVFAEQEKMVEVSDKASIAENNLAAANAALGQLISERIKNEQLWRQLESSTAINLPQLLS
NPVIEVLRGQRKALETVYQEKLENFKPSFPTMVQISNKIKEIDRQLAAEVKTIRNSLKAAYETSLAQESEMKGRIETLRG
EVLDLQKKGIQYNILKREVETNRGLYNSLLQRSKEVNIAGGVGTNNIFIVDRALVPDAPSEPNFPRALLISLALGLCTGI
GISFMLEMLDDRVRTPEEIEQLSALSTLGIIPRQEFAEGLDQALKDPRSAIAEAYRSLATTLQFSTESGLPRSIAVTSAG
PGEGKSTTSVAIARHFAQMGHKVLLIDADLRNPSLHKKLRLNNVVGLTNYLTGQSLPPEVLQRTDHPNLAFMASGPLPPN
AADLLSGTRLYSLVSLGGDVFDLIVFDAPPLLGLADAQLLANASAGTIFVIAAGEKGKGMIRSALRRLQLARITLLGAVL
TKFDSKAVGYNYGYGYGYEYGQSAYTYGNSTDAKPQLAKPGLN
>gnl|bykdb|A0A037ZJF8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Actibacterium mucosum KCTC 23349] (length=709 residues).
MTDVNIPPQDTLNLRDLLSVLRRRIRLILFTVLLGVGAALVVLFQLQPEYRSTVLLLVDPTQKNLLNPGDAERLQSASES
SRVESEVEIARSGPVLLETVRTLSLVTDPEFGPQVSMGDKVRAALGLPLSTVQNSEALLNGTLQRLSRATEVRRRGLTYL
ISITVTSKNPERAATIANTMAQVYIDLQIASKTRSVESARDLLFAQVNSARETLANTNDSFDSYIGANIDRLQSETGNAR
LLTLQDQLLQSEAARSQAELVISASQDALTSRDWSTLANSLEDEALAALVQQREALVASVSTAASGSQQALDLQAQLARL
ENSIEAGATSQLSSLRADVDGIDAQGDALREQLRNEVVSSDLSSTTLAQLYGLRQEADIAQRQYTNVLSRLRDLDAEALV
QVADSRIVSEALKASRPSFPNTKTLLAIALFASVGVGVGLALLNEFYVGGVISATQLANILPAQVVGSVPAIRRKRELST
IADTIVTSPLSAYSEAFRRIRMAIEQAISAEDRDSLVILVASANPAEGKSTTSLALARSYAQMGKSVLLIDGDLRKPSIH
SFIDVQPERGLLEYLKSEDEHSDIGEFYVADPLSKVGVIVGRGRSDVPTDQLLMSSKFAEMLNSARKAMDVIIIDTSPLN
SVVDAQYVARHADVALLCFRFGETSQQDIRLAHQRAEESVRPGTPVLALLNHDAGRSGGYYYNSGYYSY
>gnl|bykdb|A0A038GNQ5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Caballeronia jiangsuensis] (length=749 residues).
MVSMKQSTRGDSMHGDNVSISEYFRVVFDSRRLVCAVALGTFALGAFYGALNQPMYRADALVQIGTQTSSSSDTEALGRL
SAIFDSKVKAGADTEMELIRSRLVVGETVRQLHLEVAAHPRYFPLIGRWIARLGSGGWSGSELPFGLRRFAWGDEAIEVS
AFDVPRSAIGRQFLVKAGKDKSFELIAPDGIVLGQGTVGKQLTTPYGNGEVRVLVAALDAPAGCEFTLTANSAQAAILAL
QNALSISERKAQSGMIGIALEGADPLRVADIVNTVAQEYLAQDLARRSSEAEHSLLFLESQLPKLREELQHAEEQYNAFR
NSKGTIDLSTESRLLLQQVVDLDTAMRSLTQQRDDVAQHYQPGYPTLTGINAKIARLQQDREALSRRVATLPDTEQTALR
LMRDVRVDTELYTSLLNSAQQLRVIKAGNVGNVRIVDRAMTPERAVKPNWRVLLSLSAVLGIVLGIAAAFLRRAMIGGVE
RSVEIERALGIPVCAVVPHSERQVRLQDDIRRRHPGVHVLAARSPCDVAVEGVRSLRTALQSISATPRNNVIMITSSTPG
AGKSFLSANLAAVQAAGGKRVLLIDADMRMGNMHASFAPSAGPGLRELLNGDAFDDVVRRDVMDGVDLISRGGDSLNPAD
ILMSGRLSELIHAVSMRYDCVVIDTPPVLAVTDATLIGRQAGTTLFVVRHGRHSVAEVHEALSRLQKGGVSVSGVLFTDV
PADRSTYGSGYGASYGYGSGRGETSIKTA
>gnl|bykdb|A0A038GW57 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Caballeronia jiangsuensis] (length=783 residues).
MNTLYVNSGSSRPGKDDGEFTASDMLRLLRDHLGILFLFIGITAALATAYAFLATPIYSSDVVVRVDPPDPNALGIAPQN
QMQMQQSQPTVNQLAPAEISVMQSRSVLEPVVKQFHFDIKVKPTTFPVLGQIADIFAKKGHLSPAWFGLDSYGWGGESLQ
IGRLDVPPSLEDQKLDLVLLDNNQYELRDPDGAMLLRGTIGRPASANGVSILVNSALGHPGVHFDVTRLNTLDAIALMKK
SMKVAESAKDTGVVQITFNADDPALTADVANALGQAYLTAAVQARQANDTKTLEFIRGELPRLESDLRRAEGNLSAFRSK
SQSVQPLNEAQAYLQGSIVSMQQLATLKLQRTQALQRFQPSSPQVVNLNQQISELEASNKQIQQRFDSMPASERQNATLT
RDARVAETIYMGMVNKAQELSVRRASTSGGAHIVDNALRPYRPVKPHKSLVIAAGTGLGFFIGTFFIFLRRHAMIGVTDP
MFVERRLSVPVLGEVLYSRQQAMLDHEIAVSPVEHAPLTYSGAQNGGPPKALPYVHLPEHDAFAMPHVADTDRDARVLAT
RFPHDPAIEALRAVRTELYRDLANAPNNIVMLTGPIPSAGKSFVAANLSVLLAEIGLRVLLIDGDMRRGHIASFFKQSNP
GGLSEVLKGELALGDAIRYVGVPGLSFMSCGGYPENPSELLMMPGFRNMLARMSDQFDLVILDTPPFLVVTDAAIVASDA
GSTVLVLRSGIQSEEEIEETVKKVQRSGGRLVGSVFNAIPRRPSNRRSYGYAAAYTSSFKSAH
>gnl|bykdb|A0A038H1C3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Caballeronia jiangsuensis] (length=744 residues).
MAMNFDTRYTDISTADELRLSDYLAAVMRNWKLVTLVTLAVVALGTAYAYLAPPTYKADAMIQVDEASGNNAKTNASAEA
VQAVVPQLTDTKSVTAAQIELLRSRLVIDDTVRRLHLDIGASPRSFPVVGKLVGNVFSMLNRPVPPGYLSRFAWGGEEID
VPLFDTPKALYDRKFTLVAGEHGAYVLKDPDGLGILTGHVGQKASGMTPQGLITLKVDKLTSKPGVQFDLQRFSTLTTID
RLQKRLTVAETALQSGIIGVSLEGSNPKEIAAIVNNIANRYVQQDTQKRSAEAEHTLAFLEQQLPVVKKQLDEAEQRYSA
FRNKQGSVDLSEESRLLLQQVVDNKTKLTDLQQQRAELSLRFTANHPSVQALDAQIAALTVAQTRLGKNVSTLPDTEQTA
LRYMRDVRSSTELYTNLLNSTQQLRIAKAGQVSNVRIVDLAQAADDPVRPKRALVILISAAIGLVLGIIVAFIRKALYGG
VERPEDIERQLGTRVFAIVPRSTQQLRLQRQVGMRREGLHVLAAQAPEDAAVEGIRGLRTSLQLQLSDARNNVVMLTGSR
PEAGKSFLSANLATLVASTRKRVLLIDADMRRGDIHSHFGVRHSPGLSDVLMGADVMSTILHDVLPGVDLIPKGSLPSHP
AELLASDRLGEILAELKQHYDLVVIDTPPVLAVTDATVIGRHAGTSLLVVRHGKNQVQEIGETMKRLYHGGVHMKGVLLT
DVPQSKVLMGSTYAGYYGYESIAE
>gnl|bykdb|A0A059DQI3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Hyphomonas sp. CY54-11-8] (length=753 residues).
MNYDGFDEHPERAQRLRGIVPHERRDVDYYDPPAGRSGEGYGQAEEDGFNFWETLRIILRRKWMILTITFLGVTGAALMT
LQVTPLYRSTATIEIQREEAKILSSASVDPVVVADAEYMATQYALLKSRSLAERVAEVLDLPSDPRYAAPTLSREARLKA
AAATLVENIRVSPEGRSRVINVQFISPYKAETSRIANAIVENFIESNLERKYNTTAYARRFIEERLATAKSALEDSERKL
VDYAQEQNILEVGGENGSSSLDADSLVSLNSELAGAESERIAAEQKYLEARDGTTTQMLESEDLRRLRERRSELNAEYQQ
KLGIFKPSYPEMEQLQARIDAIESEIEVEKGNIIAALAAEFRAAQSREASLRQRVAELKTSVQDLRNRRIEYTILEREVD
TNRSQYEALLQRMKEVSIATGVGSSQVSIVDRALEPAFPFEPNLPRSLIQALILSLAAGIGLAFLLNYIDDTIKTPDDVR
TKLGLPTIGVVPKVKGNKDIIAHELNNPKSGVSEAFFSARTALQFTTPAGAPRSLLLTSTRPSEGKTSSTVALGMAFAKL
GQTVLIVDADMRKPSFVADAGASIGLSGLLTREATLAENVVSSRTEGLYLLPAGIVPPNPAELLSSPRLKSLISEAEDMF
DIVLIDSPPVLSFADAPLLGSIAEAAIVIIQSGQVRTPAVSRTVNRMLESNTHVIGAMLTKFDVKQAGYDYGYYSYNYGN
AGYAYTDRRVSDSASSRRKVRIFTEAGEDDTGA
>gnl|bykdb|A0A059DUM1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Hyphomonas sp. CY54-11-8] (length=786 residues).
MTGHDAPAGEDTSFDLKSLVGIVYRRFWLIMTGFLVVFLAVAYITFTATPIYKASTTIQLGANQENVIDLGSVLGGIVAN
TAVIDTEVMVISSKSLLTKVAERQKLIEDPEFNWTLVEHKPGLIDGLTRPIKKSLGMRTERVDPYAGLSAEEREAAIMSS
VVQALTNRVSVSRVGTTYLLTVTVVSTSPETAARLANAVADQYRVQQLDTKLDATRRATEWLGERVSGLRDEVAEKENRV
ELYRAQNGLDTAMGTTLAEQKIADLTKQKTQLDFDLSQARARYENMRRQIDSGAGVDGISEVLDSPLISRLKEQLSTLRG
RVAELETKLGPQHPELIGARNEVRDVERQLTGEVNRIAGNLESEVKAKQDQVNAIQARINQANAQLRDNSIASVRLRELE
RDAETSRVLYEEFIARSKETSVQDDLVQADAVILSAASVPNSPAAPKKRLNLLIGAILGAAIGAAMAIIAEMFDAKISST
EDIERKLGVSAIGSVPLIRASSLFGLGQTNPADYLVENPLSAYAESVRYLRAAIAFSDLDSETKTVAITSSLPDEGKTSL
TLSLGRMSAMSGSRTIVIDGDFRRRQLTEAAGMSPEIGFIEHLFGAGQLSDAIQKDSKTMLDVLPLSQSGHTPHDVFGTR
AFDDLLSRLRSMYDLILIDTGPLLLMAEARVVAGKVDKTILMVRWRHSTRAAVKQSLNLLRSFNADVLGATLNMVDLNRR
RHHRDPGASYKAYRKYYQMESKKSVFGFDLNGAGKRKKGGNRPVAMQTPPEKAKGTKEEEVPVGFE
>gnl|bykdb|A0A059DZ48 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Hyphomonas atlantica] (length=814 residues).
MGRSKFSVNSNFRYSILTKTFSFELPTQVPAEADSDGNTMPTDLKSLLAAVYRRFWLIALSFLAVFSLVAYMTFNQVPLY
KASSIVQLDTEQQNVIDLGSVLSGLAVSTAVIDTEVMIMKSKSLLTKVAVKQKLVEDPEFNWTLREPETSVLGSLSDSFL
GFLGVDTTEEDPFEGMSVDERENALLESAVAKLMGSVGVSRVGTTYLINVEVTSESPETAARLANAIADQYRVQQLETKL
DATRRATEWLSDRVFALREEVEEKENRVAKFIADNDMETAMGNTLTEQNIAYLTTQKTQAEVELNRVRSRYDSMRRQIDG
GAGVDGISEVLESPLITSLKQQLSTVRGRVGDLETRLGPQHPELIGARAEQADIERQIENEMNRIATNLENEVRVRRDQV
GRLQSQINNSNAKLRGNSLAMVRLRELERDAETSRVLYEEFISRSKETREQDGLVQPDAVILSQASVPKHPSSPRTKLNL
LIGAILGGMLGAGLALLAELLDMKISSTEDIEKKLRQNAIGSVPLIRTTNALGFTQTNPAEYLIENPLSAFAESVRYLRA
AIAFSDLDSETKTVAITSSLPDEGKTSLTLALGRMSAMSGARTLVIDGDFRRRQLTEAAGLKPEVGFIEYLFGAGQLSDA
IAKDPKSMLDILPLSLTGHTPHDVFGTRAFDDLLVRLRSMYDLILIDTGPLLLMAEARVVAGKTDKTILVVRWRHTTRAA
ARQSLALLKSFQADLLGVTLNMVNLNRRRHYSDPGASYDAYRKYYQMESKPSLFSFMRGGSKKSKSGKIQPTAIQTPPSL
ADHKTGAAEKVDAN
>gnl|bykdb|A0A059E002 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Hyphomonas atlantica] (length=743 residues).
MSTGIYDGRDGHPGNLSVVGNSAPVPTTANRYGEAPESDEYAIELRALVQIIFKRKWMIMSLLIIGLTAGYLSTLLVPPL
YRAKATIEIAKHAAQVLSESSVTPQVQADPEFVETQSALLKSRELAQRVVEQLNLDQDPVYADQTLPQQDRVHAATQYLS
QNLRVNVEGLSRLIAVRVSSPDPEDAARITNTLVENFIQTSLERKYNTTAYARHFVEDRLESARLSLEDSESLLASYAAE
QGLVNFGGNSSIFSLDGETIVTLNKELATAESERIAAYQKYIKAENSPITLDVLDSPDLKKLREQRFQLDTEYQNKLEIY
RPEYSEMTELKRRIELTDREIEAERTRIVDALETSFRAAEAKEASLRERIGELKTKLIELRTQSVQYGILERQVETNRSQ
YDALLTRLKELTTAEGIGASQASVVDRAIAPTHPFQPSLGKHLLLATILSLAAGIGLAILWEYIDDTIRVPEQLISKLGL
PIIGIVPVASKSSDLVQDMMKNPKDSLAEGYFSIRANLLFSTNSGAPRCLSLTSASQAEGKSTCAVGLGLAFSRSGQRAL
VIDADMRRPSFVVDRNLSIGLSGLLASDADAMEHIIAGPTENLFLLPAGRIPPNPAELLSGHRLNEILEQLKQVFDIVIV
DCPPVLGFADAPLLAAACDATVVVISSGKSRRITIRRSLDRLVSTHAQTVGAILTKFDARKVGYDYGYYYYNYGPGAYDY
ARPSARTERQSRKITLFKDQLDD
>gnl|bykdb|A0A059EFZ7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Hyphomonas sp. L-53-1-40] (length=798 residues).
MTKTFSFELPSQVPAEAETEGNNMPTDLKSLLGAVYRRFWLIALSFLSVFTLVAYMTFNQTPLYQSSSVVQLDTEQQNVI
DLGSVLSGLAVSTAVIDTEVMIMKSKSLLTKVAVKQKLIEDPEFNWTLRERKTSALGKLKNQVKSLVGMDTRVVDPFEGM
SVDERESAILDSVVGTLMGRVGVSRIGTTYLINVQVTSTSPETSARLANAIADQYRVQQLETKLDATRRATEWLSDRVFA
LREEVEEKENRVAKFIADNDMETAMGNTLTEQNIAYLTTQKTQAEVELNRVRSRFDSMRRQINSGAGVDGISEVLESPLI
TSLKQQLSTVRGRVGDLETRLGPQHPELIGARAEQADIERQIQNEMTRIATNLENEVRVRQDQVSRLQSQISNSNSKLRG
NSLAMVRLRELERDAETSRVLYEEFIARSKETREQDGLVQPDAVILSNASVPKFPSSPRTTLNLLIGAILGCLLGGALAI
MAEMFDMKISSSEDIEKKLAQNALGTVPLIRTGNALGFAQTNPADYLIENPLSAFAESIRYLRAAIAFSDLDSETKTVAI
TSSLPDEGKTSLTLALGRMSAMSGARTLVIDGDFRRRQLTDAAGLKPEIGFIEYLFGAGQLSDAISKDPKSMLDILPLSL
TGHTPHDVFGTRAFDDLLVRLRSMYDLILIDTGPLLLMAEARVVAGKTDKAILVVRWRHTNRSAARQSLALLRSFKADLL
GVTLNMVNLNRRRHYSDPGAGYDAYRKYYQMETKPSLFSFMRRDPNKPKKGEIRPTAIQTPPSLAEHSTESPEKVDAN
>gnl|bykdb|A0A059F719 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Hyphomonas jannaschiana VP2] (length=786 residues).
MTGHDGPSGEETSFDLKSLIGMVYRRFWLIVTGFLVVFLAVAYITFTATPVYKASTTIQLGTNQENVIDLGSVLGGIVAN
TAAIDTEVMVISSKSLLTKVAERQKLVEDPEFNWTLVEQKPGLIDGLVKPIKKSLGMRTERVDPYAGLSEEEREAAILEA
VVEALSNRVTVSRVGTTYLLKVTVMSTSPETSARLANAVADQYRVQQLDTKLDATRRATEWLGERVSGLRDEVAEKEKRV
AVYRAENNLDTAMGTTLSEQKIADLTKQKTQLDFELSQARSRYENMRRQIDSGEGVDGISEVLDSALVSRLKEQLSILRG
RVAELETKLGPQHPELIGARNEVRDVERQMAAEVNRIADNLASEVAAKQSQVNAIQARINQANAQLRGNSIASVRLRELE
RDAETSRVLYEEFIARSKETSVQDDLVQADAVILSAASVPSQPAAPKKKLNLLIGAVLGAAIGAAMAILAEMFDAKISST
EDIERKLGVTSIGSVPLIRASSLFGLGQTNPADYLVENPLSAYAESVRYLRAAIAFSDLDSETKTVAITSSLPDEGKTSL
TLSLGRMSAMSGSRTIVIDGDFRRRQLTEAAGMSPEIGFIEHLFGAGQLSDAIQKDSKTMLDILPLSQSGHTPHDVFGTR
AFDDLLSRLRSMYDLILIDTGPLLLMAEARVVAGKVDKTILMVRWRHSTRAAVKQSLSLLRSFNADVLGATLNMVDLNRR
RHHRDPGASYKAYRKYYQMESKKSVFGFDLNGAGKRKKGGKGPVAIQTPPEKAKGTMEEEVPVGFE
>gnl|bykdb|A0A059FVF0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Hyphomonas johnsonii MHS-2] (length=786 residues).
MAAASGSGIDDMPIDFKALVGTVYRRFWVIVTGFTATLLVVAYLTFTQTPIYKANSILQLDTNKENVIDLGSVLGGLAAS
TAVIDTEVRVMGSKSLLTKVATKLKLSEDPEFNWTLREQKPSIVDNIKAQVRSWSGHQAETTEPYANLSAEEREAAILES
VVQTLMQKVHVSRIGTTYLIDVEVTSTSPETAARVADAVADQYRVQQLDSKLEATRRATAWLSERVAGLRDEVEAKERRV
EEFRAETGLLSAQGATLTEQQIAYNTNQKSVLESQMNRARARYQSMKRQIDSGAGIDAIAEVLDSSVISNLKTQRAQILR
RVAELETTLGPAHPELIGARNEAEDIERQITAEVNRIATNLESEMKVAQDQLNSINSNISQSTAQLRGNNINQVRLRELE
RDAETSRVLYEEFISRSKETREQDDLVQADANILSTATVPSSPSSPRKMLNLVIGALLGGIIGGGLALLAEVFDMKISSA
EDIERKFGVSSIGSVPLIRSTSLLPFSHIKPADFLVDNPLSAFAESIRYLRAAIAFSDLDSETKTVAITSSLPDEGKTSL
TLSLGRMSAMSGSRTLVIDGDFRRGQLTEAAGLSPEIGFIEHLFGAGQLSDAITKDQRSMLDILPLSKSGHVPHDVFGTR
AFDDLLARLRTMYDLILIDTGPLLLMAEARVVAGKTDKTILVIRWRRSLRSAVRQSLHLLSTFNADLLGITLNMVDVSRR
RHHKDPGSTYKAYSKYYTMETKRSIFSWGRKSGSKAAQKASYPSVVSNSLRSHEPQQESVDEFSSN
>gnl|bykdb|A0A059FYR6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Hyphomonas hirschiana VP5] (length=801 residues).
MSKSYTVEIPSNADIGGSSGGIDTSAFDLKSLITMVYRRFWLIFTGFITVLSLVVFITFTQTPTYRSQAIIQLDTNQINV
IDLGALFSGAGGATTSVIDTEVRVIASKTLLSRVAEEQNLIEDPEFNWTLRPKKETFISSSQKAVVGLMGGDTSEKDPFA
GMTPEQKEAEIFEAVVGTLMSKVAVGRVGATYLLTVDVTSTSPATAARLANEVAEQYRVQQLEKKYDATRKATEWLQERV
SGLREEVEEKEQAVETFRAETGLLEAQGTTLTEQQIAYLTSQRGQAQIEVDRARARYNSMRRQIDSGAGVEGVSEVINSP
LINDLKTQRSELLRRVAELETRVGDRHPDLISARNEVADIDRQMNSEMNRIAANLESELNVARAQLGSIQGEIGRSTSQL
RGNNVNLVRLRELERDAQTSRVMLEEFLARSKQTREQDALITADSSILSTASVPFRPASPRKAFNLIIGCVLGLVVGVFL
AIVAELFDSNISSSEDVENKLGSNPIGSVPLIRTAGLLGLGQTSPADFLVENPLSAYAESIRYLRAAIAFSDLDSETKTV
AITSSLPDEGKTSLALSLGRMSAMSGSRTLVIDGDFRRRQLTEMAGMKPEIGLVEHLFGAGQLSDAIAKDHKTMLDVLPL
SLNGHTPHDVFGTRAFDELLSRLRAMYDLILIDTGPLLLMAEARVVAGKVDKAILVVRWRQTTRSAARQSLTLLRNFKAD
VLGVTLNMVDLNRRRHHRDPGATYKAYRKYYQMEAKPGIFGWTKPKKPKPNKQGPKSSIATQVPPSKASGRPETIERISA
E
>gnl|bykdb|A0A059G5G5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Hyphomonas oceanitis SCH89] (length=775 residues).
MPIDFKALIGTVYRRFWIIVTGFLVTLFAVAYITFTQTPIYKANSILQLDTNKENVIDLGSVLGGLAASTATIDTEVRVM
GSKSLLTKVATKLKLAEDPEFNWTLREQKPGLIEMTKGQIGAWTGHPPKKTVPYANLSAAEREAAILESVTRTLMSKVHI
SRIGTTYLIEVEVTSQSPETAARVADAVADQYRVQQLDSKLEATRRATAWLSERVAGLRDEVEAKEKRVEEFRAETGLLS
AQGATLTEQQIAYNTTQKSQLQAQLNRARSRYDNMRRQINSGAGIDAIAEVLDSPVISGLKAQRAQILRRVAELETTLGP
SHPELIGARNEAADIEKQIEAEVSRIAANLENEVKAAQDQINSINSNIGQSTAQLRGNNLNLVRLRELERDAETSRVLYE
EFISRSKETREQDDLVQADANILSTATVPDSPSSPKKLLNLIIGAMLGGIIGGGLALLAEIFDMKISSPDDIERKLGVNS
IGSVPLIRSTSLLPFSQTNPADFLVDNPLSAFAESIRYLRAAIAFSDLDSETKTVAITSSLPDEGKTSLTLSLGRMSAMS
GSRTLVIDGDFRRRQLTDAAGMSPEIGFIEHLFGAGQLSDAICKDSRSMLDILPLSKAGHVPHDVFGTRAFDDLLARLRS
MYDLILIDTGPLLLMAEARVVAGKTDKTILVIRWRRSLRSAVRQSLTLLKTFNADLLGVTLNMVDLTQRRHHKDPGAAYK
AYSKYYSMETKRSIFGRNKPAKSNGMTSAPNPMAAPLKPEKPQVKTGSSSEVSTH
>gnl|bykdb|A0A059KNJ5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphaerotilus natans subsp. natans DSM 6575] (length=752 residues).
MNQIQVAAQSQVPAQPVPPFAPVQIGLSEESKLALLDHWRSIKKRKWPILGLATALAALGAAVAFSMTPVYKSTATVLIE
PGKPKFLSMDDMFGSAMQSKEHYQTQVEILKSREVAMRTVTTLKLWNNPDFDPRKGEDGLSAKAKAMLGMAPPKVEWDEQ
KLAEAAVGPLMRGVSIEPVRLSQLVKVSFESPDSKLAAQIANDIAANYIESDRDAKFKLAQNLNGWLEKRASELRKNLEA
SELALQAYREEKGLVSLSGSAQALAGMQANEVTQRLVEARARRLQLEGTYNLIGSTGNGDYSNVPAVLNHPSVQEALRTE
AAAQKEVAELSENLGPNHIKMQEAQSSLAAARKYLEQQRRSVARSMVQEYNLARQSERSLETALSTATGGVQDVNRKEFQ
LQVLEREVASNKQLYDLFMGRAKEMDAGSDIQAAIARVVDPAVVTAVPVKPNKGQIIIVAFVLGLMIGSMGALLLERMDN
TIKGSESAELKLHQPVLAVLPALSGEQLENVSTIFIREPNSHHAEAIRTARTGIQLSNVDQSHRLLVVTSSVPAEGKTST
AINLALALSQTKRTLLIDGDMRRPQVGVRLGMAPNAKGLSNLVTGTASLKECVHAVEGSSLLVMPAGDIPPNPLDLLLSQ
RFKEAIRHLQPQLDFILIDTPPVELVSDALSIAPMATSTIYVVRATETPVPVIRKGLSRLQRAGANVMGVIVNGLDFEDA
QRYYGESVNGGYGNTYYHGYAAQPPATPATTT
>gnl|bykdb|A0A060BBM0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Halomonas campaniensis] (length=752 residues).
MNYFPHPPSSSASPQESDDLNLRKLVDTLSDHRWFIVTITGLFLLAGYFYASSQPRIYQADALVQIESRGANLAFMESLG
EQQPGNPTAAELEILRSRMVLGETAERQDLAIKVEPRRLPVIGDFLVNHGVSQDLIESLTPAFMREWLGMGEESRWQNPY
VWANESVRVSRFSVPDEHVGSEHLLRIKEEGNFELWLEDERVLIGNVGETVQDEGVGYRLFISQAAAHPGAEFSLTRMSS
LNAIKDLESRFEVMPRGIESGVYELMLSGADRSKIQPTLDTLTGVFLTQNVQRHSEEAEKQIAFLGEQIPQVRDQLSNAE
GMLNDYRAQRDSVDLTFETQNLLTRVVDVENQLSELAMREADLAERYRPSHPNYQTLLRQRSQLVEERDRLNAQVNELPE
TQQEVLRLTRDSQVNQQVYVQLLNQLQEMRLVKAGTVGNVRILDAAILNPGTIAPRIPLITAVSALIGALLATMLVVVRL
LLSRAIKSPEQLEELGLPVYATLPDSGGQTGLTERIRPRHSKKVQEVFRGLLAIKKPAEIAVEALRGLRTSLYFAMLESD
NNRLMITGASPGVGKSFVAANLAAVCAQAGQRVLLIDADMRRGHLHHAFHSKGVKGLSELLARRIDAEEAVRHSDLEGLD
YVARGSVPPNPSELLMQQSFHDFLEAMSQCYDLVIVDTPPILAVTDATVVGKLAGTSLMVVRFDSHPPGEIKAAKRRLES
AGVNIKGAILNGVKKTTNSRHGYYGSYLYAYR
>gnl|bykdb|A0A060DCW7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Azospirillum brasilense] (length=757 residues).
MATQDIQDQPQRRQSAPVPGPVSFDLSTAAASAVRRTTGMLLRHKLLIGTVIVLGTGIAGLVALRMTPLYTAQTLIMVEH
RKNQVMNYQEVVSGLSTELGALQSEVAILKSPAFAEKVVDKLGLMNDPEFNAALRPEQTNWFYYLNPKNWVPDSWWNSAR
GDRPEITLSPEEKTANERTSVVNNFIENLAVRPQGRSYVIAVDFDSEDPRKASLIANTIGEMYLVDQLDEKFKAAKRATA
WLEERITELRREAKTTGEAAEKYRAESGLTNANGETTLIAQQLAELNTSYVLARTKRQEAEAKLREVSTLAQSPRGVSAI
GDVLGSPLIQALRQQEVELQRKIADAANKYGARHPTLTALQSELRDLQGQIKADVGRIVQNLSNEVELERGREAALKTNL
DQLQAQRNQQQESNVTLRTLERDAETSQTMYEAMLTRFQEIAGQTEIQQPDARIVSEAAIPLNPSQPNKKMIVLLALVAS
ATLGVLLAMLREQSERGFRSPHQFESATGVRSLGIVPAIGRRRRGTSPAAYAIDKPMSAFAEAMQNLRTTLLLANPDGHQ
RVILFSSSVPGEGKSSIAAAFARICANAGQKTIILDCDMRRKGLHPMLGLENRHGLYEVLSGECAPNEVIQTDPRTGLHF
IASGRGSALPQDMLGSSRMHQLISRLALEYDRVILDSPPVLAVSEGKLLAALADQTVFIVHWGKTKRETAMAGLKEIVEA
GGEVVGVLFSQVDIRRHAQYEFPDSGRYHGYRRYYAN
>gnl|bykdb|A0A060DN90 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Azospirillum brasilense] (length=747 residues).
MGPDFRFILRVLGSHKWLIAAIVVVLTGLSALGVSTLKDQYTSEALLLVDNRQVRVVREVEQVVGAIPTEDAAILSEIEI
LKSPQVLNQVVNDLQLAQHPEFNPPAQEDETLPLVERAVAYGRDLAGRFWEGTPPAPVAWLLSHGDEVAQDIRAREAHAA
LGNDQIIARIHRKLDVAIVGRSRVIQVRFTSKEPQLSRDVVDGIVRRYMETRQQMDRDLSTSAISWLQDRIVLLRKEVAE
ADAKVEEARVKGGLLKGGTGLMAQNELEQTRLRLSEASAIRARSVAQADTLERNLKAGNWNAIGGSIASPVVAQLRATVA
AISTEMAQLSRQYGPKHPRIVELQGRLNEANSSLQQEIRREINGVREAAQVAVEQETALRSMITRMEGSYATMQEQAIPL
RTLESEATAKRQLLDSLLGRLEEVEAQKDSRAFPAAVKLVSAPQVPHEPSGPFRVLLLLAGFVAALALAIFSVFGLELLQ
RRIHTPDAVRRILGVGTVHIVPHHSDRGAKGRLYKIFQRHPFSLFSESLRALFRNHLSDLGPVGALAVTSARPQDGKTSL
TLAVAQVASQAGRRVVVVDTDFRRSRMEGLFDLSTKKGLSDWIAGDATLDEIVHTSDDVPFAMVPAGKLNPMTLDRFNVD
SLVQLMAGLSPSFDLVVFDTAPALAVSDARIVCGAASKVLFVTRWGHTTASDLDAVADLGPIDHSKFVCVMTDVNLKKAA
SKGYQGPYNSYVATRKYYGDQTLRAAP
>gnl|bykdb|A0A060DQH4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Azospirillum brasilense] (length=783 residues).
MNSSIGKGGTLPGHEAHASVLPDSLLQSGAAESSDVRSRQEATVFASLAVLWRRKLLLLTIILLGTATITYVMQSLKPMY
RATAMVQLDSRRVELAEFKSVVSNLTPEAPAVRSEVSIVGSRALAERVVEKLRLINDPEFNPTLKAADGADDHWLKRVTK
AGVGALPPEGNDVLRQIVQQATALFRAEESPNAGDPNQARLLTIDTLLRRIEARNDDRSFTIIIEASSVDPAKAAAIANA
FGQAYLDYRTEMNRDLTERVNQWLGGRLIEAREAVRGAEEAIRSFRKENSLLELPPDGRNMVQQQMNELATQLTAAQAQK
AAAEARVRQAREQTAANNAAAIPEVLASPLIQKLREAEAMLERRLAELQQVYGDKHQDIVNLRRGIGELKARIRDEVGKI
QKGLDADLEVARIREATLLKSIADLQEQQKGIEATGIQLRDLERAADAHRTLYRSLAERYEQTMALKNTGALDAHLSAPA
LPPIRPAFPQFRMSLGVGLVGSTALAVALVLLLERLSSGLRTPSQVERATGVPCLGMVPSLPRNEATWNLPLHPDSRRAR
EIGAFREAIQTVRTMACMPRKRGTPPKVLLVTSSIPKEGKSVLAANLARSLAGLGLNTLLIDADFRRPSIAKLLGYQPQG
SVADLLDGRVGIDDLIHQETTNLGVLGNAVGTPDAHDRISSQAMSDLIQWARHNYDVVVIDSAPVMLFSDALALSFLADS
VIYVVRWQHTPLDTVTAGFNKLKSVDSAVGGVVLSRVVASKHVKYGHKDDTYYYALHAPARHS
>gnl|bykdb|A0A060I9N6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhizobium sp. IE4771] (length=755 residues).
MTISTVPPDRNLPISPMRYDPRAQVETKADNLDLASAFRMLRRRMVLIIAITLLLVAPAAIMISGLKPTYQASARLIVHQ
PLATSLGADDTSRGNPLDVKSETERLLSRSIAERVVREMRLDMRDEFNPALRKVSFFESIRANLRGLFDAEKPASTARDS
IEATIREYYQALGVWHEERSEVIQISFTANDAELAAAVPNRVVSIYLDERKGSVSARLDAAETWIRQRIAEQKGRAVIAR
DAARNYQESMDILSKEDAQDERIKTLLELTGREGKIEESRLEVKATISALEAADNPSAAVQNIVVPDSITTKQRDLRAQE
EDLSRLLELYDSNAEAVVDLRRKIEQSRIDLDLATKQYLQSMRAKLAALDHEANAVQSILAVAKEKRTRDALAQTELTRL
QRIAENEQAALDKLEDQRRDLAAKATLPGAELEVFSPASVPLVSQGRGRLFYLVGALLAAISAAVTAAFVLEMWDQSVRS
FDQIAGMARTIPAGLIPRLARRENPKTIFRLVQVPMFDEALRTVILTLKQSNGGKVPNSIVVTSAHSGEGKSLVARSLAI
ELSAAGIPVLLVDGDLRRGELESFFRSGLQQGLNEYLNGQADIRDIVYHHPSGIDFIPSGKFSLQRRVRPNGLADIIEVA
GAAGRIVIFDSAPVLASTDTVLLTALAERTLAVVRWGKTSRRAVEFSLQQMKSPRNSEILVAINNVSPDKHALYNFSDSE
LFSKSLMKYYQPHTDDTPRTIINNIFSLKSKIIHK
>gnl|bykdb|A0A060IAC8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhizobium sp. IE4771] (length=757 residues).
MLSPDKLTPRIDPSRDTGNEADFIDFDKLIAIARRQWRIVAACAFVFAILGVVYVLTAVPVYTAETKVLIDRSDNQMINQ
LAAFGQLDDDEGTVLSQVELLKSDAIAYAVVDKLKLVDNPVFTAQKNSLFSVATLKSLLNFRAWFADDMAAAPDPEMKRR
YAAETVAGNIDVERVGKSYVLDVTYTSQSPDLARDIAAAIADVYLVDKLNSKYEATRRAGQWLQERIEELRQQALDTDLA
VQKFRSEHGLVEAGSGNLLSEQQLSELNSQLIKAQAETAQAEAKYTRIKSIIEAKQTDAIVTDVLDSSISNELRKKYLEA
SKLEAEIEARLGPDHVQAVRLRAEMAEYERLMFDELNRIAESYQSELTVAQSREKSLRDSVDKATGVAATAGETQVQLRE
LERTRDTYKNLYQSFLARYQEAIQQQSFPITAARIITTAETPTKPSAPKRSLVIAFAMFLGCAFGSGIGAFREFRDRFFR
TGDDVRDMLDVESLGVMPLIENNVEDPTLVDPGNPRSIARGGKTTTYVEEHPLSAFAETLRSAKIAIDLSASDQRCKVIG
VVSSLPGEGKSTTAINFAKLLAMQGARCLLIDGDMRNPGSTRAIGRHAEAGLLEAIVDNRPLKDLILLDPKTKLAFLPTV
ARYRVPHSSELLASRGMDQLLEIARQSFDYIIVDLPPLAPVVDARAINPKLDAVVFVIEWGKTSRKVVQSTLLSEPDLYT
KCVGAILTKVDPAQMKLYRTFGSSEYYYKRYSRYYTE
>gnl|bykdb|A0A060P7S6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia sp. RPE67] (length=742 residues).
MATNFDSRYVDVSTGDELRLSDYLAAVMRNWKLVTVVMLAVTAIGTAYAFLATPTYKADAVIQVDENDKTTTNVPASAGQ
QAIPQTSEAKSVTAAQIELLRSRLVIEDAVRRFHLDVSAAPRSMPVLGGAIGTAFSMLGKPVPQGYLSRFAWGGEQIDVP
LFDTPKALYDKKFTLVAGQNGTYALNDPDGLAVLTGHVGKEASGMTPQGPVTLRVDKLDGKSGVQFELQRFSTVTTIDRL
QKRLTVAEAALQSGIIGVSLEGSNPKQITEIVNNIAHRYVQQDAEKRSSDAEHTLSFLDQQLPLAKKQLDEAEQRYNTFR
NKQGSVDLNEESRLLLQQIVDNKTKLADLQQQRAELSLRFTANHPSVQALDAQIAALTNAQTRLGKNVSTLPDTEQTALR
YMRDVRVNTELYTNLLASVQQMRIAKAGQGSNVRVVDFAQVPDDPVRPKRMLVILIAAGIGLVIGIIVAFIRKALYGGVE
RPEDIERQLGTRVFAIVPRSTQQLRLQRQVGMRREGLHVLAAQAPEDAAVEGIRSLRTSLQLQLTDARNNVVMLTGSRPE
AGKSFLSANLATLVASTRKRVLLIDGDMRRGDIHSHFGVRHSPGLSDVLMGADVMSTILHDVLPGVDLITKGSLPSHPSE
LLASDRFGEVLAELKRHYDLVVIDTPPVLAVTDATVIGKHAGTSLLVVRHGKNQVQEIGETMKRLHNGGVHMKGVLLTDV
PQSKVLNGSTYAGYYSYESIAE
>gnl|bykdb|A0A060PD52 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia sp. RPE67] (length=783 residues).
MNTLYVNNGSSRPGKDDGEFTASDMLRLLRDHLGMLFLFIGIAAALATAYAFLAKPIYSSDVVVRVDPPDPNALGIAPQN
QMQMQQSLPTVNQLAPAEISVMQSRSVLEPVVKQFHFDIKSKPKTFPVLGQIAELFAKKGHLAPAWFGLDSYGWGGEELQ
IGRLDVPPALEDQKLDLVLLENHQYELRDPDGETILRGTIGRPATANGVSILVNSAIGHPGVRFDVTRLNTLDAIALMKK
TMKVAESAKDTGVVQITFNADDPALTADVANALGQAYLSAAVQARQANDTKTLEFIRGELPRLEHDLKVAEGNLSTFRAK
SQSVQPIPEAQAYLQGSIVSMQQLATLKLQRTQALQRFQPSSPQVVNLDQQIAELEASNKQIQQRFDSMPQSERQNATLT
RDARVAETIYMGMVNKAQELSVRRASTSGGAHIVDNALRPYRPVKPNKSLVIVAGTGLGFFIGTFFIFLRRHAMIGVTDP
MFVERRLSVPVLGEVLYSRQQAMLDHEIAVSPVEHAPLTYSGTQDGGPPRALPHIELPEHDAFAMPHVADTDRNARVLAT
RYPHDPAIEALRAVRTELYRDLANAPNNIVMLTGPIPSAGKSFVAANLSVLLAEIGLRVLLIDGDMRRGHIASFFKQSNP
GGLSEVLKGEMALGDAIRYVGVPGLSFISCGAYPENPSELLMMPGFRNMLARMSDQFDLVLLDTPPFLVVTDAAIVASDA
GSTVLVLRSGIQSEEEIEETVKKVQRAGGRLVGSVFNAIPRRPSNRRSYGYAAAYTSTFKSMS
>gnl|bykdb|A0A061JQ70 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas stutzeri KOS6] (length=737 residues).
MTTMPRPIYETKEDKDIDLAHLFDTFINNRVLIMGITGFFAALGIAYALLTTPVYLASAMIQIEPKNGLPSLTDVVNSNP
PVSPAQTEIALLKSRSVVGGAVSNLNLDIIITPHYFPIIGGFMARRFEPSEEGELGWHPTGLGGYAWGGETLKVTQLEVP
DKVHGKELTLEAADNNGFILRDEDDEVVAQGVVGEPVANENYRITVAELNARPGTTFTVIKNRTYNTTESYQQRLAAAER
GKQSGIVNVTLEDPDPAHAIRVLEEVASLYVEQNVARNAAEATQSLEFLNEQIPTVRRNLDAAQTALNKYQTGSRSVDIT
AETQSVLDRIVDMERQISEQNLKRTEMERRFTRQHPNFQALMNQINQLQTQKEELEKQIGTLPSTQQELLRLNRDVEVSS
ETYSMLLNKTQELDIIRAGTVGNVRIIDHAAADLETPVKPNKPLVVIVATLLGALLATAFVYVREALKRGVENPEEIERA
GTPVYASIPFTDKQAALEKRLANFKRDKSAASYLLTINDPADLATEAMRSLRTSLHFAMIEAKNNVLMITGPSPAVGKSF
VTTNLAAVVAQSGKRVLLIDADMRKGYLHKVMRCDGDKGLSDILSGRITLFDAIQKTQLNNLHVITHGQLPPNPSELLMH
ENFSRFVKEISHMYDLVIFDTPPILAVTDAALVGSQAGTTLMVTRYGLNGLKEIEAAKRRLEQNGLLVKGVIFNAVVRKA
STYGEYGYYQYEYASTK
>gnl|bykdb|A0A061JVL0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas stutzeri KOS6] (length=737 residues).
MTALTRSSLEYDADNRVDLAGIMRTAFDHKTLIIAITGLFAALGIIYAIVATPIYQATAMIQIEPKKAAITGVPEVSPRP
DSVSQAVTEISLLKSRAVLGRAVEELKLYIVAKPRYFPLFGAYLARLHDPATDGALAAPLFGLTAYAWGGEKLDVFQLDV
PEDFLGMELTLVAGSAGNFTLRDDEQQPILRGQVNQALESRGFKVQIAELEARPGTEFVLVRNRPQTTALDYQDRLRVGE
AGKDSGIIYMSLEDPDPRLASRILDEIGRLYVSQNIQRSSAEAAQRLEFLRSQLPQVRKELEKAEAALNAYQTSSKSVDI
SIETKGVLDQIVALETQLSKLSLKRVEYDRLYTRDHPTYRTLMTQMNELHSQKAELLKKVDALPMTQQELLRLKRDMEVT
TQTYTLLMNQAQEQDILRAGTIGNVRIIDNAYSMIEKPSKPVRPLVVAIAIFVGLLASAAVILLRQAFYRGVESPDVIEK
LGVPVYAGLPYSASQEQLNRRRKARDGKTRLLSLSEPNDLAVESLRSLRTCLKFAMLEARNKVLMITSPTPAVGKSFVSS
NLAAVIAQTGQRVLLIDADMRRGYLHNLFGMAPRNGLSDALAGGLSLAEITNRTELKNLHFISAGFSAPNPSELLMHDNF
SRLLREAESLYDFIIIDTPPVLAVTDAVLVAQQAGTNLLVARFGMSTGSQIDASKRRLGQNGVILKGVILNAVKRKASTS
PYDSGAYGYYTYTTQKA
>gnl|bykdb|A0A061MUA9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Agrobacterium rhizogenes NBRC 13257] (length=783 residues).
MHQKNFTFHSATPKAEEQDGFIDLDRLMAVVIRRIRTIMLGVAVFVGLAIAYLLFATPSYTSATQILLDETMTKYAEDQP
PPTSSQQADMDIASAVEILKSNEMALRVVDTAGLIDNDAFVNPPQSPVALIKSGVKLIASVFKPAKPPLTPAEAREAKRQ
LIAAMLQDALKVERVTRSSVVLVSFSSTDPLLAAKITSAYADSYLTDQLNANFDATERASVWLQERLNDLRQRAQMASLE
VEKYKAENGLTSTGGELMSEQQISDLNKQLIIAQADTASASARYNQYKSIIDQGPDNAVKNATISSSQSGNSVLQDLKTR
YLAVQKREQDVTQNFGADHPQAVALKAERQDITRQIYEELQQLTASYKNEFDVAQSRATSLRGSIEGMVGKNSEANKSLV
QLNELNQKATALKTLYESYLGRFEAAAQQRSFPIAKARVISAAGVPTAPSSPKKTLVMALSIILGLMAGGGFAAFQEFRD
RFFRVEADVRAALGLKFLGYLPLLGQQGFPKKKNKRKAGPVPAMATATADEGENGVAFERIMRVSVEAPRSMFAETLRNA
KLASDVMLQGRADRVIGVVSALPGEGKSTTAANFAALLASSGKRTLLIDADLRNPGLSRTLKTPPQVGLIEAALGEVPWA
SAVKVDPRTKLAILPVVIRDHLLHTSELLSSQGMMTLMENARKMFDYIVVDLAPLGPVIDAKAFAPQVDAFLLVAEWGAT
PTSLVRDLLEQEPQINSRVLGVILNKTDMSELARYSEFGATERYRQKYVSYYTEDHPKTQVEA
>gnl|bykdb|A0A061PIL5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio sp. JCM 19053] (length=725 residues).
MNGTHPNNLQMNKVELIRFGHHFKAIKKNWLSIAAFTLLFSLTCTWYIYSKASIYQATATLLIQEEQKSALSIEEVYGVD
TTKKEYFQTQIAILKSNHIADKVIRELNLTPLPEFTSSGGLNKKIDQIKSIPFVQDLLNVAPSPKETAQFSESYYQALQA
FRSKLDIEPVRNTQLVRIRFRSTDPKLATTIANAVGQAYIDANFEAKLVVTQNAATWLTNNSQKLEERLRNSEQALQEFL
LKEGLIDINGIDEIYANELEELTRKLNIAVNKRIEAQTLIQLLRRKSSQSLDSLLSIDEFANQAQIRDLKLSEAQAAKNL
SELAQRYGPKHDRMIQAKAQLAEIQSRTSNSSVTFPSVSNKTFLLQKRKRTCFEQNSITKSQTFNRGHKKRRYEQLKREV
ESNKALYEAFLNREKETNATSDYKNVTARFTDKAIIPLFPVAPQRIKLVLIATFFGFAIACALVIILETMREVIRSAADV
QEKLGVTCLGVIPMVKKRNLRKNGVSYTAYLDDEEKLFSEACRSVRTSLLLRLTNTKQKILPFTSAIPEEGKTSTSINMA
VSFSKMEKVLIIDCDLRRPSIAKRFGIAESSPGLTHILTMDTPIKDCVTHIKEANLDVLPAGLIPPNPQELLASDRFKKL
LEHFQNKYDRIIIDTPPYLSVSDALILGQYANGLITVIRSESTKSSLVNLALSKQIQHSVPSLGVLITQAKAKEGETLYV
QKYAY
>gnl|bykdb|A0A061PWE5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio sp. JCM 19052] (length=722 residues).
MTTQTIKQSRQVDDEIDLGKLFGIILDAKWFILCTVFLFSVVGVGVAILSTPIYKADALIQIEKKSSGGISAMVGDMANY
FLAESSATTEIEIIKSRMILGDTVDKFNLTTVVTPNYLPFIGKGLARLQGEQNRLSVSRFNIPSYAVGIPHTLEVLDAEQ
KTFKLLQDDGRVVLEGKVGELIDKDGYQFMANEMFAQDGATFTVSKISKLDAINQLQQNLSISERGKQTGIISLSFSGED
RARIQAILNDISQNYFLQNVQRNSAEAEQSLEFLKGHLPDIKVKLTASEDILNRFRQENESIDLGLEAQSTLKVMVELEA
QLNELTFKESEISQRFTQDHPAYKSLLDKRQTLLKEKERLNKQVQKLPKTQREVLRMTRDVEVNQQIYIQLLNKVQELNI
IKAGTVGNVRILDSAQSFSKPIKPKKALIVVLATLLGGMVGVAFVLIRAAFHRGVETPDQIEQMGMPVYASVPKSIQQLE
FASKLKRNKGKANKELVLLAEANPADLSIEALRSLRTSLHFAMMEAKNNILMISGPAPSIGKTFVSTNFAAVAAKTGQKV
LLIDADMRKGYLQQCFGLRWDNGLSDHLSGKVTADDIIKETSIENLDVVTRGQVPPNPSELLMHPRFKDFIEAMSEKYDL
VIIDTPPVLAVTDPSIVGALAGTTLMVARFDQTTLKEIEVAQGRFEQSGVEVKGVILNAVEKKASNSYGYGYGYYNYSYK
SE
>gnl|bykdb|A0A062BXF9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter sp. 263903-1] (length=729 residues).
MSQNPNTEDTIDLKELFFSLIAQWKLIALCTILSLVCALLYLRTTPNIYQVDAMVQVEDNKGASAALLGDLSEKMVQKSP
AEAEIEILKSRLILGNVIHHLNLDLQVSSAEDSLIQRLIHKTEYQTKYSTRSVLFKDGNRSFSIRQFDIPSYYLDKNLQL
NFESGNFTLTDTITHEPVFKGVLNRSNQFNSKYGLWKVAIYSKDQLADTYNIKKLSLPAAVNTISAPFSVAEKGKQSGIL
GLNYEGTDKQYITQVLNAILTAYSQQNIERRTAETAQTLKFLDEQLPQLKQQLDKSEREFNNFRERFNTVDVTKESELYL
TQSITLETQKIALEQKQAEMAAKYTAEHPQMREINAQLGAVNNKINELNGTLKRLPELQRQYLQLFREVEVNQQLYTALL
NSYQQLRVVKAGEIGNVRIIDTAVEPLGPIKPKKLQVIILSLFLGAFLGTLLALLRNMMRSGVKDSSQIENELDLPVYAT
VPRSPVQESRIKLLKKKKHIPILAVKNSDDIAIESLRSLRTAVNFALANAKNNIIMIAGPAPEVGKSFISTNLSVIFAQS
HKRVLLIDADMRRGYLHKYFNVNTQPGLSEYLNGQNNLSDAIHETEIKNLYMMSRGKSPANPSELLSSAAFGTMLEQLSS
QYDHIIIDTPPVLAVTDGIIISQYSGVNLIIARHAKTQMKELEITVNRFEQAGVKVNGFILNDIQRTAAGYGYGYGYNYA
YAYQAKKDD
>gnl|bykdb|A0A062DLF3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter baumannii 496487] (length=727 residues).
MNQNTNTEDTIDLKELFFSLIAQWKLIALCIILSLVCALLYLRVTPDTYSVDALVQVEDSKGASAALLGDLSDMIEQKSP
AQAEIEILKSRLVLGSVIKELHLDIHVSSTENTLTHRLLSDTEYKTEYTKNSVLFKDGTKNFDIRRFEVPAYYLDKQLVL
SFDQKSFKLVDPETDEVVLTAPINQNNQITGAYGVWKVAIFTKDQLDSKYNIKKLSIPAAVDNISSNYSVAERGKLTGIL
GLNYQGHDKEHITQVLNAILVTYGAQNVERRSAESAQTLKFLDEQLPDLKKQLDDAERQFNKFRQQYNTVDVTKESELYL
TQSITLETKKAELEQKQAEMAAKYTAEHPAMREINGQITAINKQIGELNSTLKQLPDVQRQYLQLYREVEVKTQLYTALL
NSYQQLRIAKAGEIGNVRIVDTAVEPVEPIKPKKLQVLILSLFLGGFIGTLIALLRNMLRTGIKDSGQIENELDLPVYAT
VPRSPIQESRIKILKKKKSIPILAVKNSDDIAIESLRSIRTAIHFALANAKNNIIMIAGPSPEVGKSFISTNLATIFAQG
NKRVLLIDADMRRGYIHKYFDVDVKPGLSELLSGQADFQQVLHKTQVANLDVITRGKSPTNPSEILSSAQFKDLLEKVQS
QYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSQMKELELTLNRFEQAGVKVNGFILNDIQRASAGYGYGYNYAYA
YKAQKED
>gnl|bykdb|A0A062F3W1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter baumannii 754286] (length=727 residues).
MNQNTNTEDTIDLKELFFSLIAQWKLIALCIILSLVCALLYLRVTPDTYSVDALVQVEDSKGASAALLGDLSDMIEQKSP
AQAEIEILKSRLVLGSVIKELHLDIHVSSTENTLTHRLLSDTEYKTEYTKNSVLFKDGTKNFDIRRFEVPAYYLDKQLVL
SFDQKSFKLVDPETDEVVLTAPINQNNQITGAYGVWKVAIFTKDQLDSKYNIKKLSIPAAVDNISSNYSVAERGKLTGIL
GLNYQGHDKEHITQVLNAILVTYGAQNVERRSAESAQTLKFLDEQLPDLKKQLDDAERQFNKFRQQYNTVDVTKESELYL
TQSITLETKKAELEQKQAEMAAKYTAEHPAMREINGQITAINKQIGELNSTLKQLPDVQRQYLQLYREVEVKTQLYTALL
NSYQQLRIAKAGEIGNVRIVDTAVEPVEPIKPKKLQVLILSLFLGGFIGTLIALLRNMLRTGIKDSGQIENELDLPVYAT
VPRSPIQESRIKILKKKKSIPILAVKNSDDIAIESLRSIRTAIHFALANAKNNIIMIAGPSPEVGKSFISTNLATIFAQG
NKRVLLIDADMRRGYIHKYFDVDVKPGLSELLSGQADFQQVLHKTQVANLDVITRGKSPTNPSEILSSAQFKDLLEKVQS
QYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSQMKELELTLNRFEQAGVKVNGFILNDIQRASAGYGYGYNYAYA
YKAQKED
>gnl|bykdb|A0A062FLH1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter baumannii 940793] (length=727 residues).
MNQNTNTEDTIDLKELFFSLIAQWKLIALCIILSLVCALLYLRVTPDTYSVDALVQVEDSKGASAALLGDLSDMIEQKSP
AQAEIEILKSRLVLGSVIKELHLDIHVSSTENTLTHRLLSDTEYKTEYTKNSVLFKDGTKNFDIRRFEVPAYYLDKQLVL
SFDQKSFKLVDPETDEVVLTAPINQNNQITGAYGVWKVAIFTKDQLDSKYNIKKLSIPAAVDNISSNYSVAERGKLTGIL
GLNYQGYDKEHITQVLNAILVTYGAQNVERRSAESAQTLKFLDEQLPDLKKQLDDAERQFNKFRQQYNTVDVTKESELYL
TQSITLETKKAELEQKQAEMAAKYTAEHPAMREINGQITAINKQIGELNSTLKQLPDVQRQYLQLYREVEVKTQLYTALL
NSYQQLRIAKAGEIGNVRIVDTAVEPVEPIKPKKLQVLILSLFLGGFIGTLIALLRNMLRTGIKDSGQIENELDLPVYAT
VPRSPIQESRIKILKKKKSIPILAVKNSDDIAIESLRSIRTAIHFALANAKNNIIMIAGPSPEVGKSFISTNLATIFAQG
DKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQADLQKVLHKPQVTNLDVITRGKSPTNPSEILSSNQFKELLEQLQS
QYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSQIKELELTLNRFEQAGVKVNGFILNDIQRASAGYGYGYNYAYA
YKAQKED
>gnl|bykdb|A0A062GRG2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter sp. 72431] (length=728 residues).
MNQQNTNTEDTIDLKELFFSLIAQWKLIALCVILSVVFALLYLRVTPDTYSVDALVQVEDSKGASAALLGDLSQMIEQKS
PALAEIEILKSRLVLGSVIKELHLNIQISSTENTLTHRLLSDTEYKTEYTKKSVLFQDNLKSFEVREFEVPNYYLDKNLL
LNFDKQSLRLTDPTTEEVILTLPLNKVSQVVGPHGRWKIAIFTKDQLDATYNITNLSLPAAVNALSVNYSVAERGKLTGV
LGLNYQGQDKEHITKVLNAILATYSAQNIERRSAESAQTLKFLDEQLPDLKKQLDDAERQFNKFRQQYNTVDVTKESELY
LTQSITLETKKAELEQKQAEMAAKYTAEHPAMREINGQLAAINKQIGELNNTLKQLPDVQRQYLQLYREVEVKTQLYTAL
LNSYQQLRIAKAGEIGNVRIVDTAVEPVEPIKPRKLLVLILSLFVGGFIGTLIALLRNMLRTGIKDSGQIENELDLPVYA
TVPRSPIQESRIKILKKKKSIPILAVKNSDDIAIESLRSIRTAIHFALANAKNNIIMIAGPSPEVGKSFISTNLATIFAQ
GDKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQADLQKVLHKTQVANLDVITRGKSPTNPSEILSSNKFKELLDQLQ
SQYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSQMKELELTLNRFEQAGVKVNGFILNDIQRASAGYGYGYNYAY
AYKAQKED
>gnl|bykdb|A0A062IEG8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter baumannii 21072] (length=728 residues).
MNQQNTNTEDTIDLKELFFSLIAQWKLIALCVILSVVCALLYLRVTPDTYSVDALVQVEDSKGASAALLGDLSQMIEQKS
PAQAEIEILKSRLVLGSVIKDLHLNIQVSSTENTFTHRLLSNPEYKTEYNTKSVIFKDGLKSFDIHQFDIPAYYLDKNLL
LNFDKQSLRLTDPASEEVILTVPLNQANHVAGPHGLWKVAIFTKDQFDATYNIKIQSIPAAVDALSANYSVAERGKLTGI
LGLSYQGQDQEHITKVLNAILATYSAQNIERRSAESAQTLKFLDEQLPDLKKQLDDAERQFNKFRQQYNTVDVTKESELY
LTQSITLETKKAELEQKQAEMAAKYTAEHPAMREINGQLTAINKQIGELNSTLKQLPDVQRQYLQLYREVEVKTQLYTAL
LNSYQQLRIAKAGEIGNVRIVDTAIEPIKPVKPKKLLVLALAIFVGGFIGTLIALLRNMLRTGIKDSGQIENEMDLPVYA
TVPRSPIQESRIKILKKKKSIPILAVKNSDDIAIESLRSIRTAIHFALANAKNNIIMIAGPSPEVGKSFISTNLATIFAQ
GNKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQADLQKVLHKTQVANLDVITRGKSPTNPSEILSSNQFKELLEQLQ
SQYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSQMKELELTVNRFEQAGVKVNGFILNDIQRASAGYGYGYNYAY
AYKAQKED
>gnl|bykdb|A0A062IPM4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter baumannii 233846] (length=731 residues).
MNQNSKTSEDSIDLKELFFSLIAQWKIIACCVVLSLICALLYLRITPDTYSVDAMVQVEDSKGAASAALLGDLSKVSGGL
SQKSPADPEIEILRSRMVLGQVIQNLNLDINVKDNQSGLIDKLISQDKSRLEYRHESVLYSNQNNNLIIRELKVPEYYLD
KPLKLEFKGANQFTLTYKDQVVFNGQLNKKNILNTNRGLWQVQLNAQGNLKEQSYTLTKLALPTAVKNFNDIYSVAEKGK
VTGVIGLNYLGQDPEHITQVLNNVLTVYHQQNIERKSLESKQTLAFLEKQLPELRKQLEDSEIKFNQFREKYKTVDVNAE
SELLLKQNIDLEKLKIELQQKQAELSAKYTNDHPLIRQIDAQITEINKKIADLNNRLTQLPETQRLYLQLYRDVKVNTEL
YTSLLNSYQQLKIANAGEIGNVRIIDTAVEPVKPIKPKKLIVLILSIFIGGFIGVLIALLRNMMRSGVNDSTQIENELDL
PVYATVPRSPIQETRMSILKKKKSIPILAVKSNDDIAIESLRSIRTAIHFALTSAKNNIIMIAGPSPEVGKSFISTNLAT
IFAQSNKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQADLTQVLHKTQVANLDVITRGKSPTNPSEMLSSTQFKDLL
EKFQTQYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSHMKELELTVNRFEQAGVKVNGFILNDIQRSGGGGYGYN
YAYAYKAQKED
>gnl|bykdb|A0A062L0G0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter baumannii 1571545] (length=729 residues).
MSQTSKTEDTIDLKELFFSLIAQWKLIVLCILISLVCALIYLRVTPNTYSVDALVQVEDTKSAASAALLGELSKMVDQKS
PAEAEIQVLTSRMVLGQVIHNLNLDITIKNHDDTFFNRLLSQDKQNIDYKKDAVTFSNKDSYFSIQQFQIPSYYLDKPLL
LSFKDQGHFTFSYKDKVIFSGQLNSNNLVTAREGQWKVRINSTHAPSVEQQFTISKLALPTAVQKLGSTYGVAERGKQTG
VIGLSFQGTDKEHITEVLNNILAVYHSQNIERRTLESKQTLDFLDKQLPDLKQQLEESERKFNQFREKYNTVDVTQEAEL
YLKQNIALETTKTELKQKQAELAAKYTNDHPLMAEINAQLAAVNKKSAELSDTLKRLPEVQRQYLQLYRDVKVNTELYTS
LLNSYQQLKIAKAGEIGNVRIIDTAVEPIKPIKPRPLLVLFLSLVVGGFIGTVLALLRNMLRTGVKDSTQIENDLNLPVY
ATVPRSPIQETRMNILKKKKSIPILAVKSSDDIAIESLRSIRTAIHFALTTAKNNIIMIAGPSPEVGKSFISTNLATIFA
QGNKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQADLQKVLHKTQVTNLDVITRGKSPTNPSEMLSSTQFKDLLEKF
QSQYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSQMKELELTLNRFEQAGVKVNGFILNDIQRASAGYGYGYNYA
YAYKAQKED
>gnl|bykdb|A0A062MI21 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter baumannii 1288284] (length=728 residues).
MNQQNTNTEDTIDLKELFFSLIAQWKLIALCVILSVVCALLYLRVTPDTYSVDALVQVEDSKGASAALLGDLSQMIEQKS
PAQAEIEILKSRLVLGTVIKDLHLNIQVSSTENTLTHRLLSDADYKTEYTTKSVIFKDGLKSFDIRQFEIPAYYLDKNLL
LDFDKQSLRLTDPVTEEVILTVPLNQVNHVAGPHGLWKVAIFTKDQFDATYNIKSLSLPIAVNAISANYAVAERGKLTGV
LGLNYQGQDKEHITKVLNAILATYSAQNIERRSAESAQTLKFLDEQLPDLKKQLDDAERQFNKFRQQYNTVDVTKESELY
LTQSITLETKKAELEQKQAEMAAKYTAEHPAMREINGQLAAINKQIGELNSTLKQLPDVQRQYLQLYREVEVKTQLYTAL
LNSYQQLRIAKAGEIGNVRIVDTAVEPVEPIKPKKLLVLILSVFVGGFIGALIALLRNMLRTGIKDSGQIENEMDLPVYA
TVPRSPIQESRIKILKKKKSIPILAVKNSDDIAIESLRSIRTAIHFALANAKNNIIMIAGPSPEVGKSFISTNLATIFAQ
GNKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQADLQKVLHKTQVANLDVITRGKSPTNPSEILSSNQFKELLEQLQ
SQYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSQMKELELTVNRFEQAGVKVNGFILNDIQRASAGYGYGYNYAY
AYKAQKED
>gnl|bykdb|A0A062NA32 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter sp. 796380-1375] (length=731 residues).
MNQNSKTSEDSIDLKELFFSLIAQWKIIACCVVLSLICALLYLRITPDTYSVDAMVQVEDSKGAASAALLGDLSKASGGL
SQKSPADPEIEILRSRMVLGQVIQNLNLDISIKDNQSSLIGKLVSQDQSKLEYRHDAVIYTNQNNNLIVKQLSVPEYYLD
KPLKLEFKDVNQFTLTYKDQVVFNGLLNKKNILNTDKGLWQVQLNTQGNLKGHSYTLTKLALPTAVNQFNKIYGVAEKGK
MTGVIGLSYLGQDPEHITQVLNNVLNVYHKQNIERKSLESKQTLAFLEKQLPELRKQLEDSEIKFNQFREKYKTVDVNAE
SELLLKQNIDLEKLKIELQQKQAELSAKYTNDHPLIMQINAQIAEINKKIADLNNRLTQLPETQRLYLQLYRDVKVNTEL
YTSLLNSYQQLKIANAGEIGNVRIIDTAVEPVKPVKPKRLIVLILSIFAGGFIGVLIALLRNMMRSGVNDSTQIENELDL
PVYATVPRSPIQETRISILKKKKSIPILAVKSNDDIAIESLRSIRTAIHFALTSAKNNIIMIAGPSPEVGKSFISTNLAT
IFAQSNKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQADLSQVLHKTQVANLDVITRGKSPTNPSEMLSSTQFKDLL
EKFQTQYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSHMKELELTVNRFEQAGVKVNGFILNDIQRSSGGGYGYN
YAYAYKAQKED
>gnl|bykdb|A0A062SWF7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter baumannii 25977_9] (length=731 residues).
MNQNSKTSEDSIDLKELFFSLIAQWKIIACCVVLSLICALLYLRITPDTYSVDAMVQVEDSKGAASAALLGDLSKASGGL
SQKSPADPEIEILRSRMVLGQVIQNLNLDISIKDNQSSLIGKLVSQDQSKLEYRHDAVIYTNQNNNLIVKQLSVPEYYLD
KPLKLEFKDVNQFTLTYKDQVVFNGLLNKKNILNTDKGLWQVQLNTQGNLKGHSYTLTKLALPTAVNQFNKIYGVAEKGK
MTGVIGLSYLGQDPEHITQVLNNVLNVYHKQNIERKSLESKQTLAFLEKQLPELRKQLEDSEIKFNQFREKYKTVDVNAE
SELLLKQNIDLEKLKIELQQKQAELSAKYTNDHPLIMQINAQIAEINKKIADLNNRLTQLPETQRLYLQLYRDVKVNTEL
YTSLLNSYQQLKIANAGEIGNVRIIDTAVEPVKPVKPKRLIVLILSIFAGGFIGVLIALLRNMMRSGVNDSTQIENELDL
PVYATVPRSPIQETRISILKKKKSIPILAVKSNDDIAIESLRSIRTAIHFALTSAKNNIIMIAGPSPEVGKSFISTNLAT
IFAQSNKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQADLSQVLHKTQVANLDVITRGKSPTNPSEMLSSTQFKDLL
EKFQTQYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSHMKELELTVNRFEQAGVKVNGFILNDIQRSSGGGYGYN
YAYAYKAQKED
>gnl|bykdb|A0A062TV82 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Hyphomonas sp. T16B2] (length=798 residues).
MSKTFSFELPSQVPAEAETTGNAMPTDLKSLLGTVYRRFWLIAISFLTVFLLVAYVTFTTTPTYKSTAVVQLDTEQQNVI
DLGSVLSGLVASTAVIDTEVMVMQSKSLLTKVADKQKLTEDPEFNWTLREEKPGMLDGLSRQIKSLFGMNTDKKDPFAGM
SVDERNSSIEDSVVGALMKKVSVGRVGTTYLISVTVTSESPETAARLANAVADQYRVQQMETKLDATRRATEWLTDRTSA
LKSEVEEKENRVAKFIADNDMETAMGGTITEQNISYLTTQKTQAEVELNRARSRYDSLQRQLASGAGVDGISEVLESQLI
TNLKQQLSSVRSRVEDLKTRLGPQHPELIGAMAEQDDIERQIQAEMQRIANNLENEVKVKRDQVNRLQGQINQAGSKLRG
NNLANVRLRELQRDAETSRVLYEEFISRSKETREQSDLIEPDAVILSSASVPHSPSAPRTKLNLLIGAVLGGILGAGLAL
LAEMFDMKISSSEDIEKKLGVNAIGTVPLIKTSNALGFGQMNPADYLIENPLSAFAESVRYLRAAIAFSDLDSETKTVAI
TSSLPDEGKTSLTLALGRMSAMSGARTLVIDGDFRRRQLTEAAGLKPEIGFIEYLFGAGQLSDAITKDPKSMLDILPLSL
TGHTPHDVFGTRAFDDLLVRLRSMYDLILIDTGPLLLMAEARVVAGKTDKAILVVRWRHTNRSAARQSLGLLKSFKADLL
GVTLNMVNLNRRRHYRDPGAGYDAYRKYYQIETKPSLFGFKWKSASKKNEGSVRPKAIQTPPSLAEHSSETPEKVDVD
>gnl|bykdb|A0A062UCS5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Hyphomonas beringensis] (length=798 residues).
MSKTFSFELPSQVPAEAETTGNAMPTDLKSLLGTVYRRFWLIAISFLTVFMLVAYVTFTATPTYRSTAVVQLDTEQQNVI
DLGSVLSGLVASTAVIDTEVMVMQSKSLLTKVAEKQKLDEDAEFNWTLREEKPGMFDGLKRQIKSLFGMSTAKKDPFAGM
SVDERNAAIEDAVVGTLMSKVSVGRVGTTYLISVTVTSESPETAARLANAVADQYRVQQMETKLDATRRATEWLTDRTSA
LKSEVEDKENRVAKFIADNDMETAMGGTITEQNISYLTTQKTQAEVELNRARSRYDSLQRQIASGAGVDGISEVLESQLI
TNLKQQLSSVRSRVEDLKTRLGPQHPELIGAMAEQDDIERQIQAEMQRIANNLENEVKVKRDQVNRLQGQINQAGSKLRG
NNLANVRLRELQRDAETSRILYEEFISRSKETREQSDLIEPDAIILSNASVPHSPSAPRTKLNLLIGAVLGGILGAGLAL
LAEMFDMKISSSEDIEKKLGVNAIGTVPLIKTSNALGFGQMNPADYLIENPLSAFAESVRYLRAAIAFSDLDSETKTVAI
TSSLPDEGKTSLTLALGRMSAMSGARTLVIDGDFRRRQLTDAAGLKPEIGFIEYLFGAGQLSDAITKDPKSMLDILPLSL
TGHTPHDVFGTRAFDDLLVRLRSMYDLILIDTGPLLLMAEARVVSGKTDKAILVVRWRHTNRSAARQSLGLLKSFKADLL
GVTLNMVNLNRRRHYRDPGAGYDAYRKYYQIETKPSLFGFKWKSAGKKDDGSVRPKAIQTPPSLAEHSSEPPEKVDAE
>gnl|bykdb|A0A062UIT5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Hyphomonas chukchiensis] (length=785 residues).
MPLGGGSSDDMPIDFKALIGTVYRRFWIIVTGFLVTLFAVAYITFTQTPIYKANSILQLDTNKENVIDLGSVLGGLAAST
ATIDTEVRVMGSKSLLTKVATKLKLSEDPEFNWTLREQKPSLIDMAKGQIGAWTGHPPKKTVPYANLSAAEREAAILESV
TRTLMNKVHISRIGTTYLIQVEVTSQSPETAARIADAVADQYRVQQLDSKLEATRRATAWLSERVAGLRDEVEAKEKRVE
EFRAETGLLSAQGATLTEQQIAYNTTQKSQLQAQLNRARSRYDNMKRQIDSGVGIDAIAEVLDSPVISGLKAQRAQILRR
VAELETTLGPSHPELIGARNEAADIEKQIEAEVNRIAANLENEVKAAQDQINSINSNIGQSTAQLRGNNINLVRLRELER
DAETSRVLYEEFISRSKETREQDDLVQADANILSTATVPDSPSSPKKLLNLIIGALLGGIIGGGLALLAEIFDMKISSAD
DIERKLGVNSIGSVPLIRSTSLLPFSQINPADFLVDNPLSAFAESIRYLRAAIAFSDLDSETKTVAITSSLPDEGKTSLT
LSLGRMSAMSGSRTLVIDGDFRRRQLTDAAGMSPEIGFIEHLFGAGQLSDAICKDSRSMLDILPLSKAGHVPHDVFGTRA
FDDLLARLRSMYDLILIDTGPLLLMAEARVVAGKTDKTILVIRWRRSLRSAVRQSLTLLKTFNADLLGITLNMVDLTRRR
HHKDPGAAYKAYSKYYSMETKRSIFGWNKTPKANGMTSAPNPMATPVKPEKSPVKTGSSTEVSTH
>gnl|bykdb|A0A062VFP6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Hyphomonas polymorpha PS728] (length=779 residues).
MSSFDLKSLMSMIYRRFWLIFAGFVTVMSLVIFVTFTQTPTYRAQSVLQLDTNQINVIDLGALFSGAGGATTSVIDTEVR
VIGSKTLLARVAEKQRLIEDPEFNWTLRPKKESLVSSAQKAVVGLLGGDTSEKDPFAGMTAEQKEAEIFESVVGTLMTKV
RVGRVGATYLLTVDVTSTSPETAARLANEVADQYRVQQLEKKYDATRKATEWLQERVSGLRDEVEEKEQRVESFRAETGL
LEAQGTTLTEQQIGYLTSQRGQAQIEVDRARARYESMRRQIDSGAGVEGVSEVINSPLINDLKTQRSIIMRRVAELETRV
GDRHPDLISARNEVADIDRQMSAEMNRIAANLESELRVAQAQLSSIQGEIGRSTSQLRGNNVNLVRLRELERDAQTSRVM
LEEFLARSKQTREQDALITADSSILSTASVPYSPASPRKAFNLVIGALLGLIIGGFLAIIAELFDSNISSSEDVENKLGS
NPIGSVPLIRTAGLLGLGQTSPADFLVENPLSAYAESIRYLRAAIAFSDLDSETKTVAITSSLPDEGKTSLALSLGRMSA
MSGSRTLVIDGDFRRRQLTEMAGLKPEIGLVEHLFGAGQLSDAIVKDHKTMLDILPLSLNGHTPHDVFGTRAFDELLSRL
RAMYDLILIDTGPLLLMAEARVVAGKVDKAILVVRWRQTTRSAARQSLTLLRNFKADVLGVTLNMVDLNRRRHHRDPGAT
YKAYRKYYQMEAKPGLFGWSKPKKPKASKQGPKSAIAIQVPPSKASGRKQDPVDRISAE
>gnl|bykdb|A0A063B274 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia sp. lig30] (length=761 residues).
MNRIFMNRASGPLPETDRGDAPELVRHVDLVLTNRWLVAGVTAIVFAAGAAYALLARPVYESNLLIQVEDNTGSADSLLG
SVSSLFDAKMQAAAEIEILKSRMVVGHAVENLRLYIDATPKRFPLVGKAIAARAHGLSRPGLFGFGGYGWGAESVDIGTF
DVPKAFEGETFELTALPDGRFRLENGDLDRPIEGALGQLVESTQAGGTFRIRVDALHARPGAAFRVERHSALKVLQKLQK
HLNVSEIRKQSNVINVSLKGEDPDAVANILNTIGTAYVAQNVKRKSAEAEKSLAFLENVAPQLKQNLEQAEAKYNAMRRK
RGTFNLGIEAQAYLQDSIATQATLLTLQQKYAEASTRFTAGHPEMQALDRQIGGAKQKIDGLAGRLRAFPDIEQDELRLR
RDVEVGNEMYVGVLNNIQQLKLVSAGKVGNVREVDNAPVPEEPVEPRRALILALSAILGMMLGVTAAVARESLFGGVTDA
DDIERRTGLAVYGTIPDSAAQRAAAALAARRGYIPSLLADENPHDPSIESLKSLRTALSLALLDADNNRVLLTGPSPGVG
KSFVSANLAAVMAAAGQRVLLVDADMRRGHLNESFDVPGSPGLSDVLTGRVSLRGATHRVSEGLDVMPTGTPSPRTSELL
LGEPTLRLLDEMSAAYDVVIIDTPPVLAVSDASILAPHCATAFLVTRSRQTTIGEIAESSKQLNRLSPGLLGVLFNGVDT
RAFGYRSRYGAYRYAPYGSIEANGDTQAAAGRRSRARREAS
>gnl|bykdb|A0A063BD96 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia sp. lig30] (length=777 residues).
MSEISSPLEKRRTAQSLYAGDDEGGISIGEFVDLLRNGMVTILITAVIVALLGQVVSVMSPRVFVASGLVQVEASAGGPN
STLTELTQLLTGAPAQTAAELQVLQSRVVLDQVVDKLNLQISTAPKAFPVIGNTVQRLRQNLPKPSSAPFGLGKFAWGGE
KFVVTRFDVPDDWIGHSFTLTAGEAGHYVLTDSLGVVVLRGITGKLATSADGKVELLVSGFVARPHTEFTVRKVTRQEAL
GKISPYLMVAEQGSSSGVLQITYKGSSPEFVTDVVAAIQQAYFAQNIARRSQDAQQSLDFLKRQLPLLKDQLAKSQEKLA
AYQKSNSLVDITGETRTVLQETVQLQADRLKLQQDRMQVIQRFTPQHPAVKMVDDQIGVLDAKIAELSKRTQGLPDVQQK
VFSLTRDLEANTQLYTAMLSTIQGLEISRAGTIGNVRILELPLQPLAPASPRTDLITGVSIFLGLALGVGLVLAQRMLMR
GVDDPFVLERRFGVSTYASIPYVSEQREITRRLRQGEGYGVLAAFDPKNRAVEALRALRTSLQFKMLDAPNNVIMVTGPI
PNIGKSFVATNLGAVLALSGKRVVVVDADLRRGRLHEYFQVPVHPGLSELIADAADAGAAVRSSEIDLLDVVPRGDLPSN
PAELVMHRRLDMVIKALSEQYDYVLIDSAPIFPVSDSAVIARTAGTILLVLKSGEHREREIQEALARLDSSGVKCDGFIF
NQVGARAGSYGYGYGYAYSYGYEYTSEVSEGFVPKLKSVVRSILGRDDVKGNKRRDR
>gnl|bykdb|A0A063KHB9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudoalteromonas fuliginea] (length=743 residues).
MNPKPTAPTSNQNKSNEQEIDLLALFGTLLDRKYFIVLFTAVFAIIGVAVALFSTPIYKATALIQVEESSPSVPGLDDMA
GMFESSSEAVTEIELLKSRSVIGEAVDSLKLNIVAEPKLFPVIGGRFFRGFVAEKENDIAEPMLGASSYAWGGEAINVFR
FVVPTAFEDKEFELVVNKNAQYELINPDGDTVLTGKVGQDESSGYYELTVRSLNARPGTTFTLIKNNRYRTVIDLQQEIS
ASEKGKDSGIITLAYEHKSSTHAAKVLDKVADIYVRRNVERNSAEAKKSLDFLEVQLPEVKKQLEGSEQRFNDYQKQRKS
VNITLETQAVLEQIVELDTTLQELDLKRLELSRKFKREHPAYQGVIKQIESIETEKKLLTSKISNLPETQQELLRLTRDV
EVGNEIYMLLLSKTQELDIVRAGTVGNVRVVDVAAVDTTEPVKPKKALIAIVATLLGGFLAVAIVLIQKAMHKGVEDPAE
IEALGIPVYASVPHSDFQDKLAGFTGRTKKNKVGKPKSILALDNPADLAIEALRSLRTSLHFAMMESKNNIIAISGPSPG
VGKSFISVNLAAVLAQSGKKVLIIDADMRKGYLQTQFGLKWDDGLSDYLSGRLNLEQVTKATKVKGLSVITRGQIPPNPS
ELLMHSNFSKLIEEINAAYDIVIIDTPPILAVTDPAIVSAHTGTTLLVARFGQNHLREIELTRNRFEQNGIDVKGLVFNG
VVKKASNAYGYYGYYNYEYKSDK
>gnl|bykdb|A0A064DSW7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Citrobacter freundii MGH 56] (length=720 residues).
MTEKVKQSAAPVTGNDEIDIGRLVATVVEARWWVLGITAVFALCAAIYTLFATPIYSADALVQIEQNTGNSLVQDIGSAL
SNKPPASEAEIQLIQSRLVLGKTVDDLNLDIAVTKDTFPIFGAGWDRLMGRQNETVNVTTFTLPKAMNEQTFTISVLNDK
RYQLVSDGGFSAQGQVGQILEHDGVTMLVEAIHASPESQFTVRKFSTLGMINTLQNNLMVTETGKDTGVLSLTFTGEDRE
QIRQILDSITRNYLQQNVERKSEEAAKSLAFLAKQLPEVRNRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLFTKAHPAYRTLLEKRQALEDEKSKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITE
ASTVGDVRIVDPAIAQPGVLKPKTALIILGSIILGLMLSVVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
NVQTIKGVKRYKQSQLLAVGNPTDLAIEAVRSLRTSLHFAMMQARNNVLMLTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGKGDISSGAKPTSIAHFDLIPRGQIPPNPSELLMSERFGELIAWASSHYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIQVKGVILNSIFRRASGYQDYGYYEYEYTSDSK
>gnl|bykdb|A0A066PQH4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acidiphilium sp. JA12-A1] (length=718 residues).
MDTAAKARDRVRQIGGTADPIDALRAVRRHWRLAVLVALGLPLLSLGALSRMRPVYTATGTLLYNPVDFNPKLLRGVVET
RQVTDALMASQAAILKSPAVVARVIDGLDLGASPEFDPARQRPSLLRRWLGSAGPPLPVAPDALRDAVTARFHIDVPAGS
QLINVSFTAHDPALAARAANAAMAAYLARERRESLAVLDRAQAWLGQRAKATAHRLEALDVAIARERARSGTVRGAGAAP
LTNEEAGQLTGSLAAARADLAAARARLAALNGGSEAEAAAAVAPEIAPMRAREAELAAKLRALGSTEGPNYPDIRATKRA
LAALRGQIAAETGRLITADRMRAAAAAARVKSLKAELAAVRDRAAAQSVRAAPLARLEEERTAESDLLRAQTEQIGTLES
HSALTRPDARIIAAATRPLQPSGPRSAAILSGAVLLGLCLGVLAALLADSLNGSFRSGGQVREALELPCMALLPEVGRRE
RRGLSVPDYARRYPFSAFAEQIRALRTGLWLAPGAPRSLAVTAARPGEGKTTLAVSLALSVAASGARVLVIDCDIRQPSF
DMIFGLGGLPGLTDHLAGRATLEAAIHRPGLEEGGSLPDVMPAGAVATEALALFMSDRLGRLMAELHGRYDLVVLDLPPV
FALAEAQLLARAAAATLLCIRWGQTPRRTVAAALALLDQGGLRLAGAALTRVDGPRHARSGFPDSELYHPRYGGYFRL
>gnl|bykdb|A0A066SVX4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTIIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQSSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWERLTGRQNETVKVTTFNRPKEMADQVFTLNVLDNK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHASPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKVLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVKWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A066UMK7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio fortis] (length=724 residues).
MTTQPSRQTKTDNSDEIDLGKLFGILLDAKWWIIFTTFTFALGGVVFAMLSTPIYKADALIQIEEKSSGGISSMVGDMGE
LFAQESSAATEIEIIKSRMILGETVDKFDLTTVTTPIYAPFVGKGIARLTGDDNNISISRFVVPGYASGYAHTIRILDTE
QGTYQLIREDERIILEGQVGQLVASGDYSLFVAGFESHNGFEFAISKRNRLEAIEWLKQSLSLSEQGKQTGILKLSFEGE
NKQQISEILNHINQIYFLQNVKRNSAEAEKSLAFLEGHLPGIKSQLTTFEDTLNNYRQENESIDLGLEAQSTLKVMVELE
AQLNELTFKESEISQRFTKDHPAYKSLLDKRETLLKEKERLNQQVQKLPKTQREVLRMTRDVEVNQQIYIQLLNKVQELS
IIKAGTVGNVRILDDAQAYARAVKPKKPLIVVFATLIGCMLSVALVLVKAAFHRGVENPEQIEELGLPVYAAVPKSDLQL
ELTNRFKSKRKQTFGAQALLAESNPADLSVEALRGLRTSLHFAMLEAKNNILMISGPAPGIGKSFISTNFAAVAAKTGQK
VLLIDADMRKGYLQQSFGLKWDNGLSDLLSGKQDFTQSIKSTPVENLEIITRGQVPPNPSELLMHPRFAELMEWASKEYD
LVIVDTPPILAVTDPSIVGAFAGTTLMVARFGQNTVKEIDVARNRFEQSGIEVKGVIFNAIEKKASSSYGYGYYSYSYSA
HKGD
>gnl|bykdb|A0A068DEJ1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium huakuii 7653R] (length=795 residues).
MNYANFPLDKRMPLPNSDAGNGEDFIDIERLLGMAARQAKVVAVCAAIGLFLGMLYLQTTPPKYVSVSSVLIDEGLNKIV
DDISAASTTMQTDSAILSQIEILTSTRLAAVVVDKLKLAQNDAFMNPPQSALAQGVGLIRGLIQYVRPSPPIPGMGDISK
LDPATRDALIATSSRDYAILKLQNEIQADRVGRSYVIALGYQATDPGLAKAITKAYADAYLADQLDASFDATERAAVWLQ
GRLTELRESSQQASLAVEKFRAEHGLSANSDGQLMSDKQLADLNAQLIVAQADTARASARYQQYKSIVDSGSDNAFKDAA
ISSDQPSSSVISALKTRYLTVAKRQQDVEANFGPDHPQAVALAKEKADISKQIFGELKQLTESYRNEYEVALARETALRA
NVAAAQGKSSIDNQSQVQLRDLDQKATALTTLYQTFLGRYEEAAQQQSFPVGKIRIISDASTPLSASSPRTVIVLGLSLV
LGVLMGAGFGGLNEFNERFFRTGEEVRDRVGLKFLGYLPTIGSRPAKDDKQTDALPDAKTARSPAAIERRARMRVSIDAP
ASMFSETLRSAKIAFDVVMEGQGSRVVGVISVLPGEGKSTVAANLAGLLAANGARTLLIDGDLRNPGLSRSLGMEAEQGL
MEAVVNGQTWQSVGKIDRQTKLAIIPAVLRGNFSHTSELLSSAGMRRFIENAKETFEYIVVDLPPLGPVVDAKAFAPLVD
GFVLVTEWGRTPRAMVRSMLESEPYVANKIVGAVLNKVDLKKLAKYGSFGASEKFFDKYSSYYLDKSEVRSKATV
>gnl|bykdb|A0A068EWI4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Lonsdalea populi] (length=724 residues).
MSEKIAVKTSEIDRSDDVDLGRLLGTMLDNRWLIISVTTIFTVIGILYVLMATPIYRADALIQVEQDAGDSLLKDVSSML
PDAKPQSAAEIELIKSRMVIGKTVQDLSLDTEVEQKYFPGIGKGFARILNQKSGNIAISRLQVPGMVMNKVLTLEVLDSG
RYRLTDSDGRVDITGKVGQLESRDRVSILVSDIEAPAGTEFNVRKLDELTAINKTLNALAVADKGKDTGVLSLTLEGVDP
EQTQKILNSIADNYLQQNVERKSAEAAKSLEFLKGQLPIVRTSLDEAENKLNLFRQQNDSVDLTLEAKSVLDTMVGVESQ
LNELTFKEAEISKLYTKEHPAYRALMEKRKTLEDERDKLNKRVNGMPKTQQEILRLTRDVNVGQEVYVQLMNKQQELSIN
KASTVGNVRIIDSAMVKMSPVKPKKALMVLLSIILGSMVSVAFVVLKTVLHKGIENPEQLEELGVNVYASVPLSEWQQKK
DRETAVRHKRGSPMVPSLLAMGNPTDLAIEAIRSLRTSLHFAMMEAKNNVLMISGASPGIGKSFISANLGAVVAQSGQRV
LVVDCDMRKGYAHQLMGTSGDKGLSDILSGQLAAETTVRQTAQENLSFIPRGQIPPNPSELLMHNNFSRFLGWASENFDI
VLLDTPPILAVTDAAIISRQVGTSLLVARFLVNTPKEIEVSIRRFEQNGADIKGVILNAVVKRAASYYGDGSYNYYAYEY
KSDN
>gnl|bykdb|A0A068SQR2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Neorhizobium galegae bv. orientalis str. HAMBI 540] (length=757 residues).
MDGLIAIIRRQWRVVGLCVAVFVMLGIGYMLTAVPRYTARTSVLIDRGNRQVVEQLSTIGGVLDDEASVLSQVELLRSET
IGLSAVDKLELSDDPEFMAGRRSLLLAAVSDIRSILDIRRWPGGGEVRFDQIEAQRRQALANLLGNMKVSRVGRSYVLEI
TFTATSPRLAAAVAGAIADAYLTDKLDAKYDATRRAGTWLQERIEELRQRSLESDLAVQRFRAENGLVTANDRLVSDQQL
TELNSALIVARADTARAQARSDRIEAIIARGQSEAIVTDALDSSVISSLREKYLESSKREADISRRLGQGHVQAARLRQE
MAEYDRLMFDELKRIAGSYQSELEVAQSRERQITLGVSNATDISVTAGETQVQLRELERAADAYRNLYQTFLQRYQEAVQ
QQSFPVTEARIISRAVPPTTASEPRLSLVLALCLALGCGVGGVLGAFREFRDRFFRTGEQVRDILGLEYLGSVPLVQPQT
GSRPSTEPVKGEIYRKNELSGFATEHPSSAFAETLRSARIAADVQIDRPHRVIGIVSMLAGEGKSTIAVNFAQTLARSAR
TLLIDVDLRNPGATRALGQHAEEGLLEVLLEGVAPASAMLADPVTGLKFLPAVVRRRIPHSSELLASAAMARLLAQVAGE
FDYIVLDLPPLGPVVDARAIAPRVDGFIMVVEWGETSRKAVKETLDAEPQIAGRCLGVILNKVDAARVRLYEGYGSSDYY
ASRYTHYYHETHPDPTPVSIGAATRVKTAREKPDSSR
>gnl|bykdb|A0A068SV02 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Neorhizobium galegae bv. orientalis str. HAMBI 540] (length=778 residues).
MDQVNFRPRTIFPSETRDHDTFIDLDKLWAAAIRRSGVIVVCLIVTVALAGVYLVMAQPIYTALTQILIDDNLSRYADDQ
QDSQTAQQIDNRMSSAVEILKSKALAVRVVDKAKLDQNEAVVNPPQSPVDLVKGVVRSVVALLTPGSPPPSEENVRMGRR
EKAAAVLQQSLTVERVGRSSVIALSVRSPDPQLAAMITRTYAESYLTEQLNANFDATERASLWLQERLNDLNSRSQQASL
AVEQFKTQHGLVSPRGELLSTQQLSDLNSQLIVAQADAATASARYNQYQAIIDKGPDAAVQNAVISARDTDNTVIQDLRK
RYINISDREQSIIQQFGANHPQAVALKAEKSELAQQIYRELQQLTGSFRNVLEVASSREKSLRESIDRVAGRNSEANVSM
VQLRELEQKAAALKTLYESFLGRFEEATQRQSFPIAKARVISDAGLPTAPSSPRKTLTMALSVVLGLLIGGAAATLLEFR
ERFFRTGDDVQEKLGLRFLGYLPKVSGAFAEDAPPPPPTEAEAAGAPPGNPISFRRLMRVAVEAPRSQFAETLRNAKLAC
DIMLQERKCRVIGVVSCLPGEGKSMVAANFAGLIASTGVRTLVIDADLRNPGLSRMLASEPEVGLVEVVLQQTPWTNAAR
VDRRSRLTILPMTTRSKQLAHTSELLASSGMSHFLESIKDTFDVIVVDLAPLLPVIDAKAFEPYVDGFVFVTEWGVTPAK
AVQSVIRSEPQIASKTVGVILNKTEMSELHRYADPGAPERLHSSYVSYYKDGSASAPR
>gnl|bykdb|A0A068T4W5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141] (length=757 residues).
MDGLIAIVRRQWRVVGLCIAVFLALGIGHLLTAVPRYTARTSVLIDRGNRQVVEQLSTIGGVLDDEASVLSQVELLRSET
IGLSAVDKLKLADDPEFMTGRQNPLLAAVSDIRSMLDIRRWLRGGEVRPDQIEAQRRWALANLLGNMKVSRVGRSYVLEI
TFTATSPCLAAAVAGAIADAYLTDKLDAKYDATRRAGNWLQERIEELRRRSLESDLAVQRFRAENGLVTANDRLVSDQQL
TELNSALIVARADTARAQARSDRIEAIIARGQSEAIVTDALDSSVISSLREKYLESSKREAEISRRLGQGHAQATRLRQE
MAEYDRQMFDELRRIAGSYQSELEVAQSRERQITLGVSNATDISVTAGETQVQLRELERAAETYRNLYQTFLQRYQEAVQ
QQSFPVTEARIISRAVPPTTASEPRLSLVLALCLALGSGVGGVLGAFREFRDRFFRTGEQVRDILGLEYLGSVPLVQPQT
GLRPSIEPVKGEIYRKNELSGFATEHPSSAFAETLRSARIAADVHIDRPHKIIGIVSMLPGEGKSTIATNFAQALAGSAR
TLLIDADLRNPGATRALGSHAEEGLLEVLLEGHAPASAMLADPVTGLRFLPAVVRRRIPHSSELLASAAMTRLLAQVAGE
FDYIVLDLPPLGPVVDARAIAPRVDGLIMVVEWGETSRKAVKETLNAEPQIAGRCLGVILNKVDAARMKLYEGYGSSDYY
ASRYTQYYHETHPDPTPVSIGTPTRIKTTREKPDDSR
>gnl|bykdb|A0A068TE70 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141] (length=778 residues).
MDQVNFRPRTIFPSETRDHDTFIDLDKLWAAAIRRSGVIVVCLVVTVVLAGVYLVMAQPIYTALTQILIDDNLSRYADDP
QDSQTAQQIDNRMSSAVEILKSKALAVRVVDKAKLDQNEAVVNPPQSPVDLAKGAIRSVVALLTPGSPPPSEENVRMGRV
EKAAAVLQQSLTVERVGRSSVIALSIRSPDPQLAALITRTYAESYLTEQLNANFDATERASLWLQERLNDLNTRSQQASL
AVEQFKTQHGLVSPRGELLSTQQLSDLNSQLIVAQADAATASARYNQYQAIIDKGPDAAVQNAVVSARDTDNTVIQDLRK
RYINISDREQGIIQQFGANHPQAVALKTEKSELAQQIYRELQQLTGSFRNVFEVASSREKSLRESIDRVAGRNSEANVSM
VQLRELEQKAAALKTLYESFLGRFEEATQRQSFPIAKARVISDAGLPTAPSSPRKTLTMALSVVLGLLIGGAAATLLEFR
ERFFRTGDDVQEKLGLRFLGYLPKVSGAFAEDAPPPPPTEAEAAGAPPGNPISFRRLMRVAVEAPRSQFAETLRNAKLAC
DIMLQERKCRVIGVVSCLPGEGKSMVAANFAGLIASTGVRTLVIDADLRNPGLSRMLASEPEVGLVEVVLQQTPWTNAAR
VDRRSRLTILPMTTRSKQLAHTSELLASSGMSHFLESIKDTFDVIVVDLAPLLPVIDAKAFEPYVDGFVFVTEWGVTPAK
AVQSVIRSEPQIASKTVGVILNKTEMSELHRYADPGAPERLHSSYVSYYKDGSASAPR
>gnl|bykdb|A0A069BAV0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia pseudomallei] (length=739 residues).
MVNTQAKHPYADLAVKTDEEDVVLGQMIQVILDDIWLLLGIALVVVALAGLYCYVAKPLYSADAQVRVEASDNTSQALTQ
TQTGAMINSGPPTPPTDAEIEIIKSRGVVAPVVEQFKLNASVTPNTLPILGAIAARLATPGHPGKPWLGLSSYAWGGEEA
SIDSIDVTPVLEGKQLTLTAGADGGYALADPDGAVLVRGKVGEREQGGGVTINVSKLVARPGTRFTVVRQNDLDAITAFQ
SAIQVAEQGKQTGVIQISLEGKDPEQTAQIANALAQSYLHQHVTSKQAEATKMLEFLKNEEPRLKSDLERAEAELTQYQR
TSGSINASDEAKVYLEGSVQYEQQVAAQRLQLAALAQRYTDEHPLVVAAKQQLGQLEAERAKYDGKFRGLPATEVKAVAL
QRNAKVAEDIYVLLLNRVQELSVQKAGTGGNIRLVDAALRPGVPVKPKKVLILSAATLLGLILGTSVVFLRRNLFHGIED
PDRVERAFNLPLYGLVPMSAEQARFDAADKGNRVRPILACARPKDLSVESLRSLRTAMQFALMDAKNRVIVLTGPTPGIG
KSFLAVNLAALVAHSGKRVLLIDADMRRGSLDRHFGTGGRRGLSELLSDQVALEEAIRETSVPGLSFIPSGARPPNPSEL
LMSPRLSQYLDGLAKRYDMVIVDSPPILAVTDATIFGELAGSTFLVLRSGMHTEGEIGDAIKRLRTAGVQLQGGIFNGVP
ARTRGYGRGYAAVHEYLSA
>gnl|bykdb|A0A069E7P1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Hyphomonas adhaerens MHS-3] (length=785 residues).
MTGHDTPSGEETSFDLKSLIGMVYRRFWLIVTGFLVVFLAVAYITFTATPVYKASTTIQLGTNQENVIDLGSVLGGIVAN
TAAIDTEVMVISSKSLLTKVAERQKLIEDPEFNWTLVERKPGLIDGLVNPIKKSLGMRTERVDPYAGLSAEEREAAIMES
VVEALTNRVSVSRVGTTYLLTVTVMSTSPETSARLANAVADQYRVQQLDTKLDATRRATEWLGERVSGLRDEVAEKENRV
EVYRAQNGLDTAMGTTLAEQKIADLTKQKTQLDFDLSQARARYENMRRQIDSGTGIDGISEVLDSPLISRLKEQLSVLRG
RVAELETKLGPQHPELIGARNEVRDVERQMKAEVNRIADNLESEVKAKRDQVNAIQARINQANGQLRDNSIASVRLRELE
RDAETSRVLYEEFIARSKETSVQDDLVQADAVILSAASVPNRPAAPKKKLNLLIGAVLGAAIGAAMAIIAEMFDAKISST
EDIERKLGVSSIGSVPLIRASSLFGLGQTNPADYLVENPLSAYAESVRYLRAAIAFSDLDSETKTVAITSSLPDEGKTSL
TLSLGRMSAMSGSRTIVIDGDFRRRQLTEAAGMSPEIGFIEHLFGAGQLSDAIQKDSKTMLDILPLSQSGHTPHDVFGTR
AFDDLLSRLRSMYDLILIDTGPLLLMAEARVVAGKVDKTILMVRWRHSTRAAVKQSLNLLRSFNADVLGATLNMVDLNRR
RHHRDPGASYKAYRKYYQMESKKSVFGFDLNGGKRKKGGKGPVAMQTPPEHAKSTVEEEVPVGFE
>gnl|bykdb|A0A069I4P1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Cupriavidus sp. SK-3] (length=747 residues).
MNQNPPPVAVAGSQDDEFDLIRYLDVLIANRWLIATIAAVALALGVAYAFLARPVYQADILVQVEDSPNSAKSLLGDVSS
LFEVKAEATAEIEILRSRMVVGKAVDNLQLYIYAKPKYVPFVGAWIASRAKGLSDPGLLGIGGYAWAKESIKVDQFDVPE
SLEGEKFSLKALGDGRYRLEQDSLDRPLEGRVGELLQVNQNAGSFSLLVTDLKAKPGIVFNLVRASRLRTLERLQSQLKI
AEKGKQSGIIGASLEGTDPKLTARILNDIGEEYVAQNIKRKAAEAEKSLVFLGDLLPQLKAELERAEVKYNEMRNKRNTF
NLSEEGKAFLQESVTAETSLLELKQKRTELLTRFTVTHPGVQALDQQIATLNAKVGSMAARMKTFPNVEQDTLRLMRDVQ
VNNDLYVGLLNNMQQLKLVKAGKVGTVRLLDNAPVPEEPIKPKKGIAIILAVVFGLFVGVVAAFVRASLYGGITDSQDIE
QHTGLNVYATVPLSAEQAALTETMRQRKRGNFVLADLFPNEPSIESLRSLRTALQFAMLDADNNRVLLTGPTPGVGKSFI
SANLSVVMASGGKRVLLLDADMRKGHLNQYFGKDRAHGLSDVLVGKTTFDQAVHRNVVENLDFLSTGGLPPNPAELLLNE
RMVKLLQDVGEQYDLVLIDTPPVLAVSDTAILAARCGTVFLVTRFEKTTIGEVEESAKQLRQANADVNGVVFNGLDPNAY
RYGYGSKYGRYRYAYYGYSNESSQVQG
>gnl|bykdb|A0A069IAE9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Cupriavidus sp. SK-3] (length=753 residues).
MNIVNSRNQAPETWDDGGKPIDFTSYVDVLVRYRRTFLVVAGGVICAGLVYAMLAKPVYRADIVVQVEDSNAGAGAAGKQ
TANVTPVFDVKPAASAEIELLRSRMVVGKAIDSLRLDIKASPRYFPVVGQAIASYNKELSAPGLFGWGGFAWGQESISVP
SLEVPPKLADRTIQLTALGGKQYRVSFASNDVKSTGTVGQPLTIDTPQGKVSMLVSELDGRPGSVFYVQQIPRAAAIEEL
QESLMILERGKQSGVIGMTLEGNSAEKTAAILNEIGAEYVEQNVRRKAAEAEKSLAFLDRQLPQLKQQVEAAESRYNAMR
NQRGTIDLSEESKLILGQSVQIQTRLQDLKQKRQELIARFTSNHPTIEIMDSQIASLNAQLNGVTGKIQKLPDVEQNVLR
LMRDVKVSTELYQSLLNDTQQLRLVKASKVGTARLVDAAEVPLKPVRPNRSMIAGVALVLGLLLGLLAVVVRRLLDGGVS
DADEVEKATGLTVYSTIPFSAQQARPEAARKASGKDGGRCDVLAHLEPGDPAIESLRSLRTALQFALAGSRSRVVVVTGP
APGVGKSFVCANFAAVLASGGKRVVLVDADLRRGSLNHRFGVARSPGLSEVLTGMPLNQAIRRQVMPGLDVIPTGTEPPH
PADLLLGEELDTLLDTLKAQYDVVLIDTPPVLAASDAGILAAKAGAVFMVTRADQTTVGEITAADRAIQQAGGEIKGVLF
NGLRIDGRWYRAHYHFGKYRYLNQYGTSRIKRA
>gnl|bykdb|A0A069P9T9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Caballeronia grimmiae] (length=742 residues).
MAINFDARYSDVSTGDELRLSDYLAAVFGNWKLVTVVMLAVVALGAAYAFVAPPTYKADALIQTEETNANNNANANVNAV
QAVSQMFDAKSTTAAQIELLRSRLVVDDTVRRLHLDISAAPHTVPVLGGVIGSALSTFDVKVPEGYLSRFAWGNEQIDVP
LFDTPKELYEQKFTIVAGENGAYVLNDPNGVAVLSGKVGQEASGMTPQGPIRLKVEKLVGAPGVHFDVQRFSTLTTIDNL
QQRLSVAETALQSGIISVSLEGRNPKEISQIVNNIANRFVQQDSDKRSAEAEHTLAFLDQQLPVLKKQLDEAEQRYNTFR
NRQGTVDLSEESRLLLQQIVDNKTKLTDLQQQRAELSQRFTPHHPSVQALDAQIASLSGAQTRLGKNVSTLPDTEQTALR
YLRDVRVNTELYTNLLNSAQQLRIAKAGQIGNVRVVDYAQPADDPVRPKRLIVILISAGVGLALGILFAFVRKSLYGGVE
RPEEIEKQLGVRVFAIVPRSDTQLRLQRKVGMRSEGMHVLAAQAPEDAAVEGIRSLRTSLQLQLADARNNVVMMTGSRPE
AGKSFLSANLATLVASTRKRVLLIDGDMRRGDIHSHFGVRHSPGLSDVLMGADVDSAILHDVLPGVDLITKGTLPSHPSE
LLASERLGEMLDQLKQMYDLVIVDTPPVLAVTDATVIGKHAGTSLLVVRHGKNQVQEIGETMKRLQHGGVNMKGVLLTDV
PQSKMLMGSTYAGYYGYESIAE
>gnl|bykdb|A0A069PEZ2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Caballeronia grimmiae] (length=733 residues).
MKDMQQPPNQSRSTPDNDEISLSEVLTVLRENRKLIAIATACALSIGSLYAFLWAPTYRADVLIQVDDDSGAGSLNDKLG
DLAALFQNKASADAEIELMRSRNVVGDAVNRLHLDIDARPHYVPIVGAPYVRYTAGSGLASAAFGLGSFAWGGERIGVSE
FTVPSTQYEKTFTLIARDGERYELVSPDGDTILRGRVGETASAGGVTLTVRSLLARSGTRFDLKRFSTQQTIADLQDALK
IAEKTKQSGIVGMSLDGKDAELTATTVNAIAALYVQRNVDRKSAQAQQMLAFLADQLPQLRADLDRAEARYNAFRAKNGA
VDLEEQSKLLLQSAVENRSKIVELEQKRAELVQRYTAHHPEVVAIDASIGELKRQSGDFDHRISALPSVQQDAVRLLRDV
KVSNDLYTSLLNSTQQLSVLKAGQLGNVRTVDYAVTPEKPVAPKKALALVLSVLLGLVAGCSLALGRRMFNRGLETPAEI
ESAIDLPVLAIISHSPREAALAASRRRGSSKHRVLAALAPNDVAVEGLRSLRTALQFGVLKQRNMIVMVTGARPGIGKSF
ISVNLAAVIAAGGARVLLIDGDMRRGNLSGVLGLKREPGFSNLLRDAEPDAVINRNVLPGLDVITGGGMPDRPSELLMNE
RLASVLKRLRERYDYVIIDSPPVLAVTDAGLIGRHVDASLLVVRHGRHTAAELRETTRQLANAGVPLHGALLTDTPASGT
AYGAYSQYAATGS
>gnl|bykdb|A0A069PLR4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Caballeronia glathei] (length=742 residues).
MLSTPAHSYLPKSEEEDVVLGHLIQVILDDIWWLIGIALMVILAASAYCYLAKPIYSADAHVRVEPSDNTSQALTQTQTG
ATIGSGSSTLPTDAEIEIIKSRGVVAPVVAQCKLNFSVAPVTLPVIGSLAARLATPGTPSRPWLGLSSYAWGGETIDVDS
VDVPQPLEGKDMTLKALGDGRYLLSGPDGRALLEGRAGETAKGNGVTITVNKLVARPGTRFTVMRANDLDAISAFQAGIT
VQEQGKQTGVIQISLENQNPERAAEIANALAQSYLRQHIENKQEEASKMLAFLKSEEPRLKNDLTRAEAALTEYQHQAGV
INASDEAKVYLEGSINYEQQISTLRLQIAQLQQRFEVNHPALITAQQQLAQLEGERQRYSARFRDLPASEVKAVALQRDA
KVAEDIYVLLLNRVQELSVQRAGTGGNVHIVDAALRAGEPVKPKKILIMSAAVILGVIVGAGFVFVRRAIFKGIDDPERV
ERIAGLPLYGLVPMSVEQVKFDVETKRTHERDRERQVPILATLRPNDVCVEIMRSLRTSMQFTLMEARNRVVMLTGPASG
VGKSFLAMNLCVLLAASGKKVLLIDGDMRRGKLERSFGIDRANGIAELLAGTIGLEQAIRTTRVPGLSFMPAGKRPENPS
ELLMSPRLQQYLEGLGRVYDVVFVDTPPVLAVTDASIIGKLSGTNFLVLRSGAHNETEIADSVRTLRTAGITVQGAIMNG
MPQRARGYSRVNYAAVEEYLNA
>gnl|bykdb|A0A069PLW1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Caballeronia glathei] (length=741 residues).
MAMNFDTRYSDVSTGDELRLSDYLAAVLGNWKLVTLVMLVAVALGTAYAFIAPPTYKADALIQVEESNNNNNNANANAVQ
TVSQMFDAKSTTAAQIELLRSRLVVDDTVRRLHLDIAAGPRYFPFVGGMVTSVLSTFSLPMPAGYMSRFAWGNEAIDVPL
FDTPKEQYGKTFTLVAGEHGTYVLNDPDGIAILNGKVGAEVTGASSLGPVRLKVDKLVGAPGAQFELQRASTLGTIDALQ
KRLTVAETALQSGIISVSLEGGDSRQTAAIVNNIARRFVQQDVDKRSAEAEHTLAFLDQQLPELRKQLDESEQRYNTFRN
RQGTVDLSEESRLLLQQIVDNKTKLSDLQQQRAELSQRFTANHPSVAALDAQIGALAGAQTRLGRSVSVLPDTEQTALRL
LRDVRVNTELYTNLLNSAQQLRIAKAGQIGNVRVVDFAQAADDPVRPKRLIVILISAGVGLVLGILVAFIRKALYGGVER
PEEIEKQLGVRVFAIVPRSTHQLRLQRKVGMRREGLHVLAAQAPEDAAVEGIRGLRTSLQLQLADARNNVVMLTGSRPEA
GKSFLSVNLATLVASTRKRVLLIDGDMRRGDIHSHFGVRHQPGLSDVLMGADVSAAILHDVLPGVDLITKGSLPSHPSEL
LMSDRLGEILDDLKLRYDLVIVDTPPVLAVTDATVIGKHAGTSLLVVRHGKNQVQEIGETMKRLHHGGVNMKGVLLTDVP
QSKMLMGSTYAGYYGYESISE
>gnl|bykdb|A0A069PPH8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Caballeronia glathei] (length=746 residues).
MKNDSLQALMPPNTDQDEGHFHLGYLLDTLRDNLKLITMMTVITMLIGIGYVLVARPVYQSDIMIQVEDNPNSPNNLLAS
VSSMFDVKSAAADEAEIVSSRLVVSRAVETMKLYIQVTPKYFPVVGRSIASHRVGLSVPGLFGLGGYVWGSERVDIADFD
VPSALYGESFELTALPHGAFRLRLATAGIDAIGRTGVPMHLSTSAGPMYLMVRSIDANPGATFVLARLSSIAATESLQRD
LRISQTSKDSGIIHVGLDGYDPDQTRRTLTEIGRQYVKQNIDRKSEEARKSIQFLDEQLPVLKRQLEQAEGAFNAFRMSN
STVNLSEESSAVLQQTVEAENRLVELRQKYDDASARFTENHPAVISIANQIAPIRARLAELEASTKRMPQVEQDEVRLQR
DMEVSRDLYTNMLNTAQQLRLVQASKTGNAGLVDAAVTAELPVKPNRKLVVGLSGLLGLLLGGMTAAARKELFGRLVDPH
EIEQSIGLSVYAAVPHSKKQELLSQRIAAKEEGVFVLASVNADDPSVEALRSFRTALQFSLLEARSNIILIAGCTANVGK
SFVSANFATVVAMSKQRVLLVDGDLRKGHLHRYFGQDQSPGLSDTIANNVSVDAAVRRNVLPNLDFLPCGALPPNPSELL
AHANLRRVIESLNDRYDLVIVDSPPILAVSDAIELARMAACAFLVVRQDVSFLAEVKESIKRLEQVGIAPRGVVFNAMRY
RPGTYGYGGGRYRYSKYAYGSYVDSQ
>gnl|bykdb|A0A069PT40 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Caballeronia glathei] (length=772 residues).
MNMFRFSNGPSGTPTGDGQLSARDLMNLMRDHVWEIAGITAIGIALAVAYVFIATPIYSADVLVRVDAPEPNALGIALQN
QGDGPSMAPSATAEMQVMQSRSVIQPIVERYRFDISATPVTIPVLGDIAARFATPGELSQPWLGLGSFAWGGEQIQVGSL
EVPHALEGEPLRLIALGSGAYELQGPSGEHLLSGTVGKPASSYGVSMTMTQLVARPGTKFKVIRWNTLDAITQFLTTMRV
RARAQDTGIVTISYNNENPVMAAQIANAIAEQYIASAVAARQRDDTKTLAFINGEVPRLRAELKRSEEALNSFRTSSQSF
QPTAEAQAYLQGGIEFQRQIATLQLQRTQMLQRFQPDSQWVRNIDSQLSQLTSAKASFDARFGGMPTSERKNVELARDAR
VAEAIYLGMVNKAEQLSVRRASTTGGVNIVDNALRPHRPIKPNRLLVLSAGTGVGLLAGMFFVFIRRHVMTGVTDPLFVE
RTTSVPVFGEVLFSPQQAQLDQEIAAATRTPAVVRRAASPFAVSGPDPAQNTAGVPALAAGMTRVLAARFPQDVSVEALR
VVRTTLNRDLAHSPNNIVMFTGPTPSAGKSFVAANLAVLQAEIGSRVLLIDADMRRGRLAYFFGQFNRGGLSDILAGDTE
PAEVTRNVGVPGLSFISCGSYPDNPAELMMKRRFKATLQRLSAEYDLVIVDTPPFLAVTDAAIVAGEAGATVLVLRSGMQ
TEYEITETVKKLERAEARLFGAVFNAIPLRRSNRNYGYATGYKTLELIEDAS
>gnl|bykdb|A0A069XD70 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli 3-373-03_S4_C2] (length=721 residues).
MNTPPGSTQENEIDLLRLVGELWDHRKFIISVTALFTLIAVAYSLLSTPIYQADTLVQVEQKQGNAILSGLSDMIPNSSP
ESAPEIQLLQSRMILGKTIAELNLRDIVEQKYFPIVGRGWARLTKEKPGELAISWMHIPQLNGQDQQLTLTVGENGHYTL
EGEEFTVNGMVGQRLEKDGVALTIADIKAKPGTQFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDDPQLITRI
LNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDNQLNELTF
REAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISKSSAIG
NVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEHGISVYATIPMSEWLDKRTRLRKK
NLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSDQKVLF
IDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDHYDLVI
VDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGYSYSEK
E
>gnl|bykdb|A0A069XTK1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli 3-373-03_S4_C2] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITTVFALCAVVYTFFATPIYSADALVQIEQNSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDNK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHASPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A070A7D9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Komagataeibacter rhaeticus AF1] (length=736 residues).
MNYVSLQGRATSMSWTAQDVGLVIRQTVRAFLRHRLLFVLTVLGVLVAGGAVMMTLKPRYTATATVVVSGRAQQDPLAPN
GQQQNQAPPDDSLVQTEAAMIHSRDVAAAVLAQLPPPAAAPHVGLRDRLCHMGLGFLCHAAQPVDPAVQRARDEDAFLNN
LTITPEAHTQILDINVVDGDAARAAALADAVVTNYQRLALARQTADINRVAAWLDSRTAELRQRWMDAVEKANAFDTAHG
LTNTSEGSTSSPLIERQIADTAANLSQAQGRLAAAQARADALRDAASRGDARAAVALSQEPILVSTANALMQLQSTRQEE
AATYGPQHPRLRALDQQIAVTRASLAAETQAALNSIREDQISARAEVDRLNENLDLLRQKAGGQSAPQAEYRTLDQEAQS
ARTVYETFLEHAKEVVDRAALLQPPISLVSHASAPDVPSFPNRRKIGMGLVAVALAAGAGIVLLRDYFTAGFTEIERLRA
AVPLPLMAVIPKVRARTEQGVRRHVLDHPYSRATEAVRSLVMQLSMRVHDGGQPLCLAITSAGPEEGKSTLALWMATIAR
RGGQKVLVIDADHRRGMLDQYLTDVTTGRPSLGMSDLVTTGARVEEVIRTDPDTGFDYIPAGRTMEHAFSPVEIRRLRAM
LVELKRTYELIIIDCPPLLGLSDALVHANMADQVIFVCRWKSTAQRAVMACLERLEASGAPLAGVVATMVEDNAMDVMGY
SYGNRDIKILSRFDEK
>gnl|bykdb|A0A070F2S9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli O128:H2 str. 2011C-3317] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQNSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDDK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHARPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A070FGR0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli O128:H2 str. 2011C-3317] (length=726 residues).
MTTKNMNTPPGSTQENEIDLLRLVGELWDHRKFIISVTALFTLIAVAYSLLSTPIYQADTLVQVEQKQGNAILSGLSDMI
PNSSPESAPEIQLLQSRMILGKTIAELNLRDMVEQKYFPIVGRGWARLTKEKPGELAISWMHIPQLNGQDQQLTLTVGEN
GHYTLEGEEFTVNGMVGQRLEKDGVALTIADIKAKPGTQFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDDPQ
LITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDNQL
NELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISK
SSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEHGISVYATIPMSEWLDKRT
RLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSD
QKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDH
YDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGY
SYSEKE
>gnl|bykdb|A0A070SPU3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli 2-210-07_S3_C3] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQNSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDNK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHARPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A070SUN0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli 2-210-07_S3_C3] (length=724 residues).
MTTSSVTSRQSNAAVENDEIDLGRLLGYLIDGRWWIVSITAFFMVIGISYALLATPIYKANALLQVEKKTSGAALLGNMA
DMLGGEQPDAAAEIELLTSRMVLGRTVQELNLDTVVKPDFFPVIGRGLSRLLGNPYPKIAISRFAVTPDLIGTPLSLTVT
NNSHFILDVDGNEIEGQVGKLLDTKGVTLLINDVAADDGQQFTLVKKPTLDVIGDLQRQIQVSEKGKNTGIISLSLEGDD
KARIRAILDNISQNYLQQNVLRKTEEAQKSLDFLKTHLPQVKEELNRAEEQLNVYRQQNESVDLSLEAKAALDTMVGIEK
QLNELTFREAELQQLYTRQHPAYIALLEKRQTLLNTKNTINKSIKRLPKTQQEILRLTRDVQVGQEIFVQLLNKQQELNI
MKAGTIGNVRIIDEAAVETRAVKPKKPLIVVLATLLGGMLSVGLILIRAAFHRGIESPEQLEEMGLSVYATIPYSSEQAT
IEQKQKKHQKALPINEALLAARNPADLAMESLRSLRTSLHFAMIEAKNNIIMISGSGPGLGKTFVSTNFAATLALGGKKV
LVIDADLRKGYMQKVMGQNMGTGLSAYLSGQYDIAQTISKTAFDGLDFVSRGAVPPNPSELLMHPRFKALLDWASEHYDF
VLVDSPPILAVTDAAIIGQHAGTSLLVARFAKTAVKEVDVAVRRFEQNGIAIKGILLNAVEKKASSYYGNYGYYQYSYAD
KKKN
>gnl|bykdb|A0A070SV95 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli 2-210-07_S3_C3] (length=648 residues).
MIPNSSPESAPEIQLLQSRMILGKTIAELNLRDIVEQKYFPIVGRGWARLTKEKPGELAISWMHIPQLNGQDQQLTLTVG
ENGHYTLEGEEFTVNGMVGQRLEKDGVALTIADIKAKPGTQFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDD
PQLITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDN
QLNELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSI
SKSSAIGNVRIINPAVTQPQPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEHGISVYATIPMSEWLDK
RTRLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQ
SDQKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWAN
DHYDLVIVDTPPMLAVSDAAVVGRSVDTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYY
GYSYSEKE
>gnl|bykdb|A0A070V2W6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli 2-177-06_S3_C2] (length=721 residues).
MNTPPGSTQENEIDLLRLVGELWDHRKFIISVTALFTLIAVAYSLLSTPIYQADTLVQVEQKQGNAILSGLSDMIPNSSP
ESAPEIQLLQSRMILGKTIAELNLRDIVEQKYFPIVGRGWARLTKEKPGELAISWMHIPQLNGQDQQLTLTVGENGHYTL
EGEEFTVNGMVGQRLEKDGVALTIADIKAKPGTQFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDDPQLITRI
LNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDNQLNELTF
REAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISKSSAIG
NVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEHGISVYATIPMSEWLDKRTRLRKK
NLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSDQKVLF
IDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDHYDLVI
VDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGYSYSEK
E
>gnl|bykdb|A0A070V478 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli 2-177-06_S3_C2] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQNSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDNK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHARPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQSDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYKDYGYYEYEYKSDAK
>gnl|bykdb|A0A071IND6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Agrobacterium rhizogenes] (length=783 residues).
MHQKNFTFHSATPKAEEQDGFIDLDRLMAVVIRRIRTIMLGVAVFVGLAIAYLLFATPSYTSATQILLDETMTKYAEDQP
PPTSSQQADMDIASAVEILKSNEMALRVVDTAGLIDNDAFVNPPQSPVALIKSGVKLIASVFKPAKPPLTPAEAREAKRQ
LIAAMLQDALKVERVTRSSVVLVSFSSTDPLLAAKITSAYADSYLTDQLNANFDATERASVWLQERLNDLRQRAQMASLE
VEKYKAENGLTSTGGELMSEQQISDLNKQLIIAQADTASASARYNQYKSIIDQGPDNAVKNATISSSQSGNSVLQDLKTR
YLAVQKREQDVTQNFGADHPQAVALKAERQDITRQIYEELQQLTASYKNEFDVAQSRATSLRGSIEGMVGKNSEANKSLV
QLNELNQKATALKTLYESYLGRFEAAAQQRSFPIAKARVISAAGVPTAPSSPKKTLVMALSIILGLMAGGGFAAFQEFRD
RFFRVEADVRAALGLKFLGYLPLLGQQGFPKKKNKRKAGPVPAMATATADEGENGVAFERIMRVSVEAPRSMFAETLRNA
KLASDVMLQGRADRVIGVVSALPGEGKSTTAANFAALLASSGKRTLLIDADLRNPGLSRTLKTPPQVGLIEAALGEVPWA
SAVKVDPRTKLAILPVVIRDHLLHTSELLSSQGMMTLMENARKMFDYIVVDLAPLGPVIDAKAFAPQVDAFLLVAEWGAT
PTSLVRDLLEQEPQINSRVLGVILNKTDMSELARYSEFGATERYRQKYVSYYTEDHPKTQVEA
>gnl|bykdb|A0A071M1R0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mangrovibacter sp. MFB070] (length=730 residues).
MTERIKHASASSDGSDEIDIGRLIGTVIEARWWVLGITALFAMVAVTYVMFATPIYKADALVQIEQNGSSSLVQDINSAL
QNKAPQSDAEMQLITSRMVLGKTVDDLNLDIDVEKKTFPVFGAGWDRLMGRQNESVTVSTFNVPKAMHKDEFTLEVLSPT
RYRFTSNNGFSAEGRVGQPLTKNGLTLLVSGINAHEGSEFTVTKYSTLGMINQLTNSLTVAENGKDTGVLSLTYTGADRD
QIREILNSITRNYLEQNVERKSEEAAKSLDFLAKQLPVVRHNLDAAESKLNTYRQQKDSVDLSLEAKSVLDSMVNIDSQL
NELTFKEAEISKLYTKAHPSYRTLLEQRQVLENEKAQLGKRIAAMPKTQQEVVQLTRDVESGQQVYMQLLNRQQELKIQK
ASTVGDVRIVDPAVTEPGIVKPRGALVILGSIILGLMLSIVGVLLRSLLNRGIESPQVLEEAGISVYASIPLSEWQKARD
NAGKSGSKVKHLKGSATNRRYKQSELLAVGNPTDLAIEAVRSLRTSLHFAMMQASNNVLMMTGVSPSIGKTFVCANLAAV
ISQTNKKVLLIDCDMRKGYTHELLGCSNQHGLSDVLADNSPLEKAARPTTIANFDLIPRGQIPPNPSELLMSERFEALIN
WASKNYELVLIDTPPILAVTDAAVVGRHAGTTLMVARYAVNTLKEVETSLGRFEQNGVQVKGVILNSIFRRASGYQDYGY
YEYEYKSDAK
>gnl|bykdb|A0A071M4T1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia cenocepacia] (length=755 residues).
MNAQTLPDPHDGPTLRPSYPYRRYWAMLHGGRRLILCTALAGALAGTLYALCARPVYRTDILFQVEQSPTESKTNSPPGD
PSSVFDLKTDASTEIEVLKSRAVMARAVDDTNLAIDARPHYLPVIGWRLVNAADGLSSPLPGGYVYGTERIDVPTFDVPK
RFVGKRFALVVGNGGTYTLQRTGWLGRSGPVWQGRIGQPLHVETPQGPLDVFVREVAGEPGARFDLTRYGDEEATAWLQK
NALISERGKQSNMIGVTLDGPDPVHDSRVLNAVGDAYLAQNTQRKSEAADKLIRFMDAQLPQLKAQLEKAESRFNAFRAS
HGTVNTSDEGLALRQQSVDIETRVQTLQQRREELLTRFMPKHPAVVAVDAQLADAQHSLDTVRKQIQQLPTVEQGVLQLQ
RDVAVDTALYTNLLNTRQQMILARASKTGTVRIVDAARIAETPTGPHRGMAVIASLLLGLLAGAAIVIVRQRVAGTIGDA
EEIEWSTGLTVFAAVPHSPPSGQNPPPSKAARRRNGRQPSLPTAPEGAALESLRNFRTALQLAMPDAPNRIVLISGPTTG
VGKSFVAANLASLAGAAKRRVLLIDADLRKGSLHEQFRFSRAPGLSDVVGGTHGFDQALKRDAMPGLDFMPMGNVVPDPG
ELLLQPAFTELIERAASHYDMVVIDGPPLLPVADALVLGRLAGTVFLVARSGVTTLTELDESARRLEHAQIAVRGVILND
FKGSPGRYDYGYTHENTHQAASGYAGVMGARGPAR
>gnl|bykdb|A0A071M5D0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia cenocepacia] (length=745 residues).
MTQPSAPPQPTAEDGSETDFVAVLDILLESRWLIAIITCVLLAAGLAYAMLGKPVFEANIMVQVEDSPDTSAAKSLLGDV
SALFDVKSSAAAEQQILASRLVVERAVDKLNLFIDAEPKRFPLIGDWIARHADGLSDPGLAGFGGYAWGREHIDVPRFDV
PRKNEGDAFSLTNLGGKRYRLEGGDFDAPVEGTVGTLEHFSSPRGPVTLLVASIAAKPGAAFVLVRNSRLKTIEDIRDRL
NVQERVKQSDVVVASLQDTDPKWVSDTMNEIGRQYVRQNIERKSAEAAQSLEFLSGQLPQLKQQLTDSEARLTKLRNEHG
TVDLTEEAKLALAQTADAKTRLLELQQKRQELMSRFTERHPSVAVIDEQIAALNGYRNTAEQQIRRLPDLQQDTVRLMLD
VRVNTDLYTALLNNMQQLQLVQAGKTGNVRLVDTAAVPEVAVRPKKALVALASLLLGLLAGCGTAITRSMLFHGISDHNE
IERRLGLAVYATVPISDHQRDLAEEAARKRGHKSILSIDFPNEPAVECLRSLRTALQFAMLEAKNNIVLIAGPTPGVGKT
FLSANLAVVMASAGKRVLLIDGDIRKGRLHDYLGFPRGRGFTELIAGSARVEDVIHREVVDGLDFISTGTMPKNPAELLL
NRNLAALMDDLSSRYDIVVIDSAPVLAVPDTGILGAVAGTALLVTMAGKTKLGEIGESVKRFAQNGVRLSGVIFNGVNPR
LGQYGYGSKYGGYRYVAYEYGAQDA
>gnl|bykdb|A0A071M5E6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia cenocepacia] (length=743 residues).
MTDLSEARLYDAALYDEAPLSSYVDIVLARWRLVLGIAAGVFLLGLLYVVFATPIYRVDATIQVNESTTAGNSPLHDIAA
LLDNGSTTAAELELVRARMVIDQVVSKQHLNIIAEPRYFPLIGRWVARRYRDDGVAPPLWGLSRFAWGGERFNVAAFGTV
GKKSHDGIDVLDGIGFTVTAEGGGRYVLRDEDDDVVLKGAVGVPAHGAFKGQPLTLLVADLDARPGTVLRLKRIPQLEAV
SQLQDDLTVEEKAKQSGILSVTLEGDDKARIREILKAVVDGYVAQNRDYRSEEAAATLKSLEASMPTVEKTLKDAEERYA
AFRSRTRTVDLDEQGKLLLGQEVDIETRTLELKQKRVDLIARFADGHPAVQALDANLAELAGKAQELKALEARLPGTERE
GLAVLRDVRVNTELYTNLLNTAQQLKIARQSEIGNVRAVDEPVLPVKPVKPKRLLLVALSLCVGLALGVAAPFAQRAVWG
RVEHSEHLEQALGVPVYAVVPHSREQRRLVRSQQRAAQGAHVLASEIPEDVTVDAIRSLRTTLQFTLSESGHHVIMVTSP
QPNAGKSFLCANLASLFASGGKRVLLIDADIRRGQAHRHFGLQPAPGLPDAIASGTLERGVQRSAIAGVDVLARGAVART
SELFTDGRFKGLLDTASRLYDIVIVDTAPILALHDAASIGRHGATTLLCVRHGRSSMPEIREAERRLRNAGIAISGVVLN
DVPRRQAVYGAYGEGNYAYETEH
>gnl|bykdb|A0A071ML30 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia cenocepacia] (length=756 residues).
MNTPSSSEREIDLVRVLDVLRHARWTVASIVAACVAAGALYAFVAPPTYQADLMIQADDASDAASKNLLGDAASFFNVGS
PASAEAQILSSRLVVTRAVEDLRAYIVAKPSRVPVIGAFVARFNDGAVSPGLLGFGGYAWGQERLDVARFDVPTRAEGDT
FHVVRLDATRYRLTGADLTADAVGRVGRAETFATRYGPLQIEITGFDALPGTRFRLVRHSRAETIDTLRTALDVQEKVKQ
SGVLVASLRGDDPADLSATLNAVANRYVEQNIARRSAEAAQSLTFLNGQLPIVKQQLERAETHYASLRSRTGSVDLAEEG
KLALQQGADLQTRALELRQKRDELSRRFLPTHPDMAALDAQLATLRRQQGALDSRIAHLPAQQAEEVRAQLDVKVNTDLY
TALLNNIQQLELVQAGRTASVRVVDAAVAPADPVRPNRPVVIAAAALAGLALGMLAAFAREFLYGGLTAVDEIERHTSLP
VRAVLPAAARQRRLIRAVERRDAGFHVLAYDDPDEPAIEGLRSLQTALHFSLADVPHPLVLVTGPAPGTGKSFVSVNLAA
VHAANGQRVLLIDGDLRKGYLHQYFGLERGAGFAELLDGRARADDVVRRGVAPNLDFLPTGELPAAPIALLQHAGTGARL
ASLRERYDLVIVDAAPLLAVADATWLDTHADATLLVARAGSTRAGELVESARRLPQRPAGSLGVVLNGLDPRSGASAFGS
KYGSYRYEAYRYTCETRCTYPARLRAALQRLLRRSA
>gnl|bykdb|A0A071ML36 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia cenocepacia] (length=741 residues).
MVNTQAKHSYADLSVKTEEEDVVLGQLLQVIMDDIWLLLGIAVTVVALAGLYCYVAKPVYQADVHVRVESNDNTSQALTQ
TQTGATINTGPQQAQTDAEIEIIKSRGVVAPVVDQFKLNFSIAPKTLPVIGSLAARLATAGVPSRPWLGLKSYAWGGEVA
DVDSISVVPALEGKKLTLTAGPDGTYSLVDPNGTRLLSGHVGEAAQGGGVTLLVQKLVARPGTQFTVVRYNDLDAISGFQ
AGIQVTEQGKQTGVVQISLEGKDPDQTAAIANALAQSYLNQHVVAKQAEATKMLDFLKGEEPRLKADLERAEAALTQYQR
TSGSINASDEAKVYLEGSVQYEQQIAAQRLQLASLAQRFTDSHPMVIAAKQQLAELQGEKDKFSNRFRSLPATEVKAVQL
QRDAKVAEDIYVLLLNRVQELSVQKAGTGGNIHLVDSALRPGDPVKPKKVLILSAAVFLGLILGTGVVFLRRNLFQGIED
PDRIERTFNLPLYGLVPQSAEQVKLDAAAEKGGGRARPILASLRPKDLSVESLRSLRTAMQFAMMDAKNRVIVLTGPTPG
IGKSFLTVNLAVLLAHSGKRVLLIDADMRRGLLDRYFGLTAQPGLSELLSDQAPLEDAVRETPVQGLSFIAAGTRPPNPS
ELLMSSRLPQYLEGLGKRYDVVLIDSPPVLAVTDATIIGRMAGSTFLVLRSGMHTEGEIADAIKRLRTAGVDLEGGIFNG
VPPKARGYGRGYAAVHEYLSA
>gnl|bykdb|A0A072BTY8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhizobium leguminosarum bv. phaseoli CCGM1] (length=752 residues).
MTISTVPPDRNLPISPMRYDPRAQIETKADNLDLASAFRMLRRRRFMIIAITVLLMAPAAVTISGLKPTYQAWARLIVHQ
PLATSLGAEDTGRGDLLDVKSETERLLSRSIAERVVREMRLDARQEFNPALRKVSFFESMRASLRGLFETKKPTSPERDG
IEATIREFYQALGVWHEDKSEVIQISFTANDAELAAAVPNRVVSIYLDERKSSVRARLDAAEAWIRQRIAEQKARAVIAR
DAARNYQESMDIVSKEDAQDERIKTLLDLTGREGKIEESRVEIKATISALEAADNPSVAVQNIVVPDSIATKQRDLRAQQ
DDLARLLELYDGKAEAVVDLRRKIEQSRLDLDLATKQYLQSMRAKLAALDHEANAVQSILAVAEQKRTRDALAQAELTRL
QHIAEKEQAALDKLEDQRRDLAAKAMLPGAELEVFSPASVPLVSQGRGRLFYLVGTLLAAISAAVTAAFALEMWDQSVRS
FDQIAGMARTIPAGLIPRLARKENPKTVFRLAPVPMFDEAIRTVILTLKQSNGGKLPNSIVVTSAHSGEGKSLVARSLAI
ELAAAAIPVLLVDGDLRRGELDSFFRSGLQQGLNEYLNGHADIRDIVYHHPGGIDFIPSGKFSLQRRARSNGLAEIIEMA
GAAGRVVIFDSAPVLASTDTVLLTALAEKTLAVVRWGKTSRRAVEFSLQQMKSQRNSEIIVAINNVNPEKHALYNFSDSE
LFSKSLMKYYQLHTADSSSSTIKNMFSLKSQR
>gnl|bykdb|A0A072C253 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhizobium leguminosarum bv. phaseoli CCGM1] (length=757 residues).
MLSPDKLTPRIDPSRDTGNEADFIDFDKLIAIARRQWRIVAACAFAFAILGIVYVLTAVPVYTSDTSVLIDRSDNQVINQ
LAAFGQLDDDEGTVLSQVELLKSDTIAYAVVDKLKLVDNPVFNAPKNSLFSVATLKSLVNFRSWFADDAAVAPDPQAQRR
AAAETVAGNIDVERVGKSYVLDVSYTSQSPDLARDIAAAIADVYMVDKLNSKYEATRRAGEWLQERIEELRQQALDTDLA
VQKFRSEHGLVESGSGTLLSEQQLSELNSQLITAQAATAQAEAKYARIKSIIQAKQTDAIVTDVLDSSISNDLRKKYLEA
SKLEAEIEARLGPDHVQAVRLRAEMAEYERLMFDELNRIAESYQSELQVAQSREKSLRDSVDQATGVAATAGETQVQLRE
LERTRDTYKNLYQNFLTRYQEAIQQQSFPITAARIITIAETPTKPSAPKRSLVVAFAMFLGCAFGSGIGAFREFRDRFFR
TGDDVKDMLDVESLGVMPLIENNVEDPTLVDPGNPRSIARGGKTTTYVEEHPLSAFAETLRSAKIAIDISAADQRCKVIG
VVSSLPGEGKSTTAINFAKLLAMQGARCLLIDGDMRNPGATRAIGRHAEAGLLEAIVDNRPLKDLILLDPKTKLAFLPTV
ARYRVPHSSELLASRGMDQLLEMARQSFDYIIVDLPPLAPVVDARAINPKLDAVVFVIEWGKTSRKVVQSTLLSEPDLYT
KCVGAILTKVDPSQMKLYRTFGSSEYYYKRYSRYYTE
>gnl|bykdb|A0A072CVQ0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter sp. ETR1] (length=731 residues).
MNQNSKTNDDTIDLKELFFSLIAQWKVIVLCVILTLICALLYLRVTSPVYSTDALVQVEDGKSAASAALMGELKDISSGL
GQKSPADAEIEILNSRLVLGKVIQNLNLNIQIQDNADTFLHKLVSKEKTQLSYTAKAVVFQKKQSSFSILKLDTPEYYYD
KKLTLHFIDKNQFSLSYQDQVVFKGTLNQLNQAQDNKGLWSVQVNSITPFQQDFTITKLSLPSAVKLMQENYSVVEKGKM
TGVIGLSYSGNNQQHITQVLNNILSVYHQQNIERKTLESKQTLSFLDQQLPELKQQLEESEIKFNKFREQYNTVDVTQES
ELMLKQNIELEKMRIELKQKQAEYSAKYTPDHPLMTEINAQLAAIDKKSTELNQAIKRLPETQRLYLQLYRDVEVNTQLY
TSLLNSYQQLKIVKAGEIGNVRIIDTAVEPVKPIKPRKLIVLFLSIFVGGFIGVLIALLRNMLSSGIKDSSRIENELDLP
VYATVPRSPIQESRVQLLKKKKSIPILAAKNSEDIAIESLRSIRTTIHFALNKAKNNIIAVSGPAPEIGKSFISTNLAAI
FAQANKKVLLIDADIRRGYLHKYFSHDTFPGLTEYLAGQSTLEQCIVHSDTVNHLDFLPRGKNHNHASEMLNSDRFSELL
EQLSEQYDHIIIDTPPILAVTDGIIISQFAGVNLVVARYAKTQMKELELTINRFEQAGSKVNGIILNDVRATVAGNYGYN
YAYAYTASKDD
>gnl|bykdb|A0A072N1U6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Marinobacter nitratireducens] (length=735 residues).
MTDQTNTTQRSDDDEIDLLALFGTLWDHKWLIVAFTFCFAVVGAAYVLLATPVYKATSLVQVEDQEASMPGMEDISSLLG
STSTATTEIQLIKSRNVLGKVVDELNLDIVVEPNYFPLIGKAIARRFVGSEGELAEPLIGESFAWGGEELKIAHMTVPAI
EFGKALSLEATDNGWRLYNSEGELVLEGHVGETVTAGDYSLMVKVLNARPGTNFDVTKRRRFSAIADLQEEIGASEQGKD
SGIILMSYENEDYRLAEQVLNDVGDNYVRQNVERNSAEAAKSLDFLRQKLPEVKKELEAAEERLNQYQITAETIDITAEG
EAILDQVVELEKQISQLEIQRAEIEQRFQPTHPRYKAWTSQMEELRQRRRELDSRIGGLPETQQELVRLRRDVEVGNEIY
LQMLSNIQQLDIVRAGTVGNVRVVDEAAVDVEDPVKPKKALIVAIAVLLGGFIGVAIVLIRSAFNRGVENADDIENIGLP
VYAGIPLSESQEALGRKASKRSPRRTQQGSKLLAVQNPADLAIEALRSLRTSLHFAMMDAKNNILMISGPSPGVGKTFVS
TNLAAVMGQADQKILLIDADMRKGFSHEILNVSNARGLSDLLSGQTTLEEVVHSTECENLEFIPRGTVPPNPSELLMSKR
FEDHIVQLAQNYDLVIIDTPPILAVTDPAIVGKHAGTTMLVTRFGLNPIKEIELTQRRFEQNGIGVKGVIFNAVVKKASA
YGYGYYAYEYKTDRA
>gnl|bykdb|A0A073FV81 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli 2-427-07_S4_C3] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQNSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDNK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHARPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEEEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGVKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A073FY97 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli 2-427-07_S4_C3] (length=726 residues).
MTTKNMNTPPGSTQENEIDLLRLVGELWDHRKFIISVTALFTLIAVAYSLLSTPIYQADTLVQVEQKQGNAILSGLSDMI
PNSSPESAPEIQLLQSRMILGKTIAELNLRDIVEQKYFPIVGRGWARLTKEKPGELAISWMHIPQLNGQDQQLTLTVGEN
GHYTLEGEEFTVNGMVGQRLEKDGVALTIADIKAKPGTQFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDDPQ
LITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDNQL
NELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISK
SSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEHGISVYATIPMSEWLDKRT
RLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSD
QKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDH
YDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGY
SYSEKE
>gnl|bykdb|A0A073HPB0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli 5-366-08_S1_C3] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQNSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDDK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHASPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGVKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVSWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A073URA4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli 5-366-08_S1_C1] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQNSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDDK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHASPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGVKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVSWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A074HUS1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli 1-392-07_S4_C1] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQNSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDNK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHARPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEEEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGVKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A074I6K3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli 1-392-07_S4_C1] (length=726 residues).
MTTKNMNTPPGSTQENEIDLLRLVGELWDHRKFIISVTALFTLIAVAYSLLSTPIYQADTLVQVEQKQGNAILSGLSDMI
PNSSPESAPEIQLLQSRMILGKTIAELNLRDIVEQKYFPIVGRGWARLTKEKPGELAISWMHIPQLNGQDQQLTLTVGEN
GHYTLEGEEFTVNGMVGQRLEKDGVALTIADIKAKPGTQFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDDPQ
LITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDNQL
NELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISK
SSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEHGISVYATIPMSEWLDKRT
RLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSD
QKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDH
YDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGY
SYSEKE
>gnl|bykdb|A0A074M9Y7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Erythrobacter longus] (length=733 residues).
MNDRSLMQAPGQDPRQGWVDAYMPDGQVGHFEPPRPLLDLSTIRGMLYRQRWLLAGVVVASLIAGLIITLLSTPMYEARS
TVRVEPYGQFIVEGQDVEAGIASNQVFDFLQTQLAVIKSRNLATTVAQNLNLGERSALLGADFDESRPPNMTDEQWLQAK
NEAAAGQLQSQVAAAIPDDNWIITISYRSSDPVLAAELANAYADAFAESDTRSSIETNEYAQEYLLDQINLIRVRLQEAE
EATNNYARGAQIILQPGEGEDAAPTTLTSTNLSSANARFSAARADRIAAEQKWRAIQNAPADQLPAVQTNSVLQGLVSDK
ISKEGELIELRQRYNDEFPQIQNLLQQIAVLDRQIADRGNAIKASIRNDYIVARNQEQALQAELNSLTGETLSEQDDQVQ
LSVLEREAEALRGQLESLLTRYNQVTSAANVDAGAFNKLDSAVVPSTPYAPSLSVNLTMALVAGIALAGGLALLRETFDD
RIRSLEEVEDKLGLPLFGQTPYVDERDIEVFGNDFSTLMESYASIRSSIDFSLSRERNVLQFTSTEASEGKSTTAVILAE
LFARMGRKTLLIDADLRRPTIAKLLDIEKPKVGLVEVLLGHVKLEDAIIKGVHDNLDILAIAEIPASPTELLAESYVGEL
IAKHRNDYSLIIFDSSPVMGLADAPMLSRVVDGTIFVMEANRISFGKAKTAKRRLQASGAKMLGVILTKYRALEAGQDYS
YQYSYYQYGGTKE
>gnl|bykdb|A0A075K260 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Dyella japonica A8] (length=736 residues).
MTVQLATIQDPVSRDDEIDLREVIGKLHDHKWRIIFIVLAFIVLSIAYVLLATPIYQATSIVQVEQKVPSLPGLSALTQT
LGASDSESTTESALITSRMVVGAAVDKLNLKIEAEPKRFPILGSFFARHFASKNPGKLAAPAFGMSRYDWGGSKLEIFQL
DVPDSLLDKPLRMTAGEGGSYVLQDDDGNVLLIGKVGQFSQDHGVAAQVWTLVANPGTRFRVIRHRELTVINKLQKAINT
SELGKDSGIIQLTYNNTNAELAAEFLRQVGELYVRQDIDRNSAEAASSLKFVREQLPNVRRDLEKATAALNAFQNQAHSV
DVSMQTQSLLDQSVSIETNIEQLQLQQAQMQRQFTPQHPAYKSLMQQIGQLQGQKAAIDKKVNSLPDTQQELLKLNRDVQ
VTNDTYTGLLNQAQQLDIARAGTVGNVRIIDKAAVDVTDPIWPKKILVLLGGAMLGGLVALVYVFMREALNRGIEDPSVI
ERIGLPVYATIPVSVRERSLQARRARGDGRQHMLVVDAPKDLATEALRSLRTSLHFARLEAKNNVLMISGASPNAGKTFV
AANLAAVVTQSGQRVLLIDGDMRMGSLHRVLGGRADVGLSDVISGQAELSDAVRKVASLDNLHFLSRGKVPPNPSELLMN
ARFSELINHLKSRYDLVIIDTPPILVATDASVIGHHCGTGLLVVRFGLNQARELAVAKQRFEHDGVVIKGAIFNAVEKRS
SGYYSYAYYELDEAAS
>gnl|bykdb|A0A075P169 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Alteromonas australica] (length=737 residues).
MAVNNMDDAGQKTTDMDTIDVAHYFKIVKRHTLRIVFLAIAFTVLVALLVFRMTPIYSSSATILVDSENTNLVSIEEVYG
FDSNRKDYMQTQFEILRSRQIAERTVKKLNLHKNADFMPSEDDKPLMTSLKQTLAEVLPFMPQKIEVERTEEQQEAIDLR
IATSKLRRSVELSLVSKTQVMVVTVNSDKPKLAATIANALAEEYIDNYLLAKLEMTSKATSFLTDSLEGLKQKLVFSEKN
LAEFFEKNQVVNLDGVVGLAADELEGLGQQLLDAQNALKLNETIYRQTQTNNSIEGVASLPEVLNHPTIQNVRRDEAKAM
TRVSELSKVYGPKHPNMIAANAELSSIRETLALQTRDLVSSINKQYLLSKERVELLQAQVEEAKSNYRKLSTLENQRLAL
QREVDINQQLYDSFFTRLKETDELGGFETANARILDKAIAPSVPSKPNKKLLIAAAFVFSIGFGVFVAILMETLNSGITS
VEDVEKKLGQRMLGLIPWMPHKKKTDLPVRSYFDSSKHQFAEALRTLRTSLSLLNIDKEKQVVMVTSSVPKEGKTTVSIN
LAFAFGQLKKTILIDADLRRPSIGKQFGIPSYQPGVANLIMQTHSIDECLNHDDESGVDVITAGTVPSNPQELLASRGFT
ELVTKLKEKYDYVVIDTAPTQAVSDSMIVAERTDSIVYVVRADTTSDKLINNGLSRLIQVGHRVDGVVLNQVDLRKSDVS
YKYAGFYDQYGYTSENA
>gnl|bykdb|A0A075TAQ7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=721 residues).
MTIDTTNKKNVSESDEIELGRLIGELVDHRKLIIAITSVFTLIALLYAIFATPIYQANVLIQVEQKQGNAILSSLSQMLP
DSQPQSAPEIALLQSRMILGKTVDDLNLQIEVRPNDFPLIGSGLARIFQKSPGTLTVKKLDFINFKGSDYPDLVITVIDN
NTYKVEGDGIIAEGKVGEEVHTNGLSILVDSIDSKPGQQFKIKYYSKLEAINRLQNALKVTDQGKDTGMLSLILTGDNPD
LISKILDNISDNYLTQNVARQAAQDEKSLQFLSEQLPKVRRDLDAAEDKLNKYRKQKDSVDLTLEAKSVLDQIVNVDNQL
NTLTFREAEISQLYTKEHPTYKALMEKKQILQDERIRLNKKVNTMPSTQQEVLRLSRDVESGRAVYLQLLNRQQELNIAK
SSAIGNVRIIDNAVVEPQPVKPKKFLIIVVGFFLGVFISVLFVLLRVYLRRGIESPEQLEEYGINVYASIPVSDWLSKQL
SRKGKVKQNESDIILSIENPTDLAVEAIRGLRTSLHFAMMEAKNNILMITSASPNAGKTFVSANLAATIAQTGKKVLFID
ADLRRGYVHKMFGSEIKSGVSDILSGKESITNAIQKVKNADFDYVSRGQVPPNPTELLMHPRFNELLAWASNNYDLVIVD
TPPILAVTDAAIIGRYVGTTLLVARFEVNTPKEIDSSIKRFEQSGVPIKGCILNGIVKKASSYYSYGYHQYGYSYTDNKK
D
>gnl|bykdb|A0A076PQR1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Comamonas testosteroni TK102] (length=747 residues).
MNLPPYKNVTQLDQSSGSPVYDDEIHLIDLLDVVFDSRWLIAGITALALCIGFAYTLLSPPVYQTDILIQVEDTKVIGAN
GLLNDVSSMFDIKSPAVAEIEILRSRMVIGEAIANLHLDLEVTPKYIPLVGRWLARRATGLSEPGFLGMDGYVRGTEALQ
VANFTVPKSLEGKVHTVVLTEKGYQLVSPDGELLGQGTIGKSMHIQYPEGEGSLLVVGANGKAGAAFYVTRYSKADVIGQ
FQDKISIGEKGKQSGMIRSTLEGSDPLLISQTLNEIGRLYVSQNTQRKAAEAAKSLAFLETQLPQLRKELEESERKFNQY
RSKNNVFDLEGEAKVMLDHGAKLHISLVELQQKRKEIEARFTSAHPSLQIIDNQINSVNTELDKLNSRARTFPSVEQDLL
RLTRDVKVNNELYISLLNSVQQLRLVKEGRVGNVRLVDEAIVPELPVKPRSALIVVLSTVLGLIVGLGLSFARNNLRVGL
KDPSEIEQHSSLRVLATIPHSEVQAEHAKAIAGKLPGNHVLAIQAPDDPVVESMRSLRTALQFVMLDMPSSLVLFTGPTQ
GVGKSFTSVNFATIVAAASKRVLLIDADLRKGHLNSYFGQGRTGGLSEVVSGSMAFGDAVRREVVPNVDFLSTGILPPNP
AELLTNSATQALLKQVATQYDFVVLDAPPVLAASDAAILAPLVGAVFMLVRAEVTSLGELQEASKRLAQAGAEVRGVVFN
DLHMATRRYSYGLGYRHGKYRYVNYEY
>gnl|bykdb|A0A077LAH9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter guillouiae] (length=731 residues).
MNQNLKTNDDTIDLKELFFSLIAQWKVIVLCVILSLICALLYLRVTSPVYSTDALVQVEDGKSAASAALMGELKDVAGGI
GQKSPADAEIEILNSRLVLGKVINNLNLNIQIQDNADTFLHKLVSKDKAQLSYSAKAVDFQKNQSSFSILKLDTPEYYYD
KKLTLHFIDKNQFSLSYQDQVVFKGTLNQLNQAQDNKGLWSVQINSLNPFQQDFTLTKLALPSAVKLMQENYSVAEKGKM
TGVIGLSYIGNDQQHITQVLNSILRVYHEQNIERKTLESKQTLSFLDQQLPELKQQLEESEIKFNRFREQYNTVDVTQES
ELMLKQNIELEKIRIELKQKQAEYSAKYTPDHPLMTEINAQLAAIDKKSTELNQAIKRLPETQRLYLQLYRDVKVNTELY
TSLLNSYQQLKIVKAGEIGNVRIIDTAVETINPIKPRKVIVLLLSIFVGGFIGVVIALLRNMLSSGIKDSSRIENELDLP
VYATVPRSPIQESRVQLLKKKKSIPILAAKNSEDIAIESLRSIRTTIHFALNNAKNNIIAISGPAPEIGKSFISTNLAAI
FAQGNKKVLLIDADIRRGYLHKYFSHDTSPGLTEYLAGQSTLEQCIVHSNTVNNLDFLPRGKNHNHASEMLSSDRFSELL
EQLSLQYDHIIIDTPPILAVTDGIIISQFAGVNLVVARYAKTQMKELELTINRFEQAGTKVNGIILNDVRATVGGNYGYN
YAYAYTASKDD
>gnl|bykdb|A0A077LNW5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas sp. StFLB209] (length=738 residues).
MTVMNRSTLDHYQDTRIDLTTLLHLLLDHKRLIFWLTGMFLVLGVLYVVLATPVYQASAMIQIEPRKVGIEGVPEVSNKP
MSASQATTEIELIKSRALLVKVVDDLRLNIEATPDHVPVIGAWLARNFQPQYQGQLAEPLFGLDSYAWGGEKLDIFQLTV
PEALLGEALKLVAGKTGEYSLYDADGNLLLNGAVRRTSLGHGVIMQVAELNARPGTEFSVSRQRTLSSALLWQDRLKIIE
AGKDSGIIYLSLQDPDAEKANRILNEVSRLYVRQNVERSSAEAAQRLEFLRSQLPMVRKQLEEAETALQKFQTSARSVDL
SIETKGVLDQVVEMDNRLSELKLKRVELERLYTREHPTYRSLMSQIGQLEGQKQILLKKIDSLPQSQQELLRLTRDMQVI
SQTYTLMLNKSQEQDILRAGSIGNVRIIDNADTNIEKPVKPMKKLLVLVATLCGALLAVIIIFIRQAFYRGIENPDLIEN
LGMPVYASLPFSRQQERLDKTANAAGLPRESRLLSTRAPEELALESLRSLRTSLHFAMLEARNNVLMITSPLPGAGKSFV
SANLAVIIAQTGKRVLLIDADMRRGYLHKVLGLQPRHGLSDTLAARLKYTEVIHHTEVRHLDFISCGFAAPNPSELLMHD
NFNRMLGELSPQYDLIIIDTPPILAVTDGTLVGRQAGTCLLVARFGLTTTRELEACKRRLNQNGIVIKGAIFNAVVRKAS
TAEYDCTTYGYSYHPVQK
>gnl|bykdb|A0A078LBM4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Citrobacter koseri] (length=720 residues).
MTEKVKQLAAPVTGSDEIDIGRLVGTVIEARWWVLGITAVFALCAVIYTLFATPIYSADALVQIEQNTGNSLVQDIGSAL
ANKPPASEAEIQLIQSRLVLGKTVDDLDLDISVTKNTFPLFGAGWERLMGRQNETVKVTTFTRPKEMGEQVFTLNVLSDK
TYELTSDGGFSARGQAGQLLSKDGVTMMVSAIHARPDSEFTVTKFSTLGMINNLQNNLTVTENGKDTGVLSLAFTGEDKD
QIRDILNSITRNYLEQNVERKSAEAAKSLAFLAKQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLFTKAHPAYRTLLEKRKALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITE
ASTVGDVRIVDPAIAQPGVLKPKKALIILGSIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
NVKTIKGVKRYKQSQLLAVGNPTDLAIEAVRSLRTSLHFAMMQAQNNVLMLTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSDILVGKGDIASCAKPTSIPHFDLVPRGQVPPNPSELLMSERFGELIAWASAHYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRATGYQDYGYYEYEYKSDSK
>gnl|bykdb|A0A078LPQ7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas saudiphocaensis] (length=736 residues).
MTTMPRPIYETKEDKDIDLAHLFDTFLNNRGTIAVITGFFAALGIAYALLSTPVYLATAMIQIEAKSGLPSLTDVVGNTP
AVSPAQTEIALLKSRSVVGGAVEALNLDIIIEPRYFPLIGGFMARNFEPTEEGELAWYPAGFESYAWGGETLRITQLIVP
DKMHGEELTLEAAEGNGFILRDPDGEVVVQGLVGEPVETPDYGITVAELNARPGTTFNVTRNRTYATTEDYQKRLSAGER
GKQSGIVGVSLEDTDPEKAIKVLEEVAQRYVQQNIARNAAEATQSLEFLSEQIPEVRKNLDAAQTALNQYQTGNRSVDIT
AETQSVLDRIVDLEKQISEQNLKRTEMERRFTRQHPNFQALINQINQLQTQKSELEKQISTLPSTQQELLRLTRDVEVSS
ETYAMLLNKTQELDIIRAGTVGNVRIVDHAAADIDEPVKPNKPLVIIVATLLGGLLAVAFVYVREALKRGVENPEDIERS
GIPVYAAIPFSEKQGLLEKRLANFKRDKSNASYLLSINDPADLATEAMRSLRTSLHFAMIEAKNNILMITGPSPGVGKSF
VTSNLAAVIAQSGKKVLLVDADMRKGYLHKVMRCQGDKGLSDILSGRITLFDAIQKTQLANLHVIAHGQVPPNPSELLMH
ENFSRFVREISNMYDLVIFDTPPILAVTDAALVGSQAGTTLMVTRYGLNSIKEIEHAKRRLEQNGLLVKGVIFNAVLRKA
SNYSDYGYYQYEYKAK
>gnl|bykdb|A0A078LSR7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas saudiphocaensis] (length=730 residues).
MNSPVRPDRPWQRPANTADSDFIDLKKIWHAIWSRKWGIALLVAVVGLLTLVLVMRMTPIYKAVASVLIENKAAPVVSFQ
PMVESPELSEYLQTQLSLMQSRGVAERVVRDLNLTEHPEFDLRQQPGPLIDFSALIAKLTGEEVEPISEAQVMDYATQLF
MERTSVWVEGKSQLVYLSVAMADNYTAAQATNQLAQAYIEAQLEAKVDMSMTAASWMNDRLVSLREKLQASEDQLQAYLD
AEGLVDLNGVGTISASELSLTGDRMIDARRQRAEAESQFRQVESMRSQGWERLSSVPAVLGHPLIQQFKADQAHARARVE
DLSRRYGDRHPAMVSARSDLNAATASLRQQVEQVVASIERNYQLAVANENSLRSSFNENKDRIQDISRKEFKVRDLQRQV
ESDRALYDTFMTRLQETTATSDLSSTNARVVDAAIPPTEPSAPNVKLIMVVALFLALVLGIAQAIIREILDNTFKSSEEV
ENKLNLPVMGIVPQVPRKLRKEVSHLFERSGDKRFCEAVRTIRTNLLLSEANHPRQVLVVTSTAPGEGKSSVSANLAFAM
GQLHRVLLIDADLRRATLEKAFELKPGTPGLVNLIGGNARLEDCIHSVGNVDMIAAGPVPSNPLELLSSPRFAKLLEVLK
GRYERIIIDSPPSQAVSDAAVLSTLADAVIYVVKSDSTLIPHVQKGVSQLQNSSAPVAGVVLNHVDIEKAKKNGQFRGYY
DHYGYSEQTV
>gnl|bykdb|A0A078M526 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas saudimassiliensis] (length=741 residues).
MQNITPPYRNQSSTDEIDLAVLFGALIDGKWIIAGLTLLFALLGVTYAILATPIYQANALIQIEEKSGGLAGMSELSDVF
GGPSKAVTEIELIKSRAVIGQAVTNLKLDTVSSPSYFPLIGHWAARRFKPEYEGELAQPWFGLAQYAWGGEELEIFQLAV
PPAYLDQPLALVAGAHDYFSLYNDDGEQLLTGQVGQQVEQNGFKVQIAKLIARPGTRFTVAHNRLLNSIMYLQNELDASE
RAKDSGIISLSLQHEDHQHAIRVLDEISRLYVRQNVERNSAEAAQSLEFLRDQLPQVRSELERYEQALNDFQTSSKSVDI
SIETQSVLNQIIELDTLISEQNLKRSELQRRFTGEHPSYQILQEQTQQLQRQRNELSAKVDQLPETQQELLRLSRDVAVT
TEVYTAMLNRSQELDVLRAGTVGNVRIIDAADASVTRPVKPRKAIVAILSTLFGGFLGVALVLLRQIHNRGVENPELIEQ
LGLPVYASIPFSREQEFLEKHMRSSNRAAQHDSLILALKNPADLAVESLRRLRTSLHFAHAGAMNNVLMITGPSPGVGKS
FVAVNLATTMAQTGQRVLLIDADMRKGYINKVFRMPARDGLSDLLTSRIDIQTAIRPTEVERLDLIARGRIPPNPSELLM
HDNFRRFLREIDNQYDLIIIDTPPVLAVTDASLVGREAGICLLVTRFGQNSAREIEAAKRCFEQDGIQLKGAIFNAVVKK
ASAYGYNQYGSYFYEYKSEKA
>gnl|bykdb|A0A080FXW3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli 1-392-07_S4_C3] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQNSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDNK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHARPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEEEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGVKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A080G6U1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli 1-392-07_S4_C3] (length=726 residues).
MTTKNMNTPPGSTQENEIDLLRLVGELWDHRKFIISVTALFTLIAVAYSLLSTPIYQADTLVQVEQKQGNAILSGLSDMI
PNSSPESAPEIQLLQSRMILGKTIAELNLRDIVEQKYFPIVGRGWARLTKEKPGELAISWMHIPQLNGQDQQLTLTVGEN
GHYTLEGEEFTVNGMVGQRLEKDGVALTIADIKAKPGTQFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDDPQ
LITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDNQL
NELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISK
SSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEHGISVYATIPMSEWLDKRT
RLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSD
QKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDH
YDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGY
SYSEKE
>gnl|bykdb|A0A080IZS8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli 1-250-04_S3_C2] (length=720 residues).
MTDKVKQISPSVSGNDEIDIGRLVGTVVEAKWWVIGITALFAALAIVYALFATPIYSADALVRIEQNQGSALVQDISNAL
TSKPPASEAEIQMITSRMVLGKTVEDLGLDIAVSKNTFPILGAGWERLMGRQNETVKVSAFNRPAAMADSTFTLEVINPT
RYRLSNDDGFSAEGKVGETLNKGGVSLLVTGIAAHDGASFTVTKYSTLGMINNLQNSLSVTEDGKESGVLTLTMVGEDKD
QIREILNSIANNYVAQNVARKSEEAAKSLEFLEVQLPQVRSQLDVAENKLNTYRQQQDSVDLPLEAKSVLDSMVNIDAQL
NELTFREAEISKLYTRIHPAYRTLLEKRRALEEEKAKLSKRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITR
ASTVGDVRIVDPAITQPGVVKPKKALIVLGSIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGINVYASIPLSEWQKSRD
SVKSVNGVKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAPNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLM
IDCDMRKGYSHELLGTTNDNGLSEVLVGKATFESSAKRTSVANFDLIPRGQIPPNPSELLMAERFSELLKWGAANYDLVL
IDTPPILAVTDAAIVGRHAGTTLMVTRYAVNTLKEVETSLSRFEQNGIAVKGVILNSIFRRATGYQDYGYYEYEYQSDSK
>gnl|bykdb|A0A080J8N8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli 1-250-04_S3_C2] (length=726 residues).
MTTKNMNTPPGSTQENEIDLLRLVGELWDHRKFIISVTALFTLIAVAYSLLSTPIYQADTLVQVEQKQGNAILSGLSDMI
PNSSPESAPEIQLLQSRMILGKTIAELNLRDMVEQKYFPIVGRGWARLTKEKPGELAISWMHIPQLNGQDQQLTLTVGEN
GHYTLEGEEFTVNGMVGQRLEKDGVALTIAHIKAKPGTQFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDDPQ
LITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDNQL
NELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISK
SSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEHGISVYATIPMSEWLDKRT
RLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSD
QKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRDQVPPNPSELLMRDRMRQLLEWANDH
YDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGY
SYSEKE
>gnl|bykdb|A0A080LSM4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Candidatus Accumulibacter sp. BA-91] (length=751 residues).
MDNDQSRLSANTNALPGMTAAAMQPLPQISSEEVDEGLALGEIIAVLMDYRWLIAAISLLALAIGLTWVFVSKPIYRADG
LLQVEEKSSGVGSLKALQPLLGDDTTVSAEIEILSSRMVLGRVVAKLKLDIVAVPRTLPLLGSVLARRYEGDEPNSPWLG
LSSFAWGGERIQVDSLDVPRPQLDEKHTLIAGEGGTFEVFDQDDQLVLKGKAGTRASEQGYAIFVAELRARPGTQFRLRK
LSAETAIDDLRRNYSVKERGKKSGVLELSLLGQDPAEIGLVLDDIQNTYVRQNVERRSAEAEKTLKFLETQLPALKTQLD
SAEAAYNNYRQSRGSLDLSLETQAILKSLVDVENAAVQLKQERDELRQLFKPEHPRIEAVENKLQRLNERRKQFDAEVAR
LPDTQQTVLRLARDVEVSNRLYTELLNTAQQLRVTKAGTIGDVRVIDPAAVGRKPVGAGPIAILAIALLLGLLVSMVVIW
VLRSLRVVVEDPEIIEAQLGLPVYATVPHSKTEVELHRKARGGAGELLAVVYPEDDAVESLRGLRTTLHFALLDAQRNSL
LITGSSPGLGKSFISKNLGAVLAQVDKRVVIVDADLRRGHLHKEFGIERAPGLSEYVAGQASLEEILKTTAVPMLSAVTT
GQIPPNPSELLMHPRFEVLLAELAANFDTVIVDAPPVLAVSDAAIIGRHVGATLMIARAGKHPIRELEQAVKRLNQAGVQ
VKGFVFNDLNVSRQNYRYGYKGYVYRYSYKT
>gnl|bykdb|A0A080M4Z4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Candidatus Accumulibacter sp. SK-02] (length=751 residues).
MYKDRSRPAASAKTVPGMNAAATQALPTLSSEDADEGLALGEIIAVLIDYRWLIAAISLLALAIGLAWLLVVKPVYRADG
LLQVEEKSSGVGSLKALQPLLGDDTTVSAEIEILGSRMVLGRVVTKLKLDIIAKPRTLPLLGSAVAKRYEGDEPNSPWLG
LSSFAWGGERIQVDSLDVPQVQLDQLHTLIAGEGGAFEVFDDDDQLVLKGKAGTRASNQGYAIFVADLKARPGTQFWLRK
LSAESAIDDLRRNYSVKERGKKSGVLELSLLGQDPAEIGLVLDDIQNTYVRQNVERRSAEAEKTLKFLETQLPALKTQLD
SAEAAYNNYRQSRGSLDLNLETQAILKSLVDVENAAVLLKQERDELRQHFKPEHPRIEAMDNKLQRLDERRKQFDAEVAR
LPDTQQTVLRLARDVEVSNRLYTELLNTAQQLRVSKAGTVGDVRVIDVAAVARKPVGAGPVAILSIALLLGLLISMLVIW
VLRSLRVVVEDPEIIESQLGLPVYATVPHSKAEVELHRHGRGGTGGLLAVVDPEEDAVESLRGLRTTLHFALLDAQRNSL
LITGSSPGLGKSFVSKNLGAVLAQLDKRVVIVDADLRRGHLHKEFDIERSPGLSEYVAGQASLEEILKPTVLPTLRVVAT
GQIPPNPSELLMHPRFEVLLAELAANFDTVIVDAPPVLAVSDAAIIGRHVGATLMIARAGKHPIRELEQAVKRLNQAGVQ
VKGFVFNDLNVSRQNYRYGYKGYVYRYSYKT
>gnl|bykdb|A0A081CSP1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Agrobacterium rubi TR3 = NBRC 13261] (length=782 residues).
MHHKTFKSNMNFPDSSKDADTFIDLDRLWAAVVRRANIIGACVIASMVLAGLYLVFATPVYTAMTQVLLDDSLSRYAEDE
SPVPAAQVIDNRIASAVEILKSKEMALTVVDKAQLDQSDAIVNPPMTPMDLVKSSVKGVVDLLTPNSPPVSEAAMRNGLR
EKAAAVIQQALTVERVGRSSVIAISIRSIDRQLATQIAKTYANSYLTEQLNANFDATERASVWLQERLTDLNQRSQAASL
AVEKYKAANNIVSSRGELMSEGQLADLNGQLIAAQADAATASARYNQYKSITDQGPDNAVNNAIVSARDTDNSVIQDLRK
RYIAITDRERGVVQQFGKDHPQAIALASERGDLARQIYQELQQLTGSFKNDFDVTQSRVQSLRESIDRVAGRNSEANMTL
VKLRELEQQAAALKTLYESYLGRFEEASQKQSFPIAKARIISDAGLPTSPSSPKKTMTMALSIVLGLMLGGGVAAILEFR
DRYFHTGNDVRDNLRMRFLGYLPFIGEKGVDAAKTETGAATPEVPDSDIEENGQVSFQKMLRLAVDSPRSSFTETLRNVK
LTADVVIQERQCRVIGVISCLPNEGKSVVALNLAGLIATTGKRTLVVDADIRNPGLSRMLTTRQSAGLVEVVLDEVPWTK
AVKVDSRTKMGILPVSTSNQFAHSSELLASSGMRKFMESAREACDYIIVDLAPVVPVIDAKAFASQVDGFVFVTEWGKTP
IQMVQNLMSHEPEIANKTLGIVLNKTDMTELQRYAGPGGSEHYHEQFSAYYGDAKKTVSEPA
>gnl|bykdb|A0A081G0A7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Marinobacterium sp. AK27] (length=746 residues).
MDTGFNQQERASLAQRIVDDEIDLLQLWQTIWRRKWSIITLTLVVMMLAALVVLSVTPIYKGVSTLLIEQKAAKAVSIED
IYGLDGGSNEYLQTQFELLKSRELAERVVRELNLTTHPELDPRQQPEPLIDISGMLKSFDIRKWLPIATPADFEASDELT
EAQIFDRVVLAFMERTTISPVMKTQLVKVEVEMADAALAAQAANALANAYIESQLEAKLDMTQTATNWMNERLSTLKSKL
QESERNLQAFREAENLVDLEGVTTVAGGELSQTGDRLIDARRSRAEAESQYRQVASMKSAGWERLATVPAVLSNPLVQQF
KAEEGRARSKVQELSRRYGPKHPKMISANTELSAASANLRSQVEQVVASIEREYQLATANERSLQGSFNRNKEQIQDIKR
KEFKLRELQREVDSNRSLYDTFMTRLKETSATSDFEAVNARIVDPAVVPEDPVKPKKSLIVAIAGLLAMMAGIGMVLLLE
FLNNTFKSTEDVEGKLNLPVLGILPMLKGKQRTDVARMVLNDGDKAFTESIRTIRTGVVLSGLDNPHKVLVVTSSIPGEG
KSSVAANLAFAMAQMEKVLLIDADMRRPTVAKNFEFPVGTPGLANLVAGTAKLEDCIKSVEGDVDIISAGTVPPNPLELL
SSQRFAKALQVLESRYDRIIIDSPPTQAVSDALVLSTHANALIYVIKSESTAIPLAKRGVGQLLQNNAPVTGVVLNQVDV
KKAKKYGYNYGGYYDYYGYSGSTKEA
>gnl|bykdb|A0A081K9C1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Endozoicomonas elysicola] (length=734 residues).
MNTETRHAGSAPAQTRNPQDEDIIDLRQIFHVLNNHRWAILGFTAAVTLIAILVVFSMTPIYQATSVLQIEQEQAKVVSI
EEIYGIEGGNDSYLNTQFEVLKSRGVLEKVVNKLNLLNNPEFNTRLQEAPWYAGLLDWRDWLGLKEPEAEVDPATVMRDT
INVLSAHVSIEPVRKTQIVKIHAQSESPQLAARIANAIANAYIESYMESKLSLTLNATDWMQGRLGELSEKLKIAEQELQ
DYREEEQLIDLEGVLTVSSNELKALTESLVQVRNKLAVSENIYKRIRSGEMKQGDNQSLQAVLQHPLIQDLKQDESKLER
QVLDMSRRYGPKHPSMISAQSELESIRENLNIQIRNIVDGVERDYEIDKANEKSLQIAVENVKKKVQDINRKQFRLRALE
REVQTNKDLYDAFFKRIQETSATSDLQTANARIVDQAFTPQVPVKPKKKLIVGIAALLGLMVSCGIAFLLEMLNNTIRTT
RDVEEKLNLPVLGVLPKLTDKKLLDHVFNLFNDKGQPGFGEAVRTIRTSVNLTAMDQQHRLFAVTSTVPGEGKSSTASNL
ALALGQLGKTLLVDCDLRRPVVGKNFHIKGGSAGLANLLADTAGLNDAVHKLEGIDIIPCGQVPPNPQELLSSERFSALL
KQLREQYDYVVLDCPPVQNVSDVLMVSRHCDGLVYVVEAGRMQANAVQAAVGRLLQARAPVTGAVLNKIDPKAKDTYGYN
QGYYDATGYYSGTA
>gnl|bykdb|A0A081M898 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudorhizobium pelagicum] (length=700 residues).
MVRRQIWLILSLVISLTAITAIITYSLEPRYSASALVFVDTSTQSILEPDAAMQNGSTDNARVESEVAILRSNGVLVDVV
NSQNLVADDEFGVKVGLLDRLLQMIRLKKVEPPDPSEAVAGVLNNFREAIAVSRDGPTYLISVTVTSKNREKAARLANAL
TETYIRRQVDSKVAATVASRDTLQKQVDNARSTIAASARNVDDFILSNINDLREQGSSSVGTLYDQLTRIQQERREGLSQ
VETIDETLKRNDLAALVQNLESQAAQELARQRETLAAELSSASPDTTAAFDLREELQRLDAAIAEEGRRALSSLRSDVRN
FEQQESSVSTELINAVLASDLPDETLSAIYGLRQTAEGARREFDDLSARLQRLDTLAALQMADSRVVSEALAPRNPSYPK
KQLILPLAAIMALALGVGLAFVREHFVGGFTNEDQVSTVLRLPLASITPRETDEPARKEDGGQSLSDIVIRSPLSMFAES
VRRIRVAIDRHLYKTHGIPGEGSGGTVIMVSSALPNEGKSTIALSLARTYALSGKRTLIIDCDLRKPSLHRHLGLEPSTG
FVEFLRGSDTAATLPKLTVTDVPTGLTVLLAGRRGNFATDELFMGSEMAKMIAVARRNFDYVVLDTPPVEPVVDGLYLAR
YADVIAFVVKWAVTPQTSAKRAVAALQESAPDGTPIIAVLNQQERAKLFGYYSYSDYYVE
>gnl|bykdb|A0A081M9G7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudorhizobium pelagicum] (length=699 residues).
MGIFRRQILLILSLVVGLTAVAAIIVYSIEPRYSASALVFVDTSSKDILEADPRSQNGSTDNARVESEVAIVSSDGVLLD
VINSQNLVADEEFGVKVGLIDRFLEMIRLKTAEPPNPAEAVSGVLNNFREAVSVNRRGLTYLINISVTSKSREKAALLAN
AVAQTYIRRQVESKVSATLASRDILQKQVENARANIAGSARSVDDFILGNINTLREQGSSNVGLLYDELTRIQQERRDGL
SKVETIDDTLKRNDLATLVQSLETQAAEELERQRQALAGQLASASPAAAIDLRAELQRLDETIAEEGRRTLNSLRSEVQN
FEQEELSVRSSLTDAVLTSNLPNETLTQLYSLRQTAEGARREFDNLSSRLQRLDTQAALQMADSRVVSEALAPRDASFPK
KKLILPLAAVMALGLGVGLAFVREYFVGGFTNEDQVATVLRLPLASISPRATEEPGRDDADGHSLSDIIIRSPLSMFSES
VRRIRVAVDQCLYKKNGQRDESSGGTVVMISSALPNEGKSTIALSLARTYALSGKRTLIIDCDLRKPSLHRHLGLAPDTT
LVTYLQGGDAGSLPKLTTADPSTGLTVVLGGRRGNSPTDQLLMGQEMARLISVARRNFDYIILDTPPIEPVVDGLYLARH
ADVIAFVVKWAATSQSSAKHAVAALRDSAPDGTPLLAVLNQQERAKLLGYSSYSDYYVE
>gnl|bykdb|A0A081ME56 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudorhizobium pelagicum] (length=771 residues).
MSMDQFQFRTKPVLHEPQTDADSFIDLDRLWSALVRRLGVIIACVGLAMLLAGLYLFATQPTYTSMTHILIDDSLSRFAE
EEEGPQSAQQIDNRMSSAVEILKSKALALRVVDEAQLGDNELILNPPRSLLDLVKGAVKGTIALVLPGRPPVSEEAMQAG
RREKAAAILQQSLGVERVGRSSVIAISVRSPDPQLSATIARTYASSYVEEQLNANFDATERASVWLQERLTDLNSRSQQA
ALAVEQYKVENGLVSPRGELLSAQQLADLNSQLIVAQADAATASARYEQYRAIVEQGPDAAVGNAVVSSRETDNSILQDL
RQRYIAINEREQAVVQQFGADHPQAVALKTEKQDLSRQIFTELQQLTGSFRNGMEVASSRERSLRESIREVAGTNSRANV
SMVQLAELEQKAAALKTLYQSYLARFEQASQQQSFPIAKARVISEAGVPTAPSSPRKTLTMALSIVLGAMAGGALATLLE
VRERFFRTGEDVQEKIGLPFLGYLPRISGNKTASAGGSPPESAQPMPHGEPIDFRHMMRVAVDWPRSAFAETLRNARLAS
DIVLQGRQCRVIGIVSCLPGEGKSTVAANFAGLLAASGQRTLVIDADLRNPGLSKMLATEPEVGLVEVALGEVEWTQAVR
VDRRSKLAIMPVGARGKSLAHASELLSSPGMTRFLDSVRDTFDVIVVDLAPLVPVVDAKAFEPHVDGFLFVAQWGVTPAK
TVQNVLAAQPQIAAKVMGVLLNNTDMSQLHRFADPGSPERLREQYLNYYQG
>gnl|bykdb|A0A081RG74 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingobium chlorophenolicum] (length=697 residues).
MAGPGLLIDAAMEGRPARFAAAANGAWTAVRRHRIILFVTMALCVLAGVIFILLSTPDYRATASVEVEDVPAGAAGAAAA
QRPATPSDNESLMQTELEVLRSRALAEDVARELALVGSRTFFDGMDVRRPDRGTGSLSQRQVETEMVVNLLRDNLHVELP
GKSRVIRIGFTSANAVLSARVANSYADSLIRADLKRGFESGVQARRFLLGELDGARKDLERAERDLAVYAANTGAVAPPE
SNDGESAPPEGTTATRLAQLNAFRAQATADRIAAQKRWESARLSSVETLPEVLNNGAMQQIMTERAQARAQVVQERQFRK
DAHPEMREARARLAALDDQAEGMANTIRASLKEQFDVAVHGERQIQSEIAKVERQAQAERGRGVQMSILERQVDTYRLLH
DSLLQRYRDMASQAGFQAGRIQPLDRAAVPSRPSSPNIGVTMLFASLGGLLLGLMAVAGRHIFDDAVTSADTLAERVNLP
LLGAVPAGEKPAAEIFAPMASSLLLGSAAGLPRSILVTSAQEGEGKSSTLHALAKALAKLDKRVLVIDADMRRPKQHSLF
GISPTRGISELMTGQAKMDEVIVDSGVAGVSLLPCGAIPPSPAELLVTPAMDSLLATVRERYDTVLIDAPPVLGLSDACL
LASKAQVTLLVVEWGRNHHGGLRVAVDRLRRAGGAIIGAILTKQEGRPFEYDYHRGG
>gnl|bykdb|A0A081RGC9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingobium chlorophenolicum] (length=719 residues).
MLDQTGASHADITAQASASGIISSLNTAVIGMFRRRWRTFAIVSTVAFTVAAALILMMPWKYSATARVKIDPSANAALGQ
MSGNERPDQNIFDTEVNVMRSRDIAKGVVRELRLDSNPEFVKGLDPLPARPTAHERDEFETALADRLLGNLETARDKMTY
IVNVGYTAREPAAAAAIANAFATQYIAYSVGRRTGTASRETSYLDQRLATLNDQAVQADARLAQYRATAGIVSGGDTSVT
DQQIAPLASQLATAQSEAAAASAKLAAARAQVASGGLDAVSAVLNSQVIADLRSQRAQLIQRQGEVLSRYGPKHPESVKV
IEQLRALDAQIKDEADRIIGGLVSEASAANARAASLRSDMGRLRSQQSTDTRASVMADTYQRQADAAHSAYNKLAEQAQG
MSQVARSALTQAQVIETAVPPAKPTSPNRKLLLALAFIGAVAAGSGVVLMREILAKGLYSVADLERLGVPVLASIPRIDT
GKLRDADGRPCSAPATLINKAMSSYAESYRVLRRSLLGRDGADMRVITIVSSLPDEGKTSSSLTLARICAMAGEKVLLID
TDLRRAGLREAAGIDVDRGLVEILTGDLRAEDAIVQDAVAGLDILPVASTSFVAEDLFSGRKMRDLIDAQSRIYDRIIID
TPPLLGLADARTVALLADAVVLVVKWGDTPANAVKTSLSWLTSDDARLAGAIFSMVDAGEEAYGALYYSRKYSHYYHSE
>gnl|bykdb|A0A081S1Q9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Photorhabdus temperata subsp. temperata Meg1] (length=713 residues).
MTTSDKSSHTHTDSDEIDLGRLLSALFDYRWAIGGITLLFMVIGLGYSLVATPVYKANALLQVEKKSSALSLVGDMTDML
SGRQSDTSAELELLVSRMIIGKTVKDLNLDIQVTADYFPVIGKGIARLRGMPKPDIVIKNFTVSSEHIGKAIKIYVDDSE
NYQLEFDDQVFHGQVNKVLDADGINLLISNILASPGQSFTLVKRPRLDVVRSLQQALRVTEKGNNTGIISLEIEGDDRKR
IKSILDSVSKNYLQQNVTRKTEEAESSLSFLKNHLPKVKMALNSSEELLNQYRQANESVDLSLEAKSALETLVQIEKQLN
ELTFKEAELQQLYTKQHPAYVALLDKRKTLAETKKELNQSIKRLPKTQQEILRLTRDVQVGQEIYVQLLNKQQELSILKA
GTVGNVRIIDEAVVESSAVKPKKPLIIAAMTMLGLILSIGVVLLRVMFRKGIEGPEQLEEIGISVYATIPLSETQAKLEQ
QQKKRTHRQKLRLLAIHDPTDLAIEALRSLRTTLHFSMMESANKVILLSGSAPELGKSFISVNLAAVLALGNKRVLLIDA
DMRRGHLHKVLESPQSLGLSEYLAGQNQLKEIITRTYLTELDFVSRGDTPPNPSELLMHNRFKELLSWAEEHYDYVLIDT
PPILAVTDAAIIGRYAGTSLLIARYYKTRVKEVDVAIRRFEQNGTHIKGVLLNAVEKNSSLYYGGHYQYSYKD
>gnl|bykdb|A0A081T3K0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingobium lucknowense F2] (length=697 residues).
MAGPGLLIDAAMEGRPARFAAAANGAWTAVRRHRIILFVTMALCVLAGVVFILLSTPDYRAIASVEVEDVPAGAAGAAAA
QRPATPSDNEALMQTELEVLRSRALAEDVARELALVGSRTFFDGMDVRRPDRGAGSLSQRQVETETVVNLLRDNLHVELP
GKSRVIRIGFTSANAMLSARVANSYADSLIRADLKRGFESGVQARRFLLGELDGARKDLERAERDLAVYAANAGVMAPPE
SNDGDSPPPEGTTATRLAQLNAFRAQATADRIAAQKRWESARLSSVETLPEVLNNGAMQQIMTERAQARAQVVQERQFRK
DAHPEMREARARLAALDDQAEGMANTIRASLKEQFDVAVHGEKQIQSEIAKVERQAQAERGRGVQMSILERQVDTYRLLH
DSLLQRYRDMASQAGFQAGRIQPLDRAAVPSRPSSPNIGVTMLFASLGGLILGLMAVAGRHIFDDAVTSADTLAERVNLP
LLGAVPAGEKPAAEIFAPMASALLLGSAAGLPRSILVTSAQEGEGKSSTLYALAKALAKLDKRVLVIDADMRRPKQHSLF
GIAPTRGISELMTGQAKMDEVIVDSGVPGVSLLPCGAIPPSPAELLVTPAMDALLATVRERYDTVLIDAPPVLGLSDACL
LASKAQVTLLVVEWGRNHHGGLRVAVDRLRRAGGAIIGAILTKQEGRPFEYDYHRGG
>gnl|bykdb|A0A081Y8T0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas sp. AAC] (length=742 residues).
MQQQPAVAIHDKDDDEIDLLGLLGTLIDHKWLIAGITAGFMAVGVAYALLATPIYRSDAIVQVEPKKPTIPGLSDMGDLL
GAQSEAITEIQLLTSRAVIGKAVDNLKLNIVVEPSRFPLIGGFLARHFSPETPDEVAAPMFGLSRFGWGGEELKVFQLDV
PTALLEKDLTLIAGENGSYTLLDDDDNVLVEGKVGEAYDQHGVKIQVESLHANPGTHFDVVRERRLTTILRYQDNLNVAE
TGKESGIISLSLENDEPARALQVLDEISKLYVRQNVERASAEAASSLEFLRGQLPDVRRELERAEDALSAYQTRAKSADI
SLETKALLDQIVALDTSISELKLQQAEMDRKFTRQHPAYQALQKQIGELTSKQNGLSHRVEGLPETQQELLRLTRDVQVS
TAIYTQLLNKAQELDVMRAGAVGNVRIIDTADVDITKPVKPKKAMIVLVATLLGLFFAVGLVLLRKALNRGIETPDAIEQ
LGLPVYASIPYSVLQKAEEDKRDKGRGRAAKAAPLLAMSHPTDLAIESLRSLRTSLHFAMLEAGNNRLMISGPSPAVGKT
FVSSNLAAVIAQTGQRVLLVDVDMRKGYLHKVLNSGEENGLSDILVKRCDFSAAVRTTEIEGFHFIPRGQIPPNPSELLM
HPNFTAFLEEASRQFDLVILDTPPLLAVTDAAIVGRQSGTSLIVTRFGLNPAREIELTIRRFAQNGIELKGAIFNGVEKR
ASAYYGYGGYGYYHYEYKSDKA
>gnl|bykdb|A0A083ZK45 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhizobium radiobacter] (length=749 residues).
MSDYDKSGLTAEFIDIDAALAIIRRQWRVVLAAIAVAGAIGLAFAATAVPIYSATATLLIDRNNSQIVEQLSTIGGVVED
EASILSQVEVLQSETIGLAVVDSLKLTENQEFRATRASLLSSIFGTIRSLVNVSQWFSPTKKEAVIDDGTLKRSLSDRLL
NDLSVKRIGRTYALELTYNSTSPVLAAQIVNAVASAYLLDKLNSKYEATRRASDWLSDRIAELRQRALDTDLAVQKFRAE
HNLITTGNNGLLSDQQLAESNSALILAQSETAKARARVQRIEHILATDDVDAVVTDILDSSVANDLRKKYLESSKLETEI
TRRLGSSHIQAVRLRNEMQEYRRLMFQEISRIAQSYKSDLEVSEAKEKSLAESVAKATDISNSASETQVQMRELQREAET
YKNMYQTFLQRYQEAMQQQSFPVTEARVISKAMPPYMPSKPNKPMILVLFMVMGAAAGGGIAIFREFRDRFFRTGDQVRD
VLGLEFLGNTPLIPNQPTTEAQENGHPGLTRPTSVARYAVDHPLSSFAETLRSTRLAIDLGIPAKTGARIVGVVSSLPSE
GKSTISINLAQLLAGQGARVLLLDADIRNPGATRAMARHAAEGLLEVLLEGRSVQDVLLRDEKTYLAFLPTVVKQRVPHS
SELLTSAQMHKLLAEASSAFDYIIVDLPPLGPVVDARAMAGRIDGFIFVTEWGKTARRAVRNTVENEVHIRKKCLGVILN
KVDTEKLKLYRAYGSSEYYHSRYTRYYHD
>gnl|bykdb|A0A083ZXQ5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Serratia sp. DD3] (length=725 residues).
MSEKYKVNNSSNDRSDEIDLGRLIGELIDSRWLIMAVTTAFLILGILYSLFATPIYRADALIQVEQNSGNSLLNNISQVL
PDSQPDSAPQIELLKSRMILGKTIEDLALTTIVEQQYFPIFGKGFARLTKQVPGNLVISKFALPSSWSDEPVVTLRVGTD
NSYIISRDGEHYANGKVGNLLEKDGFSILISDIQAAPGTEFKITKINELDAITKLLDNYEVADKGKNTGVLGLGLTGADP
VLIKNILNTISNNYLAQNVARKSAEDEKSLDFLKIQLPKVRSELDAAESKLNQYRQQKDSVDLSLEAKSVLDSIVAVDTQ
LNELTFKEAEISKLYTKEHPSYRALLEKRKILETERDKFNKRVNAMPKTQQEILRLSRDVQSGQQVYMQLLNKEQELSIS
KASTIGNVRIIDQAVTQIKPIQPKRLIVILLSMVLGAMLSIGYVLLRSFLHRGIENPEQLEDLGINVYASIPLSEWQQKK
DIEFQSKNRAKGKKANTDSNSLLSLHNPTDLAIEAIRSLRTSLHFAMIEAKNNIIMISGASPGIGKTFVSANLAAVVAQA
GLKVLFIDGDMRKGYVHQLLGLEGGKGLSDLLSGKVSIASVIQQTTQPGLDFIARGTIPPNPSELLMHKHFSEIINEASG
NYDLVLVDTPPILAVTDAAIIGKLAGAALLVARFEINTPKEVEVSIRRFEQNGVEIKGVILNGVIRKATNYYSYGYDHYD
YSYKS
>gnl|bykdb|A0A084DA43 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia sp. MSh2] (length=745 residues).
MTQPSAPPQHAAEEGGETDFVAVLDILLESRWLIAAVTCVFLVAGLAYAVLGKPVFEANIMVQVEDSPDTSAAKSLLGDV
SALFDVKSSAAAEQQILASRLVVERAVDRLHLFIDASPKRFPLIGDWIARHGDGLSDPGLAGVGGYAWGRERIDVSTFDV
PRKNEGDKFVLTNLGGKRYRLEGGDFDAAVEGTVGTLERFRSPRGPVALRVDAIDAKPGAAFVLVRNSRLKTIEDIRDRL
NVQERVKQSDVVVASLQDTDPKWVSDTMNEIGRQYVRQNIERKSAEAAQSLEFLNAQLPQLKAQLTDSEARLTRVRNEHG
TVDLTEEAKLALAQSADAKTRLLELQQKRQELMSRFTERHPSVAAIDEQIAALGGYRNAAELQIRRLPDLQQETVRLMLD
VKVNTDLYTALLNNMQQLQLVQAGKVGNVRLVDTAAVPEVAVRPKKALVALASLLLGLLAGCGAAIVRSMLFHGISDHNE
IERRLGLAVYTTVPISDHQRELAEEAARKRGHKSVLSVDYPNEPAVECLRSLRTALQFAMLEAKNNIVLIAGPAPGVGKT
FISSNLAVVMASAGKRVLLIDGDIRKGRLHDYLGLPRGRGFTELIAGSANVDDVMHREIVDGLDFISTGTIPKHPAELLL
NRNLAPLVDALSSRYDIVIVDSAPVLAVPDAGILGAIAGTSLLVTMAGKTKLGEIGEAAKRFAQNGIRLNGIIFNGVNPR
LGQYGYGSKYGGYRYVSYEYGMHDA
>gnl|bykdb|A0A084DBP6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia sp. MSh2] (length=741 residues).
MVNTQAKHVYADPAAKTEEEDLVLGQLLQVIMDDIWLLLGIAVTVVALAGLYCYIAKPVYQADVHVRVEGNDNTSQALTQ
TQTGAVINSGPQQAPTDAEIEIIKSRGVVAPVVEQFKLNFSVAPKTLPVIGSLAARVATPGEPARPWLGLKSYAWGGEVA
DVDSIGVVPALEGRKLTLTAGPGGTYALADDNGGRLLSGRVGEAAQGGGVTLLVSKLVARPGTQFTVIRYNDLDAITGFQ
AGIQVTEQGKQTGVVQISLEGKDPGQTAAIANALAQSYLNQHVVAKQSEATKMLDFLQGEEPRLKADLERAEAALTQYQR
TSGSINASDEAKVYLEGSVQYEQQIAAQRLQLASLAQRFTDSHPMVIAAKQQLAELQGEKDKFSNRFRSLPATEVKAVQL
QRDAKVAEDIYVLLLNRVQELSVQKAGTGGNIHLVDSALRPGDPVKPKKVLILSAAVFLGLILGTGVVFLRRNLFQGIED
PDRIERAFNLPLYGLVPQSAEQVKLDAAAEKGGSRARPILASLRPKDLGVESLRSLRTALQFALMDARNRVIVLTGPTPG
IGKSFLTVNLAVLLAHSGKRVLLIDADMRRGLLDRYFGLTVQPGLSELLSDQAALEDAVRDTPVQGLSFIAAGTRPPNPS
ELLMSARLPQYLEGLGKRYDVVLIDSPPVLAVTDATIIGRMAGATFLVLRSGMHTEGEIADAIKRLRTAGVDLEGGIFNG
VPPKARGYGRGYAAVHEYLSA
>gnl|bykdb|A0A084DP22 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia sp. MSh2] (length=766 residues).
MPLPHSTQHPPDRADEIDLAAVVDALVTRRWLIALVTAACVGAGTLYAFLSHPQYQADILVQIEDGGDASAAKSLLGDVS
SLFDVKSTAAAEAQILASRLVVARAVDDLRSYIVVQPKRFPVVGDFISRFNAGVTRPGVFGIGGYAWGDERVDLARFDVP
KPLEGERFALTMLDGGRYRLSGATLPAAVTGAVGRAERFPTADGPLVVEVTRFDANPGTRFALVRQSRAETIDTLRRALD
VQEKVKQSGVIVATLRGPDPQRLQAQLQAIADHYLRQHLERKSADAAQSLAFLNKQLPALKQQLEHAEQRYTNMRNANGT
IDLTEESKLLLQQAADTKTRLLELQQKRDEMATRFAPGHPDMAALDAQIGTLRGQQHQVERQVKRLPDLQQDAVRLMLDV
KVDTDLYTALLANAQQLELVKAGRTGSVRLVDAPVVPEETVRPNRPVVIGAAALLGLLLGTSLAFARSFLFGGIGHADEI
ERHLGLSVYATIPDSPAQRRIARQLDARMPGTHLLSVAHPHEPAIESLRSLRTAIHFAMQDARNNVMLLTGPVPGAGKSF
VSANFAALLAANGQRVLLIDGDLRKGHLHDHFGVARERGFSGLVTGALAPHDAIHANVVPNLDFMATGTLPPNPADLLAH
DRVATLIDTLSARYDAVVIDSAPILAVTDAVALSRHAGTLLLVARAGATRLAELGEAARRLAHNGVAASGVLLNGVDAHA
GRYGSRYGTYRYTQYDYAPRRDRSPGSPAMRALRAFAGRIRRGGAR
>gnl|bykdb|A0A084EL51 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingobium yanoikuyae] (length=714 residues).
MVSRIIELEQRQAGEEDRTTRFVESARGTWTVVRRHRVILFVTMALCVLAGVIYILLSTPDYRATASVEVEDVPAGAAGA
GAMQKPVSAADTESMMQTELEVLRSRALAEDVARDLALVGSPVFFQGMDARRPAQGQGSLTQRQVEHEQVIKLLRDNLQV
ELPGKSRVLRISFVSADPALSARVANSYADSLIRADLKRGFESGVQARRFLLGELDGARKDLERAERDLAVYASRTGAVP
AEAATDEDKKSDGKDAKPDAAPVPEGSTAARLAQLNAFRAQAVADRIAAQKRWESAKAASAETLPEVLGNGAMQQLMAER
AQARAALVEERQFRKDAHPEMREARARLAALDDQAESMANTIRASLRQEYEVAAHGEKQIASEIAALEGDARVERGRDMQ
MSMMSRSVETYRLLHDSLLQRYRDMASQAGFQAGRIQPLDRAAVPTTPFAPHAGQIMLVALLGGMLLGLLLIAARHMFDD
AVTSADTLAERVDLPLLGAVPTTGDQPSAPDIFAPIAASLQLASVAGLPRSILVTSAQEEEGKSLTVNALARALARLDKK
VLVIDADMRRPVQHSLFRVTATRGISEVLTGQGKAEDLILDSGVAGVSLLPCGAVPPNPAELLSTPALDALLGAVRDRYD
TVLIDAPPILGMSDAQLLAAKVQVTLLVVEWGRNHHGGLRVAVERLRRAGGSIVGAVLTKAHGRAYDYDYHRGG
>gnl|bykdb|A0A084EW77 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Haemophilus parasuis] (length=695 residues).
MNKNNHDEIDLVKLLGALLDYKWWIAIFTLLVTLFGVAYVLLATPVYTANASIQVESKSSGGLLKDFTGILEDKSSSSTE
IAILKSRMVLSNTVEQLNLTTVVEPQFSIPFLSKGLHRLMGYEPQLSVSLFEPKNPQMKEVILEVGENAGEFSLFFADEK
VLEGSIGKKYQTEDFSFEISELEAKPGQLFKIKKNDVLLAISTLQKQISVTESGKQTGIIKISINGENKAQIKKIVKSVS
ENYLLQNIVRNSAEASKSLEFLSKQLPEIKARLSESENNLNEFRLKNESVDLSLEAKSALDTIVQLEADLNELTLKESEI
SQKFTRNHPAYVALIDKRKVLNEEKIRLNKQVERLPNTQKEVIRLTRDLEVNQQIYIQLLNKMQELEIVKASAIGNVRIL
DEAQVFPNAVSPRKMIVVALAFMLGLIFASITAIAKTLLHRGIEGTSELDVLGLPTYATIPYSNEQPIFSKHKVQRFKLL
SESTPTDPAVEALRSLRTSLHFAMLEAKNNILMISGASPSVGKSFISTNLANVLAKAGHKVLLIDADLRRSYLRRLLGLA
KEVGLSDVIAQQIPFEQVIQHYDNFDIIVKGETPPNPSELLSNARFQALLEWAAKEYDLVIVDTAPILAVTDAAIIGRYA
GTSLLVGRFGETTLKEVGLAKERFERAGVFIKGFILNGIKRKASNRYDYYQYDYK
>gnl|bykdb|A0A084IQ13 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Salinisphaera hydrothermalis] (length=752 residues).
MSYEPRTEEAPSDEIDLVRLWAILSAGKWKIAACVLAAIVLAVFYLWATLPTYSANALLQVETNQPASPLQGLTSQLGQI
TGQSTSIAAPEMQIMKSRSVIGQTVRDLGLDIVAKPDYFPVIGHAIAKSRKPTKASAAAVPASQGFWFSHYAWQPAHIKV
TRFDVPHALLGKPFDLRALGDGQYVLYGPEGSKILKGQVGKAASGHTPDGQAVGLFVQTLHVAAPPTDFTVTHNAWLSTV
NGLSKKLSVSERGKDTGIVQIALQGHDRHHITQLVNAIANNYLQQNVEAQSEQAKKSLDFLNKQLPKLKSDVQTAERKLA
NYQQSNGQPVDLNEAAQSLLKQGVDLQNQQSKLKMKLAELRQTYTGKHPALEAARDQMAQLKQQEKQLQKKINKLPDAEK
AILRLKRNVKVKTQLYTTLLDRAQQLRVMKAGTVGNVRIVDPAVPPVKPVAPSKKLALILAVLLGGIVGVGLVLLQAALR
RGINDPSEIENQLGLPVYAVVPFSNWLERRARRAERQGLPTPVLARDHGDDVSVEALRSLRTSLYFAQMESGSNVILITG
PAPGVGKSFISANLSWLLGDTGQRVIVVDADMRKGRLHAFTEGRQREPGLSQVLTGQVKFEDAVRNIGEQDNVQLLTSGQ
IPPNPSELLMRQSFGELIERLKQEYDLVIIDAPPILAVTDAAVIAAATPGIVTFMVARAGVHPMAELEESVKRFSRQDRK
IAGVVFNAYRQSHAKSAGVYGGYYEYEYKASS
>gnl|bykdb|A0A084SM94 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Archangium violaceum Cb vi76] (length=732 residues).
MEETSNEAPEAPEPSLDVMQYVHAVWRRKWLILGVMAVVMLVGLFHTLRQPKIYTANTSLIIDVAAPRVLDTEVKEVMGD
ERGNYWANKEYYQTQSEVITSRAVSSRVVDRLGLRNDAAFLGVAGIQDEEARKKAMAAADPVAMVRSRITVIPSANSRVV
RIAVEDVDPKRAALLANEVADAYIAENLALRLKTTEGASVWLEERMGELGSRAGTSELDLYKFKRGADVLSLSAPGKDGQ
QQPSTAKLAYDSYMTELIAVRTKMAAVQARVDAMRQLRKSASPDAEHWAEGLSAANEGALRDLRDKVLEQRTQCVELSER
YLPEHPKMQECQGKLAVLQQELRRSLENLVKGAETDLAAVKANERTLLERVEQAKAEAFALTEKEIAYQKLRREAENDQR
LYEMVLKRFKELELSGQLRTSNVRVLDAALPNPVPVRPNTRSAFMLFFLLGLMGGVAVALGLELLDASVASRADVEERLG
LAFIGAMPPLKPDDGGPADLYIHRHPRSQAAEMCRAIRTNLLFMSPDKPFRTVVVSSAGPSEGKSTVVINLGMVMAQTGS
RVLLMDTDMRRPRLHRAFGVPDDMGVSSLVVGEGSLEGAIKSTDVPNLFVLPCGPLPPNPAELLHTRAFSELLGKLRERF
DCVLLDSPPLGPVSDALVLSKQTDGILLVLKAGTTQREQAKRAIRSLRDVKARVIGALLNHVDLKGGRYGGESYGYGYRG
YGNERDEQRSAS
>gnl|bykdb|A0A084TF40 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio sp. ER1A] (length=718 residues).
MLTDTKKAYDTASDEIDLSRLFGMLLDAKWVIVGITFLFAALGVVYALMATPIYKADALIQVESKNSGVSTLISDGLGDI
FSQESSASTEIEIINSRMVLGETVDKLNLTTIAVPKTLPVIGKGLNRLQGEQLSIDIARFERPEYLDPVSLTLIVKDDKA
ESYQVTTEDGKLVLVGRTGELAENGDWQLFVRHIDAEQGSQFMLSKRSRLEAIQWLQQTLSISERSKQTGILQLTFEGED
KTQIKAILDDISQNYFLQNVARQSAEAEKSLVFLQKNLPQIKATLNDSEDKLNRFRQQNESVDLGLEAQSALKVIVDLEA
QLNELTFKESDISQRFTKDHPSYKSLLDKRQTLLHERERLNQDIQKLPKTQREVLRMTRDVEVNQQIYIQLLNKVQELSI
MKASAVGNVRILDTAQVFMHPVKPKKSLIVVLATLLGGMLSVAVVLVKAAFHQGVESAEEIESIGLSVYTSVPKSDLQLS
FAKSSKKALRAKKPIESQGLLAKENPADLSIEALRGLRTSLHFAMMEAKNNIVMISGPAPGVGKSFIATNFAAVAATTGQ
KVLLIDADMRKGYLQKSFNLQWDNGLSDLLADKLSIQNAIKPSGIKGLEVITRGMVPPNPSELLMHQRFSKLLEWASEQY
DLVLVDTPPVLAVTDPSIVGAQAGTTLMVARFGQNSLKEIEIARDRFNKSGIEVKGVILNAIEKKASNGYGYYQYSYE
>gnl|bykdb|A0A084XWT8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Candidatus Accumulibacter sp. SK-01] (length=751 residues).
MDNDQSRPAASAKTVPGMNAAATQALPQISSEEAEEGLALGEIIAVLIDYRWLIATISLLAVAIGLAWLLVVKPVYRADG
LLQVEEKSSGVGSLKALQPLLGDDTTVSAEIEILSSRMVLGRVVAKLKLDIIAKPRTLPLLGSAVAKRYEGDEPNSPWLG
LSSFAWGGERIQVDSLDVPRVQLDQLHTLIAGEGGAFEVFDEDDQLVLKGKAGMRASNQDYAIFVADLKARPGTQFWLIK
LSAETAIDDLRRNYSVKERGKKSGVLELSLLGQDPAEIGLVLDDIQNTYVRQNVERRSAEAEKTLKFLETQLPALKTQLD
SAEAAYNNYRQSRGSLDLNLETQAILKSLVDVENAAVLLKQERDELRQHFKPEHPRIEAMDNKLQRLNERRKQFDAEVAR
LPDTQQTVLRLARDVEVSNRLYTELLNTAQQLRVSKAGTVGDVRVIDVAAVARKPVGAGPVAILSIALLLGLLISMLVIW
VLRSLRVVVEDPEIIESQLGLPVYATVPHSKAEVELHRHGRGGTGGLLAVVYPEEDAVESLRGLRTTLHFALLDAQRNSL
LITGSSPGLGKSFVSKNLGAVLAQLDKRVVIVDADLRRGHLHKEFDIERSPGLSEYVAGQASLEEILKPTVLPTLRVVAT
GQIPPNPSELLMHPRFEVLLAALAANFDTVIVDAPPVLAVSDAAIIGRHVGATLMIARAGKHPIRELEQAVKRLNQAGVQ
VKGFVFNDLNVSRQNYRYGYKGYVYRYSYKT
>gnl|bykdb|A0A084ZLB1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Trabulsiella guamensis ATCC 49490] (length=720 residues).
MTEKVKHAAPQASGNDEIDIGRLIGTIIEAKWWVLGTTALFGLAAVVYTLFATPIYSADALVQIEQNAGSSLVQDINSAL
NSKPPASEAEIQLIRSRLVLGKTVDDLNLDISVTKNTFPIFGAGWDRLMGRQNDTVHVETFTLPAGMKEQVFTLEVLGPK
QYLLTSDGGFSARGEVGQPLSKAGVTLLVSSINAETGGEFTVTKFSTLGMINNLQNNLTVTETGKDTGVLSLNFVGEDRE
QIRTILDSITRNYLEQNVERKSEEAGKSLAFLARQLPEVRSHLDVAENKLNAYRQEKDSVDLPLEAKSVLDSMVNIDAQL
NELTFKEAEISKLYTKRHPAYRTLLEKRQALEEEKANLNQRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKIQE
ASTVGDVRIVDHAITQPGVLKPKKALIILGGLILGLMLSIVGVLLRALLNRGIESPQALEEQGISVYASIPLSEWQKSHD
SVKTIRGVKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAKNNVLMLTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTTNVNGLSEILVGKADIVGCAKKTAINNFDLVPRGQVPPNPSELLMSERFAELVKWASSNYDLVL
IDTPPILAVTDAAVVGRLAGTTLMVARYAVNTLKEVETSLGRFEQNGIEVRGVILNSIFRRATGYQDYGYYEYEYKSDNK
>gnl|bykdb|A0A085A514 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Trabulsiella guamensis ATCC 49490] (length=726 residues).
MSTKNLHPQTTPAGDNEIDLVRLFFELLDHWKLITGVTLLFTLCALTYALFATPVYQADALVQVEQKQGNALLDSLSQDF
PGTSPDSAPEIELLQSRMILGKTIDDLSLRNVVAQRYFPLVGRGWARLTGEIPGRLALSGMSIPRREGRAQRIMLTVEDS
AHYRLEGADFSATGVVGELLVQGDLALNVSEIQAAPGTEFMLTQLTELEAINALQRRFAVKERGKDSGMLGLTINGDDPD
NIVRILNSIASNYLQQNIARQAAQDSKSLEFLQAQLPQVRSELDQAENKLNAYRKQQDSVDLNLEAKSVLEQIVNVDNQL
NELTFREAEISQLYKKDHPTYRALLEKRQTLEQEKIRLNKRVSAMPQTQQEVLRLSRDVESGRVVYLQLLNRQQELSIAR
SSAIGHVRIIDPAMAQPEPIQPKKALIVILGLMLGLFFSMGLVLLRTLLRRGIESPEQLEEQGINVYATVPLSEWLAKKA
QVRRKHFFSSRLRHHTRNVPFLPVDNPIDLSVEAIRGLRTSLHFAMMETANNVLMISGATPDSGKTFVSTALAAVIAQSE
LNVLFIDGDMRRGYVHDMFGIENEVGLSEVLSGQADMTGAVQRFHKGGFDVITRGQTPPNPAELLMRARFRQLMIWADEH
YDMVIIDTPPILVVTDAAIIGRSAGTSLVVARFGLNSVKEISLCVQRLEQSGINIKGAILNGVIRRASDYYGYGYNQYGY
QYTDKN
>gnl|bykdb|A0A085ETZ4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Devosia sp. LC5] (length=716 residues).
MHEQEFGLRNILGTIRRQLGLILAILILVLGVSALLIISLTPMYRATTLVLVDPSEKNLLNPTNSSSSSASDNARVESEV
SIAKSEKTVELVLDALRLTDDPSFQPQPGLRERVATLLRIAPPETYTAEELRQVAIGKLQDAITVERQGTTYLITISAYA
NAPAKAANIANMMAEKYIQSQLQSKINGVLSGRNVMEQRVTETRTGLVAAERSFNDFIISSARTIAEQSGRTDIDQMRIE
LEKIVSDREAASTTLALAETGLSQSNWAQVADTLNTQTLRDLQQRERQIQEELAGVVDGSEQADALRVELVGVLDNFRTQ
ANAQLEQLRQEIAANRAVETDLQLQLRSNILTSNLPPEVLATMYELQQNAEIARTQYQQMLVRLRDIEAQAYLQLADSRI
VSEATPPSGAAFPNTRFLAMVAGILGLMLGLAAAFLREQFIGGIVSTDQLEGIVGPTLVTSLPNQKRLGRSQDGKPVKSL
TELIAAQPYSRFAEAVRRLMISTDQALRRVRGDDLSDAASIIMVTSANAGEGKTTAAVSLARSYAISGQSTILIDADLRR
PAVHKELGLEPSDALADYLASAGTPGDDIAPLMLTDGLSKAKFIIGSNIRGAAAGQVVSGERFAKLLNSASRLFDVVIVD
TPPVGALVDALYLAQHVDVIVNVVRFGITSQKEVRATLRELVEAKQDNAEVVALLNAEPQSQAETRRRFGSYYVQA
>gnl|bykdb|A0A085EUB3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Devosia sp. LC5] (length=765 residues).
MLERSQLPAMSDPHSSDRGLLDVDRLFSILRRQFRVLLLCLGLGLMLAVIYLMLAPKTYVASSQILLDKNLKESVSDIAP
STSAVDLESEVLNQIEVMRSSRIAAAVAEAENLMTDREFLNPPPSFTRRIRGMILGLLSPILGAPEADPDDMQASVEQAA
GALRANMFVERVGRSAVIRVGYEASSPELAQRIAAAYANVFVQDQLNADIDATRQAADWLQQRLTELGDNQRQATLAVEE
YRRQSGLSTSENENLSNQRLEALTAQLVTAQAESARVNALAVQLQATIDAGPSAAGASIALLSGSGVDDKTISDLRIRYA
SIQSRINEVSATYGEDHPQVSALKAENQALQAQIFAQLQGLNEQYQSQLTIAQRQESSLREAIETEGQLASQTNQAQVEL
TELQQRSTTLGVIYNSFLSRYEEAVQRQSFPIPSARIITTAQAPENASGPRTLFVAAGGTIFGLFLGLMFGTFNELRERT
FRIGDQVGNELGLRFLGYLPRLGPDARGASHGDQTKAALALHGMIKKQVEERRANRPTTAFVETLKSAKLVMRARGKPDR
SAVIGVVSVLPGEGKTTYSVALAEMLATDGERVLLIDADLRQAASSRLVAPGATSGLMDIGGTVSWRDVVLADPRSGLHI
LPALSTSGQSSDFLSSDGMHGLLEEARQSYDYVIIDLPPLGPVMDARAVLPWTDGFILVTEWGRTPRRLVRSLIEHEPEL
AEDIVGVVLNKVDFRKLAQYSDPGGAERYMGSYSRYYQVDATEKV
>gnl|bykdb|A0A085FZW1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Buttiauxella agrestis ATCC 33320] (length=712 residues).
MSELTSTINKSNTDIIDPKEFLGVIIDNKWKILIITALFTLVSIAYAILATPIYSASALVQVEESTGTSVLSKLSDIMPD
SKPESQTEIGLLKSRMVLGQTVDDLALDTVVEEKHFPFIGKGLARLLGHNDRKIAISRLNVPDTLMDEPFSLTVISPLTY
SIEIDGVLLYGKTGELIDKDSISLLVSEIAAPVGTTFSVTKLEKLTAINKLLENFSVTDMSKDSGLLQLSFKGPSAMLAT
QILDNISHNYLSQNVSRKSEEAAKSLAFLKEQLPLVRAKLDDAESLLNQFRQKNESVDLSLEAKSVLDNTVALDTQINEL
TFREAEISKLYTRDHPAYRTLIEKKTLLLKERDRLNTRISNMPKTQQEILSLTRDVQSGQEVYMLLLNKQQELSINKAST
VGNVRIIDNAVAEKKPIAPKKSLIVIISMVLGLFVSIAFCLIRKLLHNGIESSEQIESLGLNVYATVPVSGWLKEKNQKL
AKSKRKTIRSINLLAKDNPTDLSVESIRSLRTSLHFAMMQAENNILLISGATPEAGKTFVSCNLAAVIAQSDKKVLLIDA
DLRKGQVHHVIGCSEKDGLSDVLIGSKNPLGVVKKTEIENLDFISRGKIPPNPSELLMNANFKHLMVWAGSQYDIVIIDT
PPVLAVSDACIAAKYAGTIMLVARFQKNTLKEMEVSAKRFAQNNLAINGVIFNGVEKRASNYYEYGSYKSYE
>gnl|bykdb|A0A085G6E7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Ewingella americana ATCC 33852] (length=715 residues).
MLAKGESHQDVHEDNEIDLRYLLGVLIDAKKMLIGIVLTCSLLGSIFIWNIPAVYKADALIQLDKSASGSLLNGIFDFAN
GNTSPATTEITLIKSRSILGNTVSALALDNLVRENKWPLIGGLFPQATSRLKVPLFTVSDKMLGKSFTLTLMGSDRFSLK
GEGISAEGVVGRELTLPELRILVHNIDAPEGTIFIIKKISQFAAMEQINKNLTVAETSKDSGVLRLSLLGHDRVLIRQIL
DKLSVDYLKQNIDRKSESASKSLDFLQKQLPEIESRLEKSEASLSQYRRLNESIDLPLEARGILEAEVAVTTQLNGLRFE
EAELSKRYTSAHPIYRALDEKRKTLLANKAALELKINAMPKTQQNILRLTRDVQTAQEMHSLLISKQREMEIKKVSTVGN
VHIIDPAQTLPSPVGPNKPLMLVLMLLCSSFLALGVVLLRNALKRSISSSHELEKLGLKVFCSLPHSKYQSNTKRFSIKK
DLPRKQSLLALQKPDDLAIEAIRSLRTGLYFLLKEANNKILMVVGPTSGVGKSFVISNLAVVLVQSNLRVLLVDCDMRKG
CLHQDFKLKQHHGLSELLAGKKKIEDCLYKTGLANLDLIPRGIAPSNPSELLLTPHFAELCGWATKNYDVVLFDTPPILA
VSDAAIVSKYAGTSLMVARFEVTSSKEIELAMQRFEQQGHRISGVVLNSVERRVAQYFQHGHFENYQYQSDANLA
>gnl|bykdb|A0A085G9X4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Buttiauxella agrestis ATCC 33320] (length=722 residues).
MTEKSRRPSAPTEGNDEIDIGRLFGTVLEARWWVLGITAVFAILATVYAMFATPIYKADALVQIEQNAGNSLVNDISSAL
SNKPPASAAEMQLIQSRLVLGKTVDDLNLDIAVEKNSFWLLGAGWDRLQGRQNDTVVVDTFNLPAGQGKNIFTVEVTSPT
QYQLTSDNGFSAKGQVGQTLSKDGITMNVSAIKAQVGDTFTVTKYSTLGMINQLQGNLVVAENGKDTGVLSLSYTGEDRD
KIRDILDSITRNYLEQNVQRKSEEAAKSLKFLAEQLPEVRTRLDAAENKLNAYRQQQDSVDLSLEAKSVLDTMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRKTLEDEKARLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITE
ASTVGDVRIVDAAIAQPGMVKPQRALIILGSIILGLMLSIMGVLLRSLFNRGIESPAVLEEAGIGVYASIPLSEWQKSRD
NATVRGVKAAKRNKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQASNNVLMLTGVSPSIGKTFVCANLAAVISQTNKRV
LLIDCDMRKGYTHELLGTTNNNGLAEVLTGQAEITRCAQKTSVPNFDLIPRGVVPSNPSELLMSERFAELIAWASKNYDL
VLIDTPPILAVTDAAVVGRHAGTTLMVARYAVNTLKEVETSLSRFEQNGINVRGVILNSIFRRAAGYEDYGYYEYEYKSD
AK
>gnl|bykdb|A0A085JA85 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Tatumella ptyseos ATCC 33301] (length=721 residues).
MSSSLTNKPASPDNDEIDLGRLLGELIDHRKLIISITALFTVLAIVYALFATPVYQADALIQIEQKQGNALLSNLSQMLP
GSQPQSAPEIALLQSRMILGKTVDDLNLQAQVTQNYFPVFGRGWARLTGHQPGKVSVGRIYVAQQKGKVPTLTLTAEENG
NYRLTGGGYNLQGHIGQLLEAKGLSLLINDLQAAPGTEFTVNYISWLDAINNLQQSFSAADQGKDTGMLNLTLTGSDPEL
IQKTLRSISDNYLAQNIDLQAAQDSKSLQFLDQELPQVRAQLDSAEDKLSAYRKRSDSVDLNLQARSTLDQVVNVDNQLN
QLTFREAEVSQLFTKDHPTYKALLEKRKVLQQEKAKLNQQVSGMPATQQEVLRLSRNVESGQAVYMQLLNRQQELNIAKN
SAIGNVRIIDSAITEPKPVKPKKSLILLIGIVLGGVISVGLVLLRVFLRRGIESPEQLEELGINVYASVPVSEWMARQTP
KRSLKVKGKKQENTSFLAVDNPADLAIEAVRSLRTSLHFAMMEAGNNVLMISGASPNAGKTFVTTNLAAVIAQSGQKVLF
IDADMRKGYAHQIFHHSTEHGLSDILSGKSTVQQGIKPVAAAGFDFLSRGTNPPNPAELLMHSRFQQLIEWASQNYDLVL
VDTPPILAVTDAAIIGRYAGTTLLVARFEQNTAKEMEVSVRRFEQSGIEIKGCILNGVIKKASSYYGYGYSHYGYSYDDK
K
>gnl|bykdb|A0A085KA47 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingobium yanoikuyae] (length=714 residues).
MVSRIIELEQRQAGEEDRTTRFVESARGTWTVVRRHRVILFVTMALCVLAGVIYILLSTPDYRATASVEVEDVPAGAAGA
GAMQKPVSAADTESMMQTELEVLRSRALAEDVARDLALVGSPVFFQGMDARRPAQGQGSLTQRQVEHEQVIKLLRDNLQV
ELPGKSRVLRISFVSADPALSARVANSYADSLIRADLKRGFESGVQARRFLLGELDGARKDLERAERDLAVYASRTGAVP
AEAATDEDKKSDGKDAKPEAAPVPEGSTAARLAQLNAFRAQAVADRIAAQKRWESAKAASAETLPEVLGNGAMQQLMAER
AQARAALVEERQFRKDAHPEMREARARLAALDDQAESMANTIRASLRQEYEVAAHGEKQIASEIAALEGDARVERGRDMQ
MSMMSRSVETYRLLHDSLLQRYRDMASQAGFQAGRIQPLDRAAVPTTPFAPHAGQIMLVALLGGMLLGLLLIAARHMFDD
AVTSADTLAERVDLPLLGAVPTTGDQPSAPDIFAPIAASLQLASVAGLPRSILVTSAQEEEGKSLTVNALARALARLDKK
VLVIDADMRRPVQHSLFRVTATRGISEVLTGQGKVEDLILDSGVAGVSLLPCGAVPPNPAELLSTPALDALLGAVRDRYD
TVLIDAPPILGMSDAQLLAAKVQVTLLVVEWGRNHHGGLRVAVERLRRAGGSIVGAVLTKAHGRAYDYDYHRGG
>gnl|bykdb|A0A085P332 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQSSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDDK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHASPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGVKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A085T7X2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio cholerae] (length=737 residues).
MTGKQFTQEEVIDIRQYFNVLLNYKWRILLFSVMVTAITLLFVLSMRSEYTARATILIESTQAKAVSIEEVYGLDTKSQE
YYLTQIEILKSDTIAQEVIERLDLASDPEFDLSPESDASPSLKERLVEWMPFLQGFKQEETVADPDLEAYRQNRLILYKF
KRGMEISPIRKTQLVNIYYTAGDPKLAAKIANEIARVYMDSHLEAKLEVELKANTWLNTRMEELRTQLRESEAKLQAFLQ
AEGLVDVQGVEGLATQELEELTSQMNKARDRRVAAETLYQVANSYSKNDSDLTALSSIPEISNHPTIRDLKVAEVDAERK
VSEFSKRYGPKHPKLKSASAQLEAVRKNLRAELRQLLNGINNELQAAKQSERSLQTEFNQRKSEFQTLTVKNAKYSELKR
EVQTNRELFDLFLARQKETSASGDFNTTIARFTDQASAPLAPSKPNKKLIVLLAFVVSFGFACVVAFIADAMTDTFADIK
QVEKQLALSLLGVVPVVRKQRGKLDAKAYFDEKLRELTEAVRTIRTSYLLAHVNQDQHVVMLTSCLPGEGKTTSSLNLAL
SLAQMEKTLLIDCDLRKPAIAHRFGISGSQPGVTNLLNGTQSLEDCVYHDEQSGLDILTAGVYASNPLELLSSSKFSELL
ADLRTRYQRIVIDTPPCLAVSDSFMLAQYVDSVILVIDANHTRTPVVRDVVGKLTQQGSRIDGVILNRLNAKKASRYSGY
YHYQAYYGEETKSGAAK
>gnl|bykdb|A0A085USB1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae] (length=738 residues).
MTAMNRSSLDYYQDSRIDLATILRTLFDHKGLIFSIVGLFCLVGLAYAILAEPIYQANAMIQIEPKKIGIEGTPEVSNKP
MSVSQATTEIELIKSRAVLGKVVDDLKLNIVQRPDYFPMIGGYLSRTFKPERPGQFAEPWFGMGQYAWGGEKLDVFQLEV
PEDLLGEKLTLVAGKPGFFTLYDKDRNQILSGAVNQTVEGHGAKIQVATLNARPGTEFTVSKLRTLTAALNYQERLKITE
AGKDSGIIYLALQDPDPEKANKIVDEISRLYVRQNVERSSAEAAQRLDFLRSQLPAVRKQLEASEVALNNFQTSAKSVDL
SIETKGVLDQVVKLDSMLSELKMRRVELERLYTREHPNYRALMSQMSQLEAQKQGLLKKIETLPETQQELLRLTRDMQVT
SQTYTLMLNKSQEQDILRAGSIGNVRIIDNADANVEEPVKPMKKLIVLIATLLGVLVAVATVFVRQAFYRGVDNPEVIEN
IGMPVYASLPYSRQQERLEKNNQSRTANKESRLLSVSAPTELAVESLRSLRTSLHFAMLEARNNVLMISSPSPGAGKSFV
SSNLAVIIAQTGKRVLLIDADMRKGYLHKVFGLQPKHGLSDTLAARLKSSEVIHHTEVRNLDFISCGFAAPNPSELLMHD
NFNKMLTELSPLYDLVLVDTPPILAVTDATLVGRQAGTCLLVTRFGLTSVKEIEACKRRLGQNGVVIKGAIFNGVLRKAS
TADYDCAAYGYDYSPVRK
>gnl|bykdb|A0A085V439 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae] (length=736 residues).
MTAMNRSSLDYYQDSRIDLATILRTLFDHKRLIIAVVGLFALVGVAYAVLSTPIYQANAMIQIEPKKIGIEGTPEVSSKP
MSVSQATTEIELIKSRAVLGKVVEDLKLNIVEGPKYFPMIGAYLSRTFKPERENALAEPMFGLTSYAWGGEKIDVFQLEV
PDSLLGENLILVAGKPGTFSLYDKDRSLLLSGGVNQTVEGHGTKIQVATLNARPGTEFNVAKLRTLTGALIYQNRLKITE
AGKDSGIIYLSIEDPDPAKANMVLNEVSRLYVRQNVERSSAEAAQRLEFLRSQLPTVRRQLEDSEIALNAFQTSAKSVDL
SIETKGVLDQVVSLDSKLSELKLKRVEIERLYTHEHPTYRGLMNQMSQLEAQKQGLLKKIEALPVTQQELLRLTRDMQVT
SQTYTLMLNKSQEQDILRAGSIGNVRIIDNADANVEAPVKPMKKLIVLIAVLLGVLVAVAIVFIRQAFYRGVDNPEVIEN
IGMPVYASLPYSRQQERLEKNSQGRAKESKLLSVSAPTELAVESLRSLRTSLHFAMLEARNNVLMISSPSPGAGKSFVSS
NLAVIIAQTGKRVLLIDADMRKGYLHKIFGLQPKHGLSDTLAARLTSTEVINHTEVRNLDMMSCGFIAPNPSELLMHDNF
NKMLTELSPLYDLILVDTPPILAVTDATLVGRQAGTCLLVTRFGLTTVKEIEACKRRLGQNGVVIKGAIFNGVLRKASTA
DYDCAAYGYNYSPTRK
>gnl|bykdb|A0A085WUX9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Hyalangium minutum] (length=754 residues).
MEVGARCWAGLTPREKVSRSAMLEGSVNDPANAALTPLNVMRYVRAFWRRKWIVLGVAVLITGLTALHTTRKPKVYAAST
SLIIDVTAPRVLDTDVKELMGDERSNYWFNKEYYATQNQVITSRAVATRVAEKLGLQHDAAFLGLAHLQDEKARLQAMQL
ADAAGMLQARISVIPVKDSRVVNIAVEDLDPQRAALLANEVAQAYMAENLALRLRTTETATQWLEERKVELERASQASEL
ALYDFKKDADMLSVSPENKKSSVTERINSYEATLTQVRTKIAALQGRVEAIRQLQKSSQPGDETWAEAVPGASDSAIQEL
KRRYVEQRAVCVELSERYLAEHPKMLECNTKLAVVREDFVRSLANVVRKAETELAQAVAEEKNLMRLLAAAQDESFQFGK
RQIEFDRMNREAENNRRLYESVLRRLKDIELSGLLRTTNVRVLDAARPSYGPIKPDVQRSVMLAMLVGLLAGCAVVVLLE
ILENTVATQADVEERLGLAFLGFVPRVEGKGESPKDRDLFVHRQPKSSVAECCRAIRTNLLFMSPDKPFKTLVVTSSGPQ
EGKSTSCIFLGVAMAQSGNRVLLLDTDMRRPRLHKAFGVPNDVGISSLVVGEGSLDKAVKSTEVPNLFVLPCGPIPPNPA
ELLHTQAFADLLKAAGEKFDRIILDSPPLNAVSDSAVLATQADGVVLVLRAGKTNRDAAARALRSLADVQAQMYGAVLND
LDVTDSRYRDTYMSYRGYYGHYAAEESKDGAASS
>gnl|bykdb|A0A086D8I5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Gammaproteobacteria bacterium MFB021] (length=745 residues).
MTHASNAQSGTQTSTPSASAPRSHEEIDIRRLFGILVDHKKWVLASVAAFAMLGLIYVSVATPIYRADALVQIESSSPGS
NPLKEVSTLLGQEPPTLSEIEIIQSRMVLGRAVDLLNLDISVAPVTLPVIGGLLERQHVSRPGFAAGWHYAFSGESIAVS
EMPVADAYEGQPFRLQVLDSYRYRLFDADGNDLGEGKLGELSNFADGGVALRVTSIDAGAGATFELRHGSRLAAINALRG
RLTVAEAGSETGILSWSLTGPDPQETEKTLNTIANIYYSQNVQRQSEEARKSLEFLDGQVPKIRAQVDRAEEKLNRYRES
QDSVDLSLETKSVLDRLVNLEAQLNELEMNEAEIAQRFTKSHPTYQALLEKKAQLQRERANLDKQIKAMPKTQQEILRLK
RDAEVNNEIYVQLLNKVQETRIAEASTVGNVRVLDSAQVLATPVAPNKPLLLAVAVIVGLIVGVAGVFLRALFHRGIETQ
EQIEETGLAVYATVPLSDEQRKLNRREQRGRRGTRRDPRYPQGLLSLRNPADVTVEALRGLRTSLHFAMLEASDNRLMIT
GPSPGVGKSFVSVNLAAVCAQAGQRVLVIDADMRKGQVHSVFGATSESGLSDVLGGRLTLDEAIRDVDECEGLHYVARGM
APPNPSELLMGSRFSAFLAAASERFDLVIVDSPPVLAVTDAAIIGKQVGTSLMLVRFERNPVKELELAIARLRTAGVEPR
GAILNAVERKAATAYGYGYYHYNYQ
>gnl|bykdb|A0A086EA11 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pectobacterium carotovorum subsp. brasiliense] (length=724 residues).
MAEKTSVKVSETNSDEIDLGRLLGTLLDNRWLIIGVTAVFTVLGIMYAMLATPVYKADALIQVEQNSGNSLLNDISSMLP
DAKPQSAAEIELIKSRMVIGKTVNDLALDINVQQKYFPLVGKGIARLAGNEQGKIAVSRLDVPASWQDETLSLEVLPNQQ
YTVEAGDTVKFTGTIGQLENHNGITLLVSDIVAEPGTVFRIKKLNQLTAINRLLDNFSVADKGKDTGVLALSLEGDDPTL
TTKILSSISQNYLQQNVERKSEEAGKSLEFLKEQLPNVRSSLNDAENKLNQFRQQNESVDLSLEAKAVLDTTVAVEAQLN
ELTFKEAEISKLYTREHPAYRALMEKRKTLEQERDKLNKRIGAMPKTQQEILRFTRDVQAGQEVYMQLLNKQQELSINKA
STVGNVRIVDNAVIQPKPVKPKKALIVLLAMILGGMASTAFVILKTLLHKGIESPEQLEELGINVYASVPLSEWQQKKDR
ALLGNKNKKSNTRATDLLAVGNPADLAIEAIRSLRTSLHFAMMEAKNNVLMISGASPAIGKTFVSANLGAVIAQSGQRVL
IVDCDMRKGYAHELMGTDGTNGLSDILSGQCDVTKSVRKTAVENMDFIPRGQVPPNPSELLMHSRFAEFIKWAGEHYDLV
LLDTPPILAVTDAAIISRNAGTSLLVARFEVNTLKEIEVSIRRFEQNGTEIKGVILNAIVKRAASYYGYGNYNYYAYDYK
SEGK
>gnl|bykdb|A0A086G3T0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Serratia nematodiphila DZ0503SBS1] (length=724 residues).
MIDKNRTSSLASKENDEIDFGRLLGTLVDHKWLIVSITSLFAVIGIIYSLFATPIYQADATVQVEQNEGNMLVSNLSQML
PNSLPASSTEIELISSRMIVGKTVEDLHLDTVVTQKYFPIFGRGWARLMGNKPGQVALSRLTVAEPLVESAIELEVIDDQ
NYVVTVDKDKIFQGKVGRLENASGVSMLVSEISAKPGTVFNVKKLTTLAATVQLLDDLTVEDKGKDTGVLSLTLMGDDPV
LIKRIIESISNNYLIQNVERKSEEAAKSLAFLKEQLPQVRDSLNTAEDKLNSFRQANDSVDLSLEAKSVLDTIVGVEAQL
NELTFKESEISKLYTKEHPAYRALLEKRATLQKEKDKLNQRVSKMPQTQQEILRLTRDVDAGKEIYMQLLNRQQELSITK
ASTVGNVRIIDTAVTQPKPVKPKKTLIVIIFTLLGGIASVAVVLLKSVLHRGIESPEQLEDQGINVYASIPLSEWQQKKD
IETLMRGNKKTNTRSKTLLAVGNPADLAIEAVRSLRTSLHFAMLEAKNNVLMVCGASPNIGKTFVSINLAAVIAQAGQRV
LVIDADMRKGYSHSLLNTDWHNGLSDILSAQTTMANSVRKTEIENLDFIPRGQIPPNPSELLMGARFNELIDWASKNYDI
VMIDTPPILAVTDAAIIGHRAGTSLMIARFASNTVKEIEVSIRRFNQNGIDVKGVILNAVEKRASSYYGDYGYYQYEYRS
NDKA
>gnl|bykdb|A0A086GDJ7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Serratia nematodiphila DZ0503SBS1] (length=726 residues).
MKNNALSVMVAEQDEKLEWERLVGPLWDNRWRIAVVTGVAGALGVAYALLATPVYQATAVVQVENQLSGDSLLRETLDSS
LGQNSATQDEVTLVKSRYVLGKTVDALGLTVRVEPDYFPVFGKGFARLSGEKAPVLDIATLTTPADMQGEALTLTVRDGQ
HYELSHDGAKLFSGVVGQPVAQGEWGMTVSALDAAPGTSFTVVKVARQEAVDDLRKYLGVVPSGKDSGIMTFTLPSEDPQ
RAEAVLKNITDNYLQQNVDRKTEEAQRMLAFLQEQLPQTQTSLNNAETQLNQFRQQNDSVDLSLEAKSVLDTQVQLEAQL
NELTFKEAEISKLYTRVHPAYRALLEKRATLEAEKARLGKQVQTLPKMQQEILRLTRDVQVDQQVYMQLMNKQQELSISK
AGTVGNIRIVDEAETAIRPIQPQKMLIVLLALILGAAGTAAVVLLRTAFHRGINDIDTLEKRGINVYATVPLSPWQAKRN
REQRLLLPKSGGRRLPILAVAEPADLSVEAIRSLRTSLHFAMLEAKNNILMVSGASPESGKSFTSTNLAVVVAQAGQRVL
LIDADMRKGFLHRWLSDDAHQGLSDMLVGKVTTEQAVRKTAIANLDFVPRGQVPPNPSELLMHRRFADFLRWAGQNYDLV
LIDTPPILAVTDAAIVGNHAGTSLLVVRFEVNTVKQIETSMRRFEQNGVAIRGVILNGIVKRAATDMSYYNFAYPSHRED
HRQAEE
>gnl|bykdb|A0A086P863 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingobium herbicidovorans] (length=702 residues).
MAERSIRIDSGPSPIGMEGRASRIVTTARASWTAIWRHRLILFVTMALCVLAGIIFILLSTPDYRATASVEVEDVPAGAA
GAGAAQRQMTAADNESLMQTELEVLRSRALAEDVARELALVGSRTFFDGMDERRPDRGVGSLNQRQVETEAVIGLLRDNL
DVELPGKSRVIRISFTSADPVLSARVANSYADSLIRADLKRGFESGVQARRFLLGELDGARRDLERAERDLATYAAQAGA
SLGGPVAGRGGNSPDGTTATRLAQLNAFRAQAIADRIAAQKRWESARLSSVETLPEVLNNGGMQQLMAQRAQARAAVVEE
RQFRKDAHPEMREARARLAALDDQAETMANTIRASLREQYEVAVHGEKQIDAEIAGLEGQAQAERGRGVQMSILERSVDT
YRLLHDSLLQRYRDMASQAGFQAGRIQPLDRAAVPTRPSSPRIGITMLLASFGGLVLGLLMVAGRHVFDDAVTSADTLAE
RANLPLLGTVPVTDKPAAETFVPIASSLLLASSDGLPGSILVTSAQEGEGKSSTVHALALALAKLDRRVLVIDADMRRPK
QHGLFQLAPERGISEVMTGQAKAEDVIVDSGTPGVSLLPSGAIPPNPAELLSTSALDVLLASVQGRYDTILIDAPPILGV
PDASLLASKAQAAVLVVEWGRNHHGGLRVAVDRLRRAGGAIIGAVLTKQQGRAFEYDYHRGD
>gnl|bykdb|A0A086W7H9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Massilia sp. BSC265] (length=758 residues).
MSNPADAHPLTHISHSPPVLSVPFDPRPPEPLPEETTVDLKGYFNTLYDSRWLIGSITAFITVVAVLYALVAKPVYEANL
MIHVEEESPNASKNILSEASSLFETKKAAIAEMELLRSRMVVSRAVDNLQLYIEVQPKYFPVAGFWFANQNAGNLSTPGL
FGYGGYVWGGEKADVSVFEVPDSWLNREFVLTARAGNRYRFSGGGQRLAFDGTVGQRYRVPLPDGMLEIKVDNLYANPGA
RFRIKRKSRLSTIQDIQRAMVITEQGKQSGVIEVKLQGENSARINNLLSEIGREYMRQNLARKTEEAEKSLAFLNQQLPI
LKRQLEQSEDRYNQFRNAHGTVDLREEARMSLAQAAAARTRRMELIQKKTELLSRFTEDHPVVVAINRQRKEVDTEIEAI
ASRIRTLPVMEQDEARLTRDIKVNTDLYTALSNTAQQLRLISVGRVSNVRLVDAPIAPEKPIKPNRPLIVAMAVVTGLFL
GTLIAFTRKAMRGGIDDPQKIERMLRARVVYASIPHSTNQDKLMRKSKPNGVLPLLAQILPEDPAVESLRSFRAALQFSM
PHFKSNVVMMAGPTRDLGKSFIAANFAAVMAASGKRVLLIDADMRNGHLHRYFGVDRGKGLSRAIAGGATVDEVIHRNVL
DRLDFIPTGELPTNRAEFLLHLNFGTLLETVSPQYDLVLIDPPPLLAVADALIIGAHAGAVFLVTRSAVTTEGQINESIK
RLNHAGISPRGVLFNDMALRLGDYRSQYGGGPQLAYVA
>gnl|bykdb|A0A086WST6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio sp. B183] (length=734 residues).
MENTQNSPVSKEELIDIRQYFKVLLNYKWRIIIFSILVTALAILVVLSLPSKYTARATLLIESKQANIISIEEFYGLDTK
SQEYYLTQIEILKSDRVSEEVIRRLNLTSHPEFDPRAQEESNVSLKDRLMEWFPVLQAFRKSLPNEELEQSDYARNKLVL
YKFKRGLAINPIRKTQLVQISYTSRDPELSAQIANEIGRVFMDSNIEAKIEVTQQASSWLNERIGDLREKLRQSEAQLQA
FLQQEGLVDIQGVESLASQELAELTSQLNKARDRRVAAETLYQVARNYKSDSNQLSALASVPEISNHPTIRDVKVAEVQA
ERKVSELSKRYGPKHPKLKAAIAELESVKKNLRSELNQLLNGINNELKAARQAEQTIRGELEKRKVEFQALTVKNARYSE
LKREVQTNRELFDLFLSRQKETNASSDFNANIARFTDYASPPLAPSKPNRKMIVILAFLASLSFGCVMAFVADAVNDTFT
DIKQVSKQLSLEILGIVPALKTKRPLDGKAYFDERNRQLTEAVRTVRTGYLLANSNKSNSVVMVTSSQPDEGKTTSALNL
ALSLAQMEKTLLIDCDLRKPTVARRFGLPSAQPGVTNILTKTHAIEDCIYHDEESELDILAAGTYTNNPLELISSTGFGD
FVEQLRTKYDRIIIDTPPCLAVSDAFMLSRYVDSAVIVINASHTRTKTVRDVVGKLAQQGTRIDGVILNKLNVKKASAYS
GYKQYQSYYGVENA
>gnl|bykdb|A0A087IP26 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio vulnificus] (length=727 residues).
MNETMTTPQNRSSVDNSSDEIDLGKLLGILLDAKWIILVTTFFFAVGGVAVALLSTPIYKADALLQIEEKSKGGIGSLVG
GDMGELFSQESSATTEIEIIKSRMILGDTVDKFNLTTVAEPKYLPVIGKGLARIAGKVNQIEVSRYTVPEYVQEIKHTLV
VLDAEKKTYQLVRGDEQMVLQGVAGELAKKDGYELFVTELRSYDEQEFSLSQQSRLEAIEWLKKNLAISERGKQTGILML
SFEGENRKQISEILNHISQTYFLQNVERNSAEAEKSLTFLKGHLPDIKTSLTTAEDTLNRFRQDNESIDLGLEAKSTLDV
MVKLEAQLNELTFKESEISQRFTKDHPAYRSLLDKRETLLKERERLNQQVQKLPKTQREVLRMTRDVEVNQQIYIQLLNK
VQELSIIKAGTVGNVRILDEAQSYAKPVKPKKPLIVVLATLLGGMLSVALVLVKAAFHRGVENPDEIEQIGLSVYASVPK
SNLQLELANKLARKKRNTDLTLLAESNPADLSIEALRGLRTSLHFAMMEAKNNVLMISGPAPGIGKSFVSTNFAAVAAKT
GQKVLLIDADMRKGYLQQCFGLNWENGLSDLLSGKVTRDVAVQSAKVENLDIITRGQVPPNPSELLMHPRFKELVDWASE
NYDLVIIDTPPVLAVTDPSIVGAIAGTTLMVARFGQNTVKEIEVARNRFEQAGIEVKGVILNAIEKKASSSYGYGYYNYS
YGESNKA
>gnl|bykdb|A0A087IRN0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio vulnificus] (length=739 residues).
MNRASSRVNGYTAMNENQTNRYYIGNKELFQFGSYLKVLRKHWFSIVTLSLVITLAATWFIYSKPSIYQATATILIQEEQ
RNALSIEEVYGLDTTKKEYFQTQIAILQSNHIADKIIQQFDLTNHPHFTGSSSLKTKLNELKSVPLIQDLLNVSPNPTET
NEYHSSYYEALQSYKNRVDIDPIRNTQLVKVSFRSADPKLAAEIANAIGQAYIDSNFEAKLAVTQNATNWLDSNARQLED
KLHKSEQALQQFLTTEGLVDINGIDDIYANELEELSKKLNIAIEKRIQAQTLSDLLLRKSAQNLDSLLSIDEFANQAQIR
ELKMLESNAEKLVGELSQRYGPKHDKMIQAKAQLQNIQARSQQLIMEMVLSKQQDLKVAQSFENSIRREMSNKKAEIQLV
GGKKAEYEKLKRDVESNRELLKAFVNREKETTATSDFRNVNARFTDKALEPLFPIAPQRLKLVIICAVFALFFSSAAAII
LDMIKDVIRTPEDVENKLGLSCIGTLPYVRSRKLRKPGVSFQAYLDPQNRVFSEACRSIRTSLLLRLVNSKQKVLVFTSA
IPEEGKTATCINIASTFSNLERVLLIDCDLRRPSLEKRFNIPAQVPGLSNILTMNTPLEECIVRIEEANLDVLTAGLLPP
NPQELLSSKRFQNLLNTLQEKYDRIIIDTPPLLSVSDALILGQLAQGLITVIRSDSTKVALAKTALSKQRQHDIPSFGVV
ISQATTPQEEAHYVQKYAY
>gnl|bykdb|A0A087L6M6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Serratia sp. Ag1] (length=724 residues).
MLEKNRINISRSEKNDEVDLKRLFGEVLDNRWLIIAVTSVFLTLGVLYSLLATPIYRADALVQVEQNSGNSLLKNINQML
PNGQPDSAPEIELLKSRMILSKTVEDLNLDTVIEQKYFPVFGKIFVRLTKEPAGKIAISRLVLPDEWGDDPTIEVIINDG
KHFSVNRDEAIFAEGIIGTLLRKGDFSILISDVNAKAGTSFFVTKVPELKVINSILDVFNVQDKGKNTGVLGLSYTGSDP
ILNQKILNSITNNYLAQNVERKSEEDARSLEFLRGQLPKVRNSLDASENLLNKYRQQNDSVDLSLEAKSVLDSIVSVDAQ
LNELTFKEAEISKLYTVEHPSYRALLEKKKVLEDERDKLNKRVSSMPKTQQEILRLSRDVQSGQEIYMQLLAKEQELSIS
KASTVGNVRIIDQAVTQDIPVQPKKVIIISLSLILGVMLSIGYVLIRSFLYNGIESPEQLEELGINVYASVPLSEWQRKQ
DLTLANKRKTKKTTPNDTSLLLTYGNPADLAVEAIRSLRTSLHFAMMEAKNNILMISGASPGIGKTFISANLAAVIAQSG
LKVLFMDCDMRKGYAHELLGGDSRYGLSDVLSGKLNAQSAIQKTKYDNFDFIARGQNPPNPSELLMHNRFTELLEYVGEE
YDIVLVDTPPILAVTDAAIIGKLAGTALMVARFEINSPKEVDVSIKRFEQNGVDIKGVILNAVLRKSSNYFGYGYYHYEY
KSGA
>gnl|bykdb|A0A087NGB6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingobium sp. ba1] (length=697 residues).
MMTPILTERDLDATPGHGRAARMTAAARRGWLVLRRHRVILFVTMALCLLAAVLAILMSTPDYRATASVEVEDVPAGAAG
AGTTPRAATDNIEAMMQTELEVLRSRALAEAVAQDLALVGTPTFLKGMGHRRPTGGTGSLSQRQVEQEQVVALLRDNLEV
ELPGKSRVLRISFVSADPVLSARVANSYADNLIRADLKRGFESGVQARRFLLGELDGARRDLSRAERELAVYAARMGMEP
GKDAPPSEDSIATRLAQLNAFRAQALADRIAAQKTWEGARRASVETLPEVLNNGAMQTLMAERAQARAALVEERQFRKDA
HPEMREARARLAALDDQAQEMANRIRASLKERYDVAVHGETQITAEIADLERQGQAAQGRDVQLGIYERSVDTYRMLHDS
LLQRYRDMASQAGFQAGRIQPLDRAAVPTKPFSPRIGVTLLLAAIGGISLGLLLVAARHIFDDAVTSADTLAERVGLPLL
GSVPVTGDNPQPPEIFAPIASSLLLASAAGLPRSILVTSAQEGEGKSLTLHALALALGRMGKRVLVIDGDMRRPVQHSLF
RITPVRGISEVLTGQANAQEAIIDSGVQGVFLLPCGAVPPNPAELLATPALDALLDSVRDAYDTVLIDAPPILGLGDTPL
LAARVQASLLVVEWGRNHHGGLRAAVERLRQAGGTLIGAILTKQQGRMMEYDYHRGG
>gnl|bykdb|A0A087NJH2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia pyrrocinia] (length=741 residues).
MVNTQAKHSYADLSVKTEEEDVVLGQLLQVIMDDIWLLLGIAVTVVALAGLYCYIAKPVYQADVHVRVESNDNTSQALTQ
TQTGATINSGPQQAQTDAEIEIIKSRGVVAPVVEQFKLNFSVVPKTLPVIGSLAARVATPGTPARPWLGLKSYAWGGEVA
DVDSISVVPALEGKKLTLTAGPNDTYSIVDQNGTRLLSGQVGESAQGGGVTLLVKKLVARPGTQFTVVRYNDLDAIGGFQ
AGIQVSEQGKQTGVVQISLEGKDPDQTAAIANALAQSYLNQHVVAKQAEATKMLDFLKGEEPRLKADLEHAEAALTQYQR
TSGSINASEEAKVYLEGSVQYEQQIAAQRLQLASLAQRFTDSHPMVIAAKQQLSELQGEKDKFSNRFRSLPATEVKAVQL
QRDAKVAEDIYVLLLNRVQELSVQKAGTGGNIHLVDSALRPGDPVKPKKVLILSAAVFLGMILGTGIVFLRRNLFQGIED
PDRIERAFNLPLYGLVPQSAEQVKLDAAAEKGGGRARPILASLRPKDLSVESLRSLRTAMQFAMMDAKNRVIVLTGPTPG
IGKSFLTVNLAVLLAHSGKRVLLIDADMRRGLLDRYFGLTAQPGLSELLSDQSPLEDAVRETPVQGLSFIAAGTRPPNPS
ELLMSTRLPQYLEGLSKRYDVVLIDSPPVLAVTDATIIGRMAGSTFLVLRSGMHTEGEIADAIKRLRTAGVDLEGGIFNG
VPPKARGYGRGYAAVHEYLSA
>gnl|bykdb|A0A087NJT0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia pyrrocinia] (length=743 residues).
MTDLSDARLYDAALYDDAPLSSYVDIVLARWRMVLGIAAGVFLLGLLYVVFATPVYRVDATIQVNESTTAGNSPLHDIAA
LLDNGSTTAAELELVRARMVIDSVVTKQHLNLIAEPRYVPLIGRWVARRYRDDGVARPLWGLSRFAWGGERFDVVTFETA
GKKSHDGIDALDGLWFDVTAEGGGRYVVRDEDGDVVLKGEVGVPAHGQYKAQPLTLLVAALDARPGTAFRLRRIPQLEAV
SQLQDDLTVEEKAKQSGILTVTLEGDDRTRIRDILRAVVDGYVQQNKEYRSEEAAATLASLKSSMPTVMKALKDAEDKYA
AFRARTGTVDLDEQGKLLLGQEVDIETRTLELKQKRVDLIARFADGHPAVQALDANLAELAGKAKELKALEARLPDTERE
GLGVLRDVRVNTELYTNLLNTGQQLEIARRSEIGNVRAVDLPVLPVKPVKPRRLLLVALSLCVGIALGIAAPFAQRAVWG
RVEHSEHLEQALGVPVYAVVPHSREQRRLVRNQQHAGRGAHVLASEIPEDVTVDAIRSLRTTLQFTMSESGHNVIMVTSP
QPSAGKSFLCANLASLFASGGKRVLLIDADIRRGQSHCHFGLPAAPGLPDAIASGTLERGVQKSAVAGVDVLARGAVART
SELFNDGRFKMLLDTAARLYDIVIVDTAPILALHDAATIGRHGATTLLCVRHGRSSMPEIREAERRLRNAGIAISGVVLN
DVPRRQAVYGAYGEGKYAYETEH
>gnl|bykdb|A0A087NLQ6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia pyrrocinia] (length=745 residues).
MTEQSAPPQQTAEDGSETDFVAVLDILLESRWLIATITCVFLVAGLAYAILGKPVFEANIMVQVEDSPDTSAAKSLLGDV
SALFDVKSSAAAEQQILASRLVVERAVDKLKLFIDASPKRFPLIGDWIARHGDGLSDPGLAGFGGYAWGRERIDVTLFDV
PRKNEGDTFTLTSLGGKRYRLEGGDLDAAVDGTVGTLEHFRSPRGPIALRVDAIVAKPGAAFVLVRNSRLKTIEDIRDRL
NVQERVKQSDVVVASLQDTDPKWVSDTMNEIGRQYVRQNIERKSAEAAQSLEFLTAQLPQLKQQLTESEARLTKLRNEHG
TVDLTEEAKLALAQTADAKTRLLELQQKRQELLSRFTERHPSVAVIDEQIAALSGYRNTAELQIRRLPDLQQETVRLMLD
VKVNTDLYTALLNNMQQLQLVQAGKVGNVRLVDTAAVPEVAVRPKKALVALASLLLGLLAGCGTAIVRSMLFHGISDHNE
IERRLGLAVYATVPISDHQRDLAEEAARKSGHKSILSIDFPNEPAVECLRSLRTALQFAMLEAKNNVVLIAGPAPGVGKT
FISSNLAVVMASAGKRVLLIDGDIRKGRLHDYLGFPRGRGFTELIAGGARVEDVMHREVVDGLDFISTGTMPKNPAELLL
NRNLAPLLGDLSSRYDIVIVDSAPVLAVPDSGILGAFAGTALLVALAGKTKLGEIGESAKRFAQNGVRLNGVIFNGVNPR
LGQYGYGSKYGGYRYVAYEYGMHDA
>gnl|bykdb|A0A087NT61 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia pyrrocinia] (length=749 residues).
MNASNPRQPHLHDADELDVRGILDVLIRHAGRIVAVTAACAALGAGYAFVVKPVYKADIAVQVESGGSDLRSMADGGLVG
GLGALFDVKSTDDGEMEILRSRLVTEPVVDGQRLHIEAHPRRVPVIGSAVARFNRRLSTPGLFGIGGFVWGNERIDVPAF
DVPRDFQKHTFIVTSLGDGRYRLSGSDLDRDAEGAIGEPLRVKTAAGDVTLQVAGIEAEAGAQFVVKADSRQVVLAELQK
KLTIANRGKDQSGVIGVSYESHDPVRAAAVLNAIADNYVQQNASRKAATAEKSLAFLSDQVPAVERQLRAAEDRLNEYQA
RHEIVDLTEQAKAMLTQSTAAQMSLFELEQKRRALASTLTPAHPELAAVDRQIAAANAQIGTINDTIRRLPDAQQNVVRL
RRDVTVQTEIYVGLLNSVQQLRLATASKIGNVRVIDRAIVPDKPVRPRPALVTVMAALIGLVLGTCAVIGRAVLFGGVTD
PAEIERDTNLNVMATIPHSVAQHRLAQRDAAAGGATVLALARPNEPAVEALRSLCTALRFQLMDQPDGNRVLITGPSAGV
GKSFVSGNVAALLGQSNKRVLLIDGDLRRGKLAKRFGLRPEIGLSTVLRGGATAADAIVRDVAPNVDLLPAGPYADRPVE
LLSSDRLSALLMHVARDYDVVLLDAPPLLPVTDAVVLAAQADTILLAARAGVTTSGELLEASKRIERVGARATAVVFNGF
RPGLRSARYGNYGAYGYDNADSQTAADRT
>gnl|bykdb|A0A087NWE2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia pyrrocinia] (length=756 residues).
MNTSSPPEREIDLIRVLDVLRNARWTIASIATACVAAGALVAFVAPPTYQADLMIQTDDATDAASKNLLGDAASFFNVGS
PASAEAQILSSRLVVTRAVEDLRSYIVAKPSRVPVIGAFVARFNDGAVPPGLFGFGGYAWGQERIDVARFDVPTRAEGDT
FHVVRLDATRYRLTGADMRADAVGTVGNPETFDTRYGPLHVEITGFDALPGTRFKLIRQSRAETIDTLRTALDVQEKVKQ
SGVLVTSLRGSDPAEISATLNAIANRYVEQNIARRSAEAAQSLTFLNGQLPIVKQQLERAETRYAALRSRTGSVDLAEEG
KLALQQGADLQTRALELQQKRDELSRRFLPTHPDMAALDAQLATLKRQQGALDGRIARLPAQQAEEVRAQLDVKVNTDLY
TALLNNIQQLELVQAGRTASVRVVDAAVAPADPVRPNRPVVIAAAALIGLALGVIAAFMREFLYGGLTAVDEIERHTSLP
VRAVLPAATRQRRLMRAVEQHDQGLHVLAYDDPYEPAIEGLRSLQTSLHFSLADIAHPLVLVSGPAPGTGKSFVSVNLAA
VHAASCRRVLLIDGDLRKGYLHQYFGLERGPGFAELLDGRADADDVVRRGVAPNLDFLPTGELPHAPTALLQHARAGTLL
ASLRARYDLVVVDSAPLLAATDATWLDMYANAALLVARAGSTRAGELVESAKRLPQRPDRLVGVVLNGLDPRSGASAFGS
KYGGYRYEAYRYTCETRCTHVARLRAVLQRLLRRSA
>gnl|bykdb|A0A087NZR2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia pyrrocinia] (length=755 residues).
MNSLTLPDPHDGPALRPSYPYRRYWTMLVGGRRLILCTALAGALAGAVYALCARPVYRTDILFQVEQSPTESKPNSPPGD
PSSVFDLKTDASTEIEVLKSRAVMARAVDDTNLAVDARPHYLPIVGWRFVNAADGLSSPLPGGYVYGTERIDVPTFDVPK
RFLGKRFALTVGNDGAYTLQRTGLLGRTGPVWQGRVGQPLHVETPQGPLDVFVRGVAGEPGARFDLTRYADEEATAWLQK
NALISERGKQSNMIGVTLDGTDPVHDSRVLNAVGDAYLAQNTQRKSAAADKLIRFMDAQLPQLKAQLEQAESRFNAFRAS
HGTVNTSDEGLALRQQSVDIETRVQTLQQRREELLTRFMPKHPAVVAVDAQLADAQHSLDTVRKQIQQLPTVEQGVLQLQ
RDVAVDTALYTNLLNTRQQMILARASKTGTVRIVDAAKVAETPTGPHRGMAVIASLILGLLAGAAVVIVRQRVAGTVGDV
EEIEWSTGLPVFAAVPHSPVSEPAVPPSKAARRRGARTPEPPGAPEGAALESLRNFRTALQLSMSDAPNRVVLISGPTTG
VGKSFVAANLASLVGAAKRRVLLIDADLRKGSLHERFRYSRAPGLADVVAGTHALDEAIKRDAAPGLDFMPMGNVVPDPG
ELLLQPALAELIERVASRYDMVVIDAPPLLPVADALVLGRLAGTVFLVARSGVTTLTELDESARRLEHAHIDVRGVILND
FKGSPGRYDYGYTDANTHQAASGYAGVMAARPPAR
>gnl|bykdb|A0A088MRI7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella pneumoniae] (length=722 residues).
MTSISKKKQPETVDDLDFGRMVGELIDHRKIIIALTSFATLIALLYAFFATPIYKADALIQVEQKQANAILSNLSQMLPD
SQPQSAPEIALIQSRMILGKTVDDLNLQAVVSPKYFPIFGRGWARLSGEHQGNIQLSRLYVSSSIGDEENPPEFTLKVKD
SNRYVIEFGGEEINGKVGELIEKDGITLKIDEINAKAGAEFTIKYVSKLKAIADLQENLSVADQGKDTGILILSYLGDDP
LKIKNIVDSISENYLAQNISRQAAQDEKSLEFLNKQLPMVRSDLDSAEDKLNDFRKRNDSVDLSLEAKSVLDQIVNVDNQ
LNELTFRESEISQLYTKEHPTYKALMEKRKTLQDERGKLNKRVATMPETQQEILRLSRDVESGRAVYMQLLNRQQELNIA
KSSAIGNVRIIDSAVTQHKPVKPKKIIVVLAGLFIGLVISVSLVLVRILLRKGIETPEQLEELGINVYASIPVSESNPKN
VIAKRLNKRDDSRPKVLLATENPADLAIEAIRGLRTSLHFAMLEARNNLLMISGASPNAGKTFVSSNLSSVISQTGKKVI
FIDADLRKGYTHKLFNIKNTNGLSDYLSGRVALDKIINNLQTEGFDYISRGSVPPNPAELLMHNRLAELLEWANKSYDIV
ILDTPPIRAVADAAIIGNYVGTTLLVARFEENTPKEIDISVKRFQNSGVNIKGCILNGVVKKASNKYGYGYNYYDYSYSD
KK
>gnl|bykdb|A0A088U0Z5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia cenocepacia] (length=736 residues).
MIDTTKNSVDAAHVEDVHLSDYLMIVQESWRLIAAVAACTLLIGALYAVVAKPVYRADVMIQVDDSTGSVNDALGQLASI
FDSKQTASAEIELIRSRLVVGQTVRALHLDISAVPRYFPLVGSLIARRASGSTPASPLFGLKRFAWGGEKVEVTSFDVPE
QLYDVPFTIIALSDDRFELHDEDDNVVLKGRVGELATTASGAVRALRISRLVARPGTEFVVKRASTLDTVNKLQNDLVIA
EKTKQSGVIGVSLDGPDSQRTAQIINTIASAYVQQNIDRKSAEAEHTIAFLDQQLPVLRKQLDDAENRYNAFRNQNGTVD
LTEESRLLLQQIVDGKTKLADLQQRRVELAQRFTPSHPAIASLDAQIKSLQDQQSQLNRHVENLPNTEQSALRLLRDVRV
DTQLYTNLLDSAQQLRILKAGQVGSVRVVDYAVAQDLPVKPKRVLVIVAALVLGVIAGVAVAFLRKTLFGGVEQSEEIER
VLELPVYASIPHSETQTRLSRAIRSTPAGQQYVLATTAPNDVAIEGLRSLHTALQFGLVDASNNILVITGPRPAVGKSFT
SVNLAAVLASSGKRVLLVDADMRRGDVHSYFGVSRQPGLSDVIAGVALENALLREVLPGLDLLPKGTLPPNPVELLMSTR
FKTLLDEIQARYDLVIIDTPPILAVTDAALIGRYAGATLLVVRHGRHPVPELLESANRLRISGVTLKGALFSEVPKRRVG
YGAYYSSYYGYESVSE
>gnl|bykdb|A0A088UCI1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia cenocepacia] (length=757 residues).
MSHLTMPESRGGPTARPPHPFRRYWGMLYGGRRTIVASALICVAAGALYALCARPVYRSDVLFQVEQSPTDTKPASPTGD
PSSMFDLKTDAATEIEVLKSRAVMARAVDTTKLYIEARPRYVPLIGWRLVNGADGLSSPLPGGYVYGTERIDVAAFDVPK
RLYDKSFALTVGRGGAYTLQRTGLFGRKGPVWQGRVGEPLHAETPDGNIDLLVRGIDGEPGARFDLTRHGEAETTAWLQK
NVLISERGKQSNIIGATLDGSDAAHISSILNAVGDAYLAQNTQRKSEAADKLIRFMDAQLPQLKAQLEAAEGRFNAYRAS
HGSVNTSDEALALRQQSVDIETRILTLQQQRQELLTRFMNKHPAVVAVDAQLADAQRSLAAVREQIQKLPAVEQGVLQLQ
RDVTVDTALYTNLLNARQQMMLARASKTGTVRIVDRAKVADLPVQPHRGVAVVAALLLGVLAAGAYLMLRQRFVGTVSDP
GEIEWTTGLPVIATVPRGESPRLAGADARNRPHASAASRGGLADPAIESLRNFRTTLQLSLPDAPNRIVLISGPTTGVGK
SYIASNLAALAAAASQRVLLIDADLRKGALHDHFRYSRAPGLSDVVMGTHRLDEALKRDVRPGLDFLSMGSIVADPGEVL
LQPALAELIERLSSQYRMIVIDGSPLLPVTDGLALGRLAGIVFLVARSGVTTLTEIDESVRRLQDVQVDVRGVILNDFAR
GPGHGYGYGNAETHQAASGYAGMMAHRPAGAGGKGDR
>gnl|bykdb|A0A088UGC3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia cenocepacia] (length=761 residues).
MNRIFMNRASGPLPETDLGDEPELVRYVDLVLTNRWLVAGVAAIVFTVGTAYVLLARPVYESNLLIQVEDNTGSADTLLG
SVSSLFDAKIQAAAEIEILKSRMVVDHAVKNLRLYIEATPKRFPLVGNAIAARTPGLSRPGLLGLGGYAWANESIDVGTF
DVPKAFEDETFELTALSGGRFRLDNGDLDRPIEGALGQLVESTQAGGTFRIRVSALQGNPGVVFRVKRRSELKTLQKLQR
QLNVSEIRKQSDVINVSLKSKDPDTVANILNTIGSAYVAQNVKRKSAEAEKSLAFLESVAPQLKQNLERAEAKYNGMRRK
RGTFDLGIEAQAYLQDSIATQATLLALQQKRADASTRFAPGHPDMQALDRQIDGAKQKIDGLSARLRAFPDIEQDELRLR
RDVEVGNAMYVGVLNNIQQLKLVSAGKVGNVREVDSAPVPEEPVEPRKALILALSAILGAMLGLMAAIAREALFGGVKDA
DDIERRTGLTVYGTIPDSSAQRAAEVSAARHRSIPQLLADENPHDPAIESLKSLRTALGLALLDADNNRVLLTGPSPGIG
KSFVSANLAAVMAAAGHRVLLVDADMRRGHLNESFDVPSSPGLSDVLAGHVQLRGATRRVTDALDFLPAGTPSPRASELL
LGESTLRSLDEMSAAYDVVIIDTPPVLAVSDATILAPHCATTFLVTRARQTTIGEIAESAKQLNRISSGLLGVLFNGVDT
RAFGYRSRYGAYRYAPYGPVEPSDNTHAAAGRRSSAQREAS
>gnl|bykdb|A0A088UIR0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia cenocepacia] (length=741 residues).
MVNTQAKHSYADLTAKTEEEDVVLGQLLQVIMDDIWLLLGIAVTVVALAGLYCYVAKPVYQADVHVRVEGNDNTSQALTQ
TQTGAMINSGPQQAPTDSEIEIIKSRGVVAPVVEQFKLNFSVVPKTMPLLGSLAARLATPGEPARPWLGLKSYAWGGEIA
DIDSVSVVPALEGKKLTLTAGPNGSYSLVDENGARLLSGHTGEQAQGGGVTLLVSKLVARPGTQFTVVRYNDLDAITGFQ
AGITVTEQGKQTGVVQISLEGKDPEQTAAIANALAQSYLNQHVVAKQAEATKMLAFLKGEEPRLKADLERAEAALTQYQR
TSGSINASDEAKVYLEGSVQYEQQIAAQRLQLASLAQRFTDSHPLVIAAKQQLAELEGEKQKYSDRFRSLPATEVKAVQL
QRDAKVAEDIYVLLLNRVQELSVQKAGTGGNIHLVDSALRPGAPVKPKKVLILSAAVFLGLILGTGVVFLRRNLFQGIED
PDRVERTFNLPLYGLVPQSAEQVKLDAAAEKGGGRTRPILASLRPKDLSVESLRSLRTAMQFAMMDAKNRVIVLTGPTPG
IGKSFLTVNLAVLLAHSGKRVLLIDADMRRGMLDRYFGLTVQPGLSELLSDQSPLEDAVRETPVQGLSFISAGTRPPNPS
ELLMSSRLPQYLEGLGKRYDVVLIDSPPVLAVTDATIIGRMAGATFLVLRAGMHTEGEIADAIKRLRTAGVDLEGGIFNG
VPPKTRGYGRGYAAVHEYLSA
>gnl|bykdb|A0A089Q6L2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Cedecea neteri] (length=722 residues).
MTEKVRRSSAPTEGNDEIDIGRLFGTVLEARWWVIGITGLFAALAVVYALFATPVYKADALVQIEQNAGNTLVNDISSAL
SNKPPASAAEIQLIQSRLVLGKTVDDLNLDISVSKNTFWLFGAGWDRLQGHQNDTVNVTTFTLPAGMNKDTFTVEVLNDK
QYQLTSDNGFSAKGEVGKPLSKGGVTMQVDGIKAQPGDNFTVVKYSTLGMINQLLGNLTVTENGKDTGVLSLSYTGEDKD
QIRAILDSITRNYLAQNVQRKSEEASRSLKFLAEQLPEVRHNLDSAENKLNAYRQRQDSVDLSLEAKSLLDSVVNIDSQL
NQLTFKEAEISKLYTKVHPSYRTLLEQRRTLEDQKARLTNSIAAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITE
ASTVGDVRIVDPAITQPGMVKPQRALVVLGSIILGLIVSIIGVLLRSLFKGGIESPAALEEAGLSVYASIPLSEWQKTRD
QANLRNAKGTKRFKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQASNNVLMLTGVSPSIGKTFVCANLAAVISQTNKRV
LLMDCDMRKGYTHELLGTTNVNGLSDVLSGQGDITRCAQKTSVPNFDLIPRGQVPANPSELLMNERFAQLVKWASENYDL
VLIDTPPILAVTDAAIVGRHAGTTLMVARYAVNTLKEVETSLSRFEQNGIAVRGVILNSIFRRATGYQDYGYYEYEYKSD
AK
>gnl|bykdb|A0A089YUC6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas rhizosphaerae] (length=738 residues).
MTAMNRSNLEYYKDTQIDLATILRTLFDHKKLITVVVVLFTLLGAFYAVVATPVYQANAMIQIEPKKVGLDATPQLNTKP
ASVSEAVTEIELIKSRTVLGKVVSDLKLDVVATPRYFPAIGRYMAREFTPTGSEKLAAPLFGLDAFAWGGEKIEVFNLDV
PANLQGERLTLIAGPNGTYRLVDADGAPLLSGRVGEVSQGNGITLQLAELTARPGTEFRLVKNRLLNTSLDYQQRLRVAE
SGKDSGIVYLSINDTDPVQANRVLDEVSRLYVRQNVERSSAEAAQRLDFLRSQLPVVRKELEKSEEALHAFQMRTKSVDI
TLETKALLDQMVAYDAQLSELRLKRTDLDRLYTRQHPASAALSQQISQIETQKASLQAQIKGLPETQQELLRLTRDMQVT
TQTYTLVLNKSQEQDIIRAGNIGNVRIIDKADSNVEEPVKPMRAVIVLVAMLLGTLVAVAIIFIRQAFYRGVENPEVIEN
LGMPVYASLPLSRQQERLQKKRGKGVTNRESRLLSVAAPSELAIESLRSLRTSLHFAMMEARNNVLMITSPMPGVGKSFV
SANLAVIIAQAGKRVLLIDGDMRKGYLHRSFGLQPKHGLSDALAARLGNTEVINATEVDNLHLIACGFAAPNPSELLMHD
NFSKLLRELSPHYDLVIIDTPPVIAVTDASLIGRQAGTTLLVARFGQSSVKEIEVSKRRLAQNGVLVKGAIFNGVIRKAS
TAEYDCAAYGYDYSPSKK
>gnl|bykdb|A0A090AJJ5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Thioploca ingrica] (length=738 residues).
MEMPTLQPSQLANLASGEDEIDLRVYWNVFNKHKWQIIGLTLLIGLLTTLVTFSLQPIYRATVTLLIEFDQPKIISIEEV
YGVSSANKDYYQTQLEILKSRSLVEKVVDKLNLVSHKAFNQDTSPVWFWDWRHWWVQLNESAATPISAEEKYQAIVNMIA
ANLGIEPVRNTQLAKISFESKDAQLAADIANTLANLYIETDLNARIALTKKATTLLTERINDLRQKLSHSEQVLQAYLEE
HNLVNVEGVKSVAIKQIEEMASNLVKAHQQLAETQSAYNQVQALRGQASGAFESITAVINNPLVQRLKEIELDAEKKVSE
LSKRYGSKHPNMIAATTELNTAQANTTKQIRQVITGITKEYEVALANVQALERSLKEKENQIQDINRNEYQLAVLQREVE
VNRQLYDLFLTRFKETDASQDIQALQSKIGQVIEPALVASTPYKPQKKLIVAISLVLGFLFSTLLAYLLEYLDNTIKNGE
DVEQKLGLPLLGTLPKLKISKQDPCHPQLMFLEKQTSQFAESVRTIRTGIMLSNLDTPRKVLVVTSSVVSEGKTTFAINQ
ALALGQMEKTLLIDADMRRPSIASVFGLTDKAPGLSELVAGTKQLAECIHPVMDGNIDCIHSGLIPPNPLELLSSRRFKE
LLTQLEKHYGYIVIDSAPTLAVSDAIVLATAASAIVYVVKADVTPYQMVKEGLKRLYQVNAPVLGIVLNQINTRKLSHYY
SNKYGYYNKPGYYSYTNR
>gnl|bykdb|A0A090DCK5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium sp. SOD10] (length=793 residues).
MNYANFPLDKRMPLPSTDQEKGEDFIDVERLLGMAARQAKVVAVCAVIGLFLGVIYLQTTPKQYMSVASVLIDEGLNKVV
DDISAASQTVQTDASFLSQVEILTSARLASVVVDKLKLDQNDAFMNPPQSALAKGIGFLRGVVGYFRGSSADDIPGMQNV
DEATRQAMIKTARHDYAVLKLQSEVLAQRNGRSYVLSIGYQAPDPALATAITKAYADAYLADQLNASFDATERAALWLQG
RLTELRESSQQAAMAVEKFRAEHGLSANSDGQLLSDKQLADLNAQLIVAQADTARASARYQQYKAIVDSGSESAFNDSAI
GADQPSSSVIIALKTRYLAIAKRLQDVETNFGKDHPQAVALTKEKADVSAQIFGQLKQLTESYRNDFQVAQAREQALRDK
ISTAAGKSSIDNQSQVKLKELDQQAQALTTLYQTFLSRYEEASQQQSFPVGKVRIISDATMPLAASSPRTLRVLALSLVL
GLMLGAGFGGLNEFNERFFRTGEDVRDRVGLKFLGYLPTIGGGKAKDSKPDDLPADGKVASLSAAERRARMRVSIDAPAS
MFAETLRNAKIAFDVVMEDRGSRVIGVISVLPGEGKSTVAANLAGLLAANGAKTLLIDGDLRNPGLSRSLGMETEQGLME
AVVNGQTWQSVGKVDRQTKLAIIPAVLRGQFSHTSELLGSAGMRRFIENAKETFEYIIVDLPPLGPVVDAKAFAPLVDGF
VLVTEWGRTPRNMVRSMLESEPYIANKVIGAVLNKVDLKKLAKYGSLGGSERFFDRYSTYYLEKSEQRPKQAA
>gnl|bykdb|A0A090DEG9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium sp. ORS 3324] (length=694 residues).
MSYAADDPIIARQLPSLDVREIFDFFLRRWKFGCAIAAITLAIFLVAAFTLPPSYTGVAQVLLDSPVDYMTPQDYSNSDF
SDNPTFIESQIAVLRSASLLQQVVDSEKLAEDPKIGPAALTWLQGALGVSRVGLGNVIELDVTMYDPAKAASLANAIAQA
YVADRTKTRYEGVQKASTWLSDRAAYLRSELSRSEEAVQKFRADHNLLTTRAGSLTDQQMSELNVALINARAELSAKRAQ
YQQVDKLLSSGGDLQSMPDVLQSVVVSALRSQLSVVSRREADLRLKYGERHPDVLSAQAERRDIEGQISAEVQRLVGNLK
NEVDAAEAREAALVRALGSVSDQSEVEGQVGVQLRDLERIASANQNLFETFLSRAKLTEEKSTLLNSGVRVITAAAVPLS
PSFPNRPLFAALGLVLGVLFGGAGAVLRELSASGFMAKKQIEEELAVPVLASMPRMLGWSGETQPIAYLERRPLSRYSEA
VRRLRLGMDATSELSCSPRLMLVTSAMPSEGKTTLALSLACSAAADGERVLLIDADLRLSAATAFFGMAEKVGLVDLLTL
PMKASNAIHLDERSGISLLPAGAKTRNPPALLASARMRSILDELRGKFDTVIVDAPPVGPAADASILARHVDKIIFAVKW
CETSREAVAEGIRHLGGRSKIAGIALTMVDEPKLPKYGRYTSLDSSVSDSYYLN
>gnl|bykdb|A0A090DQ30 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium plurifarium] (length=793 residues).
MNYANFPLDKRVPLPGADQEKGEDFIDVERLLGMAARQAKVVAACAVIGLFLGVIYLQTTPKQYMSMASVLVDEGLNKVV
DDISAASQTVQTDASFLSQVEILTSARLASVVVDKLKLDQNDAFMNPPQSALAKGIGFLRGVVGYFRGSSAGDIPGIENV
DEATRQAMIKTATHDYAVLKLQSEVLAQRNGRSYVISIGYQAPDPALATAITKAYADAYLADQLNASFDATERAALWLQG
RLTELRESSQRAAMAVEKFRAEHGLSANSDGQLLSDKQLADLNAQLIVAQADTARASARYQQYKAIVDSGSESAFNDSAI
GADQPSSSVIIGLKTRYLAIAKRLQDVETNFGKDHPQAVALAKEKADVLAQIFGQLKQLTESYRNDFQVAQAREQALRDK
ISTAAGKSSIDNQSQVKLKELDQQAQALTTLYQTFLSRYEEASQQQSFPVGKVRIISDATMPLAASSPRTLRVLALSLVL
GLMLGAGFGGLNEFNERFFRTGEDIRDRVGLKFLGYLPTIGGGKAKDSKADDLPADGKVASLSAAEKRARMRVSIDAPAS
MFAETLRNAKIAFDVVMEDRSSRVIGVISVLPGEGKSTVAANLAGLLAANGARTLLIDGDLRNPGLSRSLGMEAEQGLME
AVVNGQTWQSVGKVDRQTKLAIIPAVLRGQFSHTSELLGSAGMRRFIENAKETFEYIIVDLPPLGPVVDAKAFAPLVDGF
VLVTEWGRTPRNMVRSMLESEPYIANKVIGAVLNKVDLKKLAKYGALGGSERFFDRYSTYYLEKSEQRPKQAA
>gnl|bykdb|A0A090E9E3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium sp. ORS 3324] (length=794 residues).
MNYANFPLDKRMPLPSTEAEKGEDFIDVERLLGMAARQVKVVAVCAVIGLFLGVIYLQTTPKQFTSVASVLIDEGLNKVV
DDISAANVTQQTDATILSQIEILTSARLASVVVDKLKLDQNDEFMNPPQSALAQGVGFLRNVVAYFRGGSSVDDIPGIQN
VDAATRQAMINVARHDYAVLKLQTELMADRNGRSNVITIGYQSTNPALATAITKAYAEAYLADQLNASFDATERAAVWLQ
GRLNELRQSSQQAAMEVEKFRAEHGLSANSDGQLLSGKQLADLNAQLIIAQADTARASARYQQYKAIVDSGSENAFNDSA
IASDQPSSSVIIALKTRYLAVSKRLQDVEANYGKDHPQAVALTKEKADVSAQIFGQLKQITESYRNDFQVAQARETELKQ
KIATAAGQSSADNESQVRLRELDQQAQALSTLYQTFLSRYQEASQQQSFPVGKVRIISDANMPLAASSPRTLRVMALSLV
LGLMLGAGFGGLNEFNERFFRTGEDVRDRVGLKFLGYLPTIGGGKAKDTKSDDLPADGKVTSLSAAERRARMRVSLDAPA
SMFAETLRNAKIAFDVVMEDKGSRVVGVISVLPGEGKSTVAANLAGLLAANGAKTLLIDGDLRNPGLSRSLGMESEHGLM
EAVVSGQTWQSVGKVDRQTKLAIIPAVLRGQFSHTGELLGSAGMRRFIENAKETFEYIIVDLPPLGPVVDAKAFAPLADG
FVLVTEWGRTPRAMVRSMLESEPYIADKVVGAVLNKVDLKKLAKYGSFGGSEKFFDRYSSYYLEKSDARAKQAA
>gnl|bykdb|A0A090FD69 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium plurifarium] (length=793 residues).
MNYANFPLDKRVPLPGADQEKGEDFIDVERLLGMAARQAKVVAACAVIGLFLGVIYLQTTPKQYMSVASVLVDEGLNKVV
DDISAASQTVQTDASFLSQVEILTSARLASVVVDKLKLDQNDAFMNPPQSALAKGIGFLRGVVGYFRGSSAGDIPGIENV
DEATRQAMIKTATHDYAVLKLQSEVLAQRNGRSYVISIGYQAPDPALATAITKAYADAYLADQLNASFDATERAALWLQG
RLTELRESSQRAAMAVEKFRAEHGLSANSDGQLLSDKQLADLNAQLIVAQADTARASARYQQYKAIVDSGSESAFNDSAI
GADQPSSSVIIGLKTRYLAIAKRLQDVETNFGKDHPQAIALAKEKADVLAQIFGQLKQLTESYRNDFQVAQAREQALRDK
ISTAAGKSSIDNQSQVKLKELDQQAQALTTLYQTFLSRYEEASQQQSFPVGKVRIISDATMPLAASSPRTLRVLALSLVL
GLMLGAGFGGLNEFNERFFRTGEDIRDRVGLKFLGYLPTIGGGKAKDSKADDLPADGKVASLSAAEKRARMRVSIDAPAS
MFAETLRNAKIAFDVVMEDRSSRVIGVISVLPGEGKSTVAANLAGLLAANGARTLLIDGDLRNPGLSRSLGMEAEQGLME
AVVNGQTWQSVGKVDRQTKLAIIPAVLRGQFSHTSELLGSAGMRRFIENAKETFEYIIVDLPPLGPVVDAKAFAPLVDGF
VLVTEWGRTPRNMVRSMLESEPYIANKVIGAVLNKVDLKKLAKYGALGGSERFFDRYSTYYLEKSEQRPKQAA
>gnl|bykdb|A0A090FG74 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium sp. ORS 3359] (length=793 residues).
MNYANFPLDKRTPLPSADQEKGEDFIDVERLLGMAARQAKVVAICAAIGLVLGVIYLQTTPKQYTSVASVLIDGGMNKVM
DDISAASVTQQTDATILSQIEILNSARLASEVVDKLKLDQNQDFMSPPQSALAKGIGFLRGIVGYFRGNAADQLPGIQNV
DAATREAMIKAATHDYAVLMLQTGLSADRVSRSNVISISYQATNPALATAITKAYADAYLADQLNASFDATERAAVWLQG
RLTELRESSQAASLAVEKFRAEHGLSANSDGQLLSDKQLADLNAQLIVAQADTARTSARYQQYKAIVDSGSESAFNDSAI
AADQPSSSVIIGLKTRYLAIAKRLQGVETNFGKDHPQAVALTKEKADVSAQIFGQLKQITESYRNDFEVAQARETALRDK
ISTAAGKSSIDNQSQVKLKELDQQAQALTTLYQTFLSRYEEASQQQSFPVGKARIISDATMPLAASSPRTMRVLALSLVL
GLMLGAGFGGLNEFNERFFRTGEDIRDRAGLKFLGYLPTIGGGRAKDSKADDLPADGKVTSLSSAERRARMRVSIDAPAS
MFAETLRNAKIAFDVVMEDRGSRVIGIISVLPGEGKSTVAANLAGLLAANGAKTLLVDGDLRNPGLSRSLGMEAEQGLME
AVVNGQTWQSVGKVDRQTKLAIIPAVLRGQFSHTSELLGSAGMRRFIENAKETFEYIIVDLPPLGPVVDAKAFAPLVDGF
VLVTEWGRTPRNMVRSMLESEPYIANKVIGAVLNKVDLKKLAKYGALGGSERFFDRYSSYYLEKSEARAKQAA
>gnl|bykdb|A0A090G1U2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium plurifarium] (length=793 residues).
MNYANFPLDKRVPLPGADQEKGEDFIDVERLLGMAARQAKVVAACAVIGLFLGVIYLQTTPKQYMSVASVLVDEGLNKVV
DDISAASQTVQTDASFLSQVEILTSARLASVVVDKLKLDQNDAFMNPPQSALAKGIGFLRGVVGYFRGSSAGDIPGIENV
DEATRQAMIKTATHDYAVLKLQNEVLAQRNGRSYVISIGYQAPDPALATAITKAYADAYLADQLNASFDATERAALWLQG
RLTELRESSQRAAMAVEKFRAEHGLSANSDGQLLSDKQLADLNAQLIVAQADTARASARYQQYKAIVDSGSESAFNDSAI
GADQPSSSVIIGLKTRYLAIAKRLQDVETNFGKDHPQAVALAKEKADVLAQIFGQLKQLTESYRNDFQVAQAREQALRDK
ISTAAGKSSIDNQSQVKLKELDQQAQALTTLYQTFLSRYEEASQQQSFPVGKVRIISDATMPLAASSPRTLRVLALSLVL
GLMLGAGFGGLNEFNERFFRTGEDIRDRVGLKFLGYLPTIGGGKAKDSKADDLPADGKVASLSAAEKRARMRVSIDAPAS
MFAETLRNAKIAFDVVMEDRSSRVIGVISVLPGEGKSTVAANLAGLLAANGARTLLIDGDLRNPGLSRSLGMEAEQGLME
AVVNGQTWQSVGKVDRQTKLAIIPAVLRGQFSHTSELLGSAGMRRFIENAKETFEYIIVDLPPLGPVVDAKAFAPLVDGF
VLVTEWGRTPRNMVRSMLESEPYIANKVIGAVLNKVDLKKLAKYGALGGSERFFDRYSTYYLEKSEQRPKQAA
>gnl|bykdb|A0A090IJ94 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Moritella viscosa] (length=765 residues).
MDKLEQSLNKSSVNKDIVLPSPHWHVVQRYKWRIFLLSAFVSLSAALYLSKEQPLYRASATLLIEANQAQAVSFDSVQGL
DSNRKEYYLTQFEILKSKSIAETVFDRLNLQQQPSFQKRESWRDKAVAYILDVSPLLKSFIMNIDSEFAENIGAGYISGV
PQSATDISNQALESQQVKISRLRQFSKRLMVTPIRKTQLVKLSFESEDPALAAMIANAVGEAYIAQDLEVKSSINKNAAH
WLTKRLEGLRRSLDESETLLQAYRKEENIIDLQDRGGRGLTGLVSNELEQTSYQLVEAKNEVNQLRSIVRAINEYGVKNL
ENLESIPEITSHPIIQNIKKLKVRAKLKVSELSQIYGRKHPDLIAAKSELYTVNKHLTIQISKLVSGLDRELKTKKSNVA
ALERQYSKIQNQFQDVIGKDNEYQKLVRDVESNRKLYNTFLERSKETALTSDFNAAVARFTDRAKAPNKPITLSTKIVII
IVFILTMLLHIAYLLVKEYFTDNFNSVGDIENKLGLPVLGVLPKVARKRNQDLDLHYFFDEDGRQFSESVRTLRTSFLLA
QGQRVNQVIGIISSQPNEGKSTTATNIAFSLAQIEKTVLIDADMRKPSLAKNFNIPKDKPGLAQVITGDANLSDCITVDP
ASGVHVMACGPTPKNAQELLSSKRFKQLLESLRQSYDRVVIDTPPIQAVSDSLIISLHTDAIIYVIKSEATRVRLVQNGI
RRLAKVDANLVGIVMNHVNTDGVADSEYYYGYYSDDDYAEKSTKS
>gnl|bykdb|A0A090IK46 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Moritella viscosa] (length=730 residues).
MSSITLNQADKTQQSSQTSNSSDADLGKLFGILLDARWSIIAVTFIFSVLGVCYALLTTPVYKADALIQVEQKSGSMSAL
VGDMGDMFSSESSATTEVEIIKSRMVLSQTVEKFNLTTLAAPKYLPVIGKGLARMSGQQNDITISRFEIPSYASPAFSLI
IDASSKGAYTLYDGDERKVLSGVVGELAQNNDYRLFVQALVGKNTDEFSIAKQSKLDAIQWLQQNLLVSERGKQTGILQL
TFSGEDKVLIEDILNDVSQNYFLQNVQRNSAEAEKILAFLQGHLPNIKTELTAAEDTLNRFRQNNESIDLGLEAASTLKV
MVALESQLNELTFKESEISQRFTKDHPAYKSLLDKREVLLAKQHKLNAQVQKLPKTQRDVLRMKRDVEVNQQIYIQLLNK
VQELSILKAGTVGNVRILDTAQAYSKAVKPKKSLIVVLVTLLGGMLAVAVVLVRAALHKGIENPDEVEALGLPVYASIPM
SDWQAEMDVKFKHNKRKKNFALHETLLAESNPADLSIEALRGLRTSMHFAMMEAKNNVVMISGPAPGIGKSFVSVNFAAV
IAKTGQKVLLVDGDMRKGYLQRHFNLEWDHGLSEMLSGKLDTKDVIKTSGIENLDIITRGQIPPNPSELLMHPRFADFIT
WASSEYDLVLIDTPPVLAVTDPSIVGALAGTTLMVGRFGQNTVKEIEVARHRFEMAGIEVKGFILNAVEKKASASYGDGY
YNYSYESDKF
>gnl|bykdb|A0A090MKT2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Afipia felis] (length=773 residues).
MLQRNSDELAAPRVEQIGMGVEDAAGPAVDLREIGRILRRRGGVIAYVAASLVGIALLYVLLATTRYTATSTVVIDPRHA
NVADTTQPVLSSYGTDDATIESQALLIQSVATLQRVVDKLKLTEDEEFSPEPGFLDPIKRVIGSLVSSESNEAAPDNAAQ
TRSVDLLQKRLKVVRQGTTFLVDINVSSKSPRKAALIANAIADAYLEEQVRAKFDVTRTAAKWLNGQLDSLKARVVASEK
AVEDFRAANNLAVSQGVTLNDQQITDLNNKLISARSETAEARAKFEQVQQLSKSGNDPGGINAAISSDIITKLRTQYADI
AKNEADLTSKYGPRHPLVASVHAQLKDTQRLIDQEIKRILQSTAHDYDVAKSREKSLQDSLDQLQNVSSESGQAQVRLHE
LQREAEANRTLYESYLARAKETSSQESLEMPDSRIVTKASIPLKPSSPKTLLILGLAIVLGGGGGVVLALLLDYLDSRIK
TLEQAEAISGVPALAAIPRIGARELASRAKRGRFDLKGYDPAIMRLLPPSLQPPLMRYAIEEPGTFFAEAVRAARLSIQR
VLRTQSAKVVLVTSALDSEGKTTFASNLALSFASLGVKTLLIDGDLRNPGLTRAVSPRASAGLMQVATGEIPLERAILFD
RSSGLSILPATVCDNDNTITELMFSEEIATVLDRLRVHYELIIIDSPPLIPLVDGRALAELADRIVLALAWDQTPKEVLL
HMMELLEPVSDRILGTVLTQVDLSRLRFYDYYRSSAYLKPYVASVAAAGGAAH
>gnl|bykdb|A0A090NIW0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Shigella dysenteriae WRSd3] (length=726 residues).
MTTKNMNTPPGSTQENEIDLLRLVGELWDHRKFIISVTALFTLISVAYSLLSTPIYQADTLVQVEQKQGNAILSGLSDMI
PNSSPESAPEIQLLQSRMILGKTIAELNLRDMVEQKYFPIVGRGWARLTKEKPGELAISWMHIPQLNGQDQQLTLTVGEN
GHYTLEGEEFTVNGMVGQRLEKDGVALTIADIKAKPRTQFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDDPQ
LITRILNSIASNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDNQL
NELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISK
SSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGVVLARAMLRRGVEAPEQLEEYGISVYATIPMSEWLDKRT
RLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSD
QKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDH
YDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGY
SYSEKE
>gnl|bykdb|A0A090S975 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio variabilis] (length=716 residues).
MNQPSTHTSQVADDEIDLGKLFGILLDSKWLIILVTFFFAVLGVTVALLSTPIYQADALVQVEEKSSGVPGLSDISDMFA
TESSSDTETQIIKSRMVLGNTVDKLQLTTKVEPKYLPFIGKGIARLTGETPPIFQVEHFEVPQDLLGKPMLVSIAEQGSY
QVIWDGSVVLEGAIGELAQSNGITLGVSAIDAPVGTEFLITKTARLVTIADLKERLSVSEQGKKTGILRLVLEGEDPDLI
QSIVNSIASDYLIQNVERTSEEAEKSLQFLRGHLPEIQGQLDASEGKLNRFKIANDSVDLALEAESVLKTMVTIESQLNE
LTFKEADIAQRFKKSHPAYISLIEKRKTLQSEKLRLESMVAKMPATQQEVIRLSRDVEVNQAIYLQLVEKVQELNVMKAS
AIGNVRILDYAETLEEPVKPKKAIIVVIGTLLGGFLAVAYALVKEAFHKGVETPDQIEAIGLPVYASVPKSDTQMRLNVL
QRKLGKKANIDQLLAETNPADLSIEALRGLRTSLHFAMMEAKNNILMISGPSPSVGKTFVSTNFAVVVAKTGQRVLLVDA
DMRKGYLQRQFGLQWDNGLSDYLSGKVELPGTIKASGIENLDIVTRGQTPPNPSELLMHQRFADFTEWAQQNYDLVIIDT
PPILAVTDPSIVGAYAGTTMLVGRFGQNTIKEIEITKQRFEQSGVEVKGLILNAIERKASNSYTYGYYNYAYASDN
>gnl|bykdb|A0A090TTL4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Citrobacter werkmanii NBRC 105721] (length=720 residues).
MTEKVKQSAAPVTGNDEIDIGRLVGTVVEARWWVLGITTAFAVCAAVYTLFATPIYSADALVQIEQNTGNSLVQDIGSAL
SNKPPASEAEIQLIQSRLVLGKTVDDLNLDIAVTKDTFPIFGAGWDRLMGRQNETVNVTTFTLPKAMKEQTFTLSVLNDK
SYQLVSDGGFSARGQVGQLLNRDGVTMLVEAIHASPESQFTVSKFSTLGMINTLQNNLMVTETGKDTGVLSLTFTGEDRE
QIRQILDSITRNYLQQNVERKSEEAAKSLAFLAKQLPEVRNRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLFTKAHPAYRTLLEKRQALEDEKSKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITE
ASTVGDVRIVDPAIAQPGVLKPKKALIILGSIILGLMLSMVGVLLRSLFNRGIESPQALEEHGISVYASIPLSEWQKARD
NVQTIKGVKRYKQSQLLAVGNPTDLAIEAVRSLRTSLHFAMMQARNNVLMLTGVSPSIGKTFVCANLAAVISQTHKRVLL
IDCDMRKGYTHELLGTNNVNGLSELLVGKGDITSCAKPTSIANFDLIPRGQIPPNPSELLMSERFGELITWASEHYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIQVKGVILNSIFRRASGYQDYGYYEYEYTSDSK
>gnl|bykdb|A0A090UY09 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudescherichia vulneris NBRC 102420] (length=720 residues).
MTEKLHHAAAPQTGGDEIDIGRLVGTVIEARWWVLGITALFALAAAIYALFATPIYSADALVQIEQDAGGSLVQNLNSAL
SNKPPASDAEIQLIKSRMVLGKTVDDLDLDIGVTKNTFPIFGAGWDRLQGRQNETVKVTTFTLPKGAGGQVFTLSVLGPK
QYQLTSDAGFSARGEVGKLLQKEGVTFEVSAIQAAEGSEFTVSKFSTLGVINNLQNNLSVTENGKDTGVLSLSFTGEDRN
QIRAILNSITRNYLAQNVERKSEEAAKSLAFLAKQLPEVRANLDAAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKAHPAYRTLLEKRRALEDEKDRLSGRVSAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITE
ASTVGDVRIVDPAIDQPGVLKPKKALIILGSIILGLMLSIVGVLLRSLFNRGIESPQVLEENGISVYASIPLSEWQKARD
SVNTHKGTKRFKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQASNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLM
IDCDMRKGYTHELLGTDNVNGLSDILAGKGDFSTCVKPTAITHFDLVPRGQVPPNPSELLMSERFAQLIAWASSQYDLVL
IDTPPILAVTDAAVVGRHAGTTLMVARYAVNTLKEVETSLSRFAQNGIQVKGVILNSIFRRATGYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A091B0J7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Arenimonas oryziterrae DSM 21050 = YC6267] (length=763 residues).
MQDANKDPMSGGEGNFPTPVDSRRIQSLTIARNQQLSLDLRSQEAVAGGDEIDLLSYWRILVKRKWTVLGAMGIVLVSTL
VATLLMTPIYRASATLQIDRDTIQVVQVEGMGAVEGGAGDRDFYQTQYELLKSRALAERVATQLGLTAPGALEKLTPPSP
WRRLTGIFSSNDEPSQGEADEASATRRRQAISAFAEGLSIEPVRNSRLVRVHFDSPSPAFSTKAANAVVEAFIASNLERR
FESSSYAKTYLEDRLQELKLKLEDSERKLVAFAQKEQIVGAGGDQATLTEQNLGSINAALSKAKEDRIRAEARWNQAQAA
SGTSLPADVLGSSIIHTLQESRGKAMADYQDKLRTYKPEYPLMLSLKSQIDEIDKQIRQEVANIKSSIRAEYDAASKQEA
MLQTQLTGLKSEVLDLQNRSIQYNIFKREVDTNRQLYDGLLQRYKEIGVAGGVSTNNLSIVDRADIGRKYKPSLTRNLGL
GLLVGLMLGVLLALLFEYLDDTVKAPDDIEKLLGLSVLGVIPMLKDGLTPARALDDPRSAFAEAYRSVRTALQFSTNEGV
PRCLLVTSATPSEGKSTTALTLAKNFAQLGKRVLLIDADLRNPSLHRALGAENSHGLSNLLAGASKVTQTIVTSPEIPNL
SFITSGPLPPNPAELLMGSKLMSLLTVAAQKYDQIIVDGPPIMGLADAPILANVCTGTILVVEAGETRISIARNALKRLL
AARAHVIGALLTKYHASHAGYGYGYGDYAYYSYGNNTAKLTRQ
>gnl|bykdb|A0A091B4W3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Arenimonas malthae CC-JY-1] (length=760 residues).
MNQENPEGHNAGLPTPAGPGGQQALALSRQQALSLDLRAGEPAADSDEINLLDYWRIIVKRRWTVLATLGIVVVTALVGT
LLMTPIYRASTTVQIERDTIKVVEVEGFTPTESPADRDFYQTQYELLKSRSLAQRVISQLNLANDPVYLEMSRPSPWRAL
LGGGDDEEETLTAAEADSREDAKMSRMITGFLANLSIEPVRNSRLVRVHYDSPDPAYSQRVVNAVAEAYIAANLERRFDA
SSYAKTYLEDRLQQLKLKLEDSEKQLVEFAQREKIVDANDGSSLSTQSLGELNSAVAKAQDERIRAEARWRQAEAATGMG
LASVLDSSIVQTLQETRAKLQAEYQDKLRVFKPAFPEMQQLKAQIDELDKQLGAEVANIKASIRAEYQAALAQEQLLKAQ
VGALKDEVLDLQSRSIQYNILKREVDTNRQQYDALLQRYKEIGIAGGVGTNNISIVDRAEVPTNKHKPRLALNLAVALLL
GLFGGVLLAFVFEHLDDTLKSPEDVEKQMGLSVLGVIPMLKAPMTPAKALEDPRSAFAEAYRSVRTALQFSTDTGVPRCL
LVTSASPSEGKSTTALTLAKNFAQLGKRVLIIDGDLRNPSLHRSLDKPNDIGLSNYLAGAAKATEVIHATDSPHLMFMPT
GPLPPNPAELLMGPKMLSLISIASEKFDQVIIDGPPVMGLADAPILANMASGTLLVVEAGETRISLARNALKRLYAARAH
VIGALLTKFSAKHAGYAYGYGGYNYYSYGAQPEPKKLARR
>gnl|bykdb|A0A091C494 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Arenimonas composti TR7-09 = DSM 18010] (length=759 residues).
MTDAIDTNDASGLPTPAGQPNRQLALPRDRPLSTEVSPPENGDGGDEISLLDYWRVIVKRRWTVLATLAIVLVTALVGTL
LMTPIYRASVTLQIERDTMQVVQVEGFTPEESGVGGDFYMTQYELLKSRSLAQRVISELDLENDPAYQAMTAPSPWKALF
GSGGGDEDTVVDAAVAEAAESDRQSAMITAFLNRLSVEPVRNSRLVRVHFDSPDAAFSQRVINALAEAFIASNLERRFEA
SSYAKTYLEERLEQLKIKLEDSEKELVAFAQRERIVDSSNGTPLPAQSLAELNTALAKAQDERIRAEARWRQAEAASGMG
LSSVLGSTIIQTLQETRAGLQAQYQEKLSVFKPAFPEMQQLQAQIDELDRLIATEVANIKLSIRAEYQAALAQEQLLRNQ
INTVKDEVLDLQSRSIQFNILRREVDTNRQQYEALLQRYKEIGVAGGVGTNNISIVDSAERPRFAHSPSLGLNLAIGLLL
GLFLGILLAFLFELIDDSLKSPEDIERLLGQSVLGVIPRLKAPMTPAQALADPRSAFAEAYRSVRTALQFSTDTGVPRCL
LVTSATPSEGKSTTALTLARNFAELGKRVLIIDGDLRNPSLHRMISSDNSTGLSNYLAGAAKAVDVIRPTDVPNLSFMPT
GPLPPNPAELLMGAKMVALVRVASEKYDQVIIDGPPVMGLADAPILANMASGTLLIVEAGSTRISVARNALKRLYAARAH
VIGALLTKYSSKQGGYAYGGYSYYSYGASGETQKQLGTR
>gnl|bykdb|A0A093SNW3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pectobacterium polaris] (length=722 residues).
MTEKTSVKASEKNSDEIDLGRLLGTLLDNRWLIIGVTAVFTILGIMYAMLATPVYKADALIQVEQNSGSSLLNDISSMLP
DAKPQSAAEIELIKSRMVIGKTVNDLALDISVRQKYFPLVGKGIARLVGNEPGKIAVSRLDVPASWQDEVLSLEVLPNQQ
YVVQAGDTLKFTGSIGKLENHNGITLLVSGIEAEPGTIFRIQKLNQLTAINGLLDNFSVADKGKDTGVLALSLEGDDPTL
TTKILSSISQNYLQQNVERKSEEAGKSLEFLKEQLPNVRSSLNEAENKLNQFRQQNESVDLSLEAKAVLDTTVAVEAQLN
ELTFKEAEISKLYTREHPAYRALMEKRKTLEQERDKLNKRIGAMPKTQQEILRFTRDVQAGQEVYMQLLNKQQELSINKA
STVGNVRIVDNAVIQPKPVKPKKALIVILAMILGGMVSTAFVILKTLLHKGIESPEQLEELGINVYASVPLSEWQQKKDR
ALLGNKSKKGNTRATDLLAVGNPADLAIEAIRSLRTSLHFAMMEAKNNVLMISGASPAIGKTFVSANLGAVIAQSGQRVL
IVDCDMRKGYAHELMGTQGTDGLSDILSGQCDVTKSVRKTAVENMDFIPRGQVPPNPSELLMHSRFAEFIKWAGENYDLV
LLDTPPILAVTDAAIISRHAGTSLLVARFEMNTVKEIEVSIRRFEQNGTEIKGVILNAIVKRAASYYGYGNYDYYTYEYK
SK
>gnl|bykdb|A0A093UEV9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pectobacterium betavasculorum] (length=722 residues).
MTEKTSVKVSETHSDEIDLGRLLGTLLDNRWLIIGVTAVFTVLGIMYAMLATPVYKADALIQVEQSSGNSLLNDISSMLP
DSKPKSDAEIELIKSRMVIGKTVNDLALDIDVQQKYFPVVGKGLARLTNEETAKIVVSRLDVPESWQDQIFTLKIIDGTQ
YSVEAGDVLTFTGTVGRLETHNSITLLISDIAAKPGTVFNIKKLNQLTAVNSVLDNLVVADKGKDTGVLELSLEGEDSVL
TNKTLSSISQNYLQQNVERKSEEAGKSLEFLKEQLPNIRTSLNEAENKLNQFRQQNESVDLSLEAKAVLDTTVAVEAQLN
ELTFKEAEISKLYTREHPAYRALMEKRKTLEQERDKLNKRVGAMPKTQQEILRLTRDVQAGQEVYMQLLNKQQELSINKA
STVGNVRIVDNAVIQPKPVKPRKTLIVLIATILGGLISTAFVILKTLLHKGIESPEQLEELGINVYASVPLSEWQQKKDR
ALLSSKSKKGNTRATDLLAVGNPTDLAIEAIRSLRTSLHFAMMEAKNNVLMISGASPAIGKTFVSANLGAVIAQSGQRVL
IVDCDMRKGYAHELMGTHGTDGLSDILSVQCSTEKSIRKTGVENMDFIPRGQVPPNPSELLMHNRFAEFVKWAGEHYDLV
LLDTPPILAVTDAAIISRHAGTSLLVARFEMNTLKEIEVAIRRFEQNGTEIKGVILNAVMKRAASYYGYGNYDYYTYEYK
SK
>gnl|bykdb|A0A094SX85 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pectobacterium carotovorum subsp. odoriferum] (length=724 residues).
MAEKISGKTSETNADEIDLGRLLGTLLDHRWLVIGVTAIFTIIGILYATFATPIYKADALIQVEQNSGNSLLKDISSVLP
DAKPESAAEIELIKSRMVVGKTVKDLSLDIVVQQKYFPIFGKGFARLMDDELGKIAVSRLEVPQSWQDTPIALTVLDSQT
YEVEAGDVVRFKGKVGQIEKHNGLSILLSEIQAEPGTIFRVQKLNTLTAINNILGNLSVADKGKDTGVLSLSFEGEEAEL
TNKILNSISQNYLQQNVERKSEEAGKSLEFLKEQLPSVRLNLDDADNKLNSYRQKNESVDLSLEAKAVLDTMVSVESQLN
ELTFREAEISKLYTKEHPAYRALMEKRKTLEEEREKINKRVGVMPKTQQEILRLTRDVNVGQEVYMQLLNKQQELSINKA
STVGNVRIIDPSAIQLSPVKPKKVLIVLLSILLGGMVSTAFVVLKTLLHKGIESPEQLEELGINVYASVPLSEWQQKKDR
ALLGRGKRGNTRSTELLAVGNPADLAIEAIRSLRTSLHFAMMEAKNNVLMISGASPAIGKTFVSANLGAVVAQSGQRVLI
VDCDMRKGYAHELMGCTGNDGLSDILSGQTNTEKCLRKTAVENMDFIPRGQIPPNPSELLMHNRFSQFIDWAANNYDIVL
LDTPPILAVTDAAIISRHAGTSLLVARFEVNTLKEIEVSIRRFEQNGTEIKGVILNAIVKRAASYYGYGNYHYYAYDYKS
EKNS
>gnl|bykdb|A0A094WG91 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITTVFALCAVVYTFFATPIYSADALVQIEQNSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDNK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHASPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A094YRB0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acetobacter tropicalis] (length=743 residues).
MNTLQIPSPYNGQSSLPVVAQQVSPLHAFSIMNRHKVTIAVVTLAIAIPSAIAIFSMKPYYDASSILIVGTRQAPFRDLQ
ATVASPEVDTVAVNSEVSILRSPTISRAVVQKLDLTHDPEIQANLSYVPLSKRISNTVASLFTRPALPEPITENERIQAV
SDLLNKWVSILNDGRSYIITITASTGDAQTSARIANAYADVYLDFKRRMKVTATWQANALLDEQIVPLRERLRKAEQAVQ
AFREKNGLIAAELERAPVAGTENNMSGGATVTDQQLSQMNHELMIARGDLEAHRARYAEISSAIKNGSLDSIPEAVSSPL
IQQLQAQEAQVSSRAASLSQVVMDANPELQSTRAAATHIRSRIGAEVHRIANSAAKELASAQARVNALSEQVNTLQKQVT
AENEADVTLRQLQSEATAARTVYQDYLGRFAQTSTQAELQVAEADLISRAEAPLKPQGPPRKQYMAIAFLFALLTGAGSA
LVIDRVHKGIRSLDELDAIPGLFALGLVPAFTGSLMRQYGSAQRSAYIETVDSIRSVLSFGHSRFRAKVVLITSAEQGEG
KTTFALSLAANTGRCGQRALVIDCDIRNPSTMRILGALRVAQNNQMPVDPLMAGLERDVLPGVDILTPDAIRHHGNGAML
LPEELGRILTHVGSQYDMILLDTPPALAFPDAAILSRQSDGVVLVVKWGHTSASTLTQALRTLHTYDARTLGAVLTQAPP
NSLGKAEKHPFHIYKRYGLLASS
>gnl|bykdb|A0A095AS77 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingopyxis sp. LC81] (length=682 residues).
MAAAIVIAAAAYLAAEPRYLATAQVALERTAEQVIKVDSVIPTTDPDSAAVDTEVQVLRSPELIGRVVDRLKLERDPAFN
EAAGQGRPTAQPDLIGRQRAIGTLLSGLTVKRDGLSYAISVSFEGGTPVQSAQIANALVDDYVSGQVGSKTEATHRARGF
LEQRLQDLRAQVVGAEREVADYRAAHNLFAVSEASSVTQQELSGLSTQLAQAKAENAAAQARLSAARAQLSGGRTGEELG
DSLDSPVVSQLRAQRAEVAREVGALEKRYGPRHPDLVRAQSQLRVADQQIAAEVQRIVSNVAIQASIANQRAGSLAGSVA
QSEGKLASDNAASVRLNELERNAESARTLYQAFLDRYRQTVAQSGLERSDAYIVSRARVPSAPSSPNMLIYAAMAVVGGL
GIGVLLVVLLQLLERGIETSDAIEETLGLSTLASIPDANTLPGYRKLGPPAPPAELLLKRPQSTYAEAFRTLRTSIQFAE
AAGPIRVVAITSAVPGEGKTTTAMGLARAVAAAGGKVLLIDADARRRASSRQFADGVKLGLDEVLAGQATLEQAIVKDSM
SGAFLLPQRLDSKGVGLTESPRLAELIEEVRGRYDLVILDTPPVLPVDEARVIASMADGVVFLVRWRKTPAKAASVALRR
LYDVHAEMLGAVLTLVDVREQERAGYEDGGTFLKSYRPYYAD
>gnl|bykdb|A0A095AX64 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingopyxis sp. LC81] (length=733 residues).
MSKMEPSAQMIGDEAGASAAPWAAPILLDYWNALKRHIWVALAIVSVAVVIGTILTLLMTPQFTATSRIEIAREQANVTN
VEGLQREDATPNQEFYLTQYSLLNARSLAERVERRLRLASNKSFFEAHGATPVGEGFLSGGGNAGAVSVDNMRDRQRQAV
DLLLGHISISPVRGSALVDVSYTSASSGISQQIAKTWVSEFAQQSMDRRLASTADARVYLESRLQGLRERLETSERDLVN
YAARQGIVRLSESKSPDGRTQTTQTLASSNLDQLNRFLVEATAERTQAEARLRAARSAGSTQLALQNQSLSNLRAQRAET
NAKYQEMLVHFEPEYADAKAAREQIAALDRAIGAEDKRVRDAYMADYEAASQREQVLRGKVNELLGQLDSESRSSIQYNI
FQREVDTNRQLYDSLLQRYKEIGVAGVGTNNISVVDPAPLPEAPSSPKLLINLVLALLAGAGLAAITIFVLENLDESLRE
PHQVATKLDVPLLGAIPVVNDDALENMDDPKSILSEAYMTVRTNLSFSTDHGVPKTFALISTSPAEGKSTSAYSLARVLG
RTSGTVVLVDVDMRRPILASRLGLESGRGVSNFLAGDDNWEQLVQDTGATNVSFVAAGPTPPSASELLSGERLALFVKQL
ASRFDHVILDSPPMLGLSDAPLIANVVEGVVYVIEADRTAVRASQAAIQRLRESRGHILGVLLTKYSAKQSGYGYGYGYG
YGYGSDKADGEKG
>gnl|bykdb|A0A095B4G9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingopyxis sp. LC363] (length=725 residues).
MDALSRRTSLRQEADPQVDRGALIDLRHIGGILRRRWMVLCAAMVAAIIVATAAYLVAEPRYLATAQVALERTAERVIDV
DAVPPTADPDSAAVDTEVQALRSPELIGRVVDRLRLARDPAFNEAAGQGAPAAQPDLIGRQRAIGALLGGLTVKRDGLSY
AISVSYEGNTPAQAAQIANALVDDYVSGQAGSKAEATQRAQGFLEKRLEELRTQVLGAERAVADYRAANNLFAVSEASTV
TQQELSGLSTQLAQAKAENAAAQARLSAARAQVRGGRSGEELGDSLDSPVVSQLRAQRAEAAREVAALEKRYGPRHPALV
QAQNQLRTADQHIAAEVKRIVANASIQASIANQRAASLAGSVAQTQGKLASDNEASVRLAELERNAESSRTLYQAFLDRY
RQTVAQSGLERSDSYIVSRARVPGAPSSPNMLIYAAMAVVGGLGIGVLLVVLLQLLERGLETSDAIEEALGLATLASIPD
ARTLPGYRKSGLPAPPAELLIKRPQSTYAEAFRALRTSIQFAEAAKPVRVVAITSAVPGEGKTTTAMGLARAMAATGGKV
LLIDADARRRASSRQFAEGVTLGLDEVLAGEATLDQAIVKDSLSDACLLPQRLDSKGIGLTESPRLAELIEQVRDRYDLV
ILDTPPVLPVDEARVIASMADGVVFLVRWRKTPSKAASVALRRLYDVHAEMLGAVLTLVDVREQERAGYEDGGTFLKAYR
HYYAD
>gnl|bykdb|A0A095D3A6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingopyxis sp. LC363] (length=730 residues).
MFSQDGTAAGTHQFWSAPTILEYWNALKRHAWLASAILAVTLVVGVILTLLMTPQYTATSRIEIAREQANVTNVEGLKRE
DSTPNQEFYLTQYSLLNARSLAERVERRLRLSSNKDFFAAHGVTPEGEGFLSSEGSAPVSVERMRGRQRQAVDLLLKNVA
ISPLRGSALIDISYTSASPNISQSVARTWVGEFAQQSMDRRFASTSDARIYLETRLQGLRERLEQSERDLVNYAARQGIV
RLSESKSGEGRTQTTQTLASSNLEQLNRVLIEATAERTAAEAKLRAARSPGSTELALQNQSLNLLRQKRAEAQAKYQDLL
VHFEPEYPEAKAGREQVAALDRAISAEERRVRDAYLSEFDAASQREQDLRQRVNGLLDKFDTESRSNIQYNIYQREVDTN
RQLYDSLLQRYKEIGVAGVGTNNISVVDSAPMPEKPSSPKLLINVIMALLAGLVLAAIAVIVLENLDESLREPGQVSTKL
DVPLLGAIPVVDDDALEKLDDPKSILSEAYMTVRTNLSFSTDHGVPKTMALTSTSPAEGKSTSAYSLALVLGRTSGSVVL
VDVDMRRPILASRLGLQNLRGVSNFLAGDDSWEQLIQDTGKSNVHFIAAGPTPPSASELLSGERLALFVQKLASRYDHVI
LDSPPMLGLSDAPLIANVVEGVVYVIEADRTAVRASQSAIQRLRDSRAHLLGALLTKYRAKQSGYGYGYGYGYGYGRDGA
EDDSVGGVRN
>gnl|bykdb|A0A095DLH1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia cepacia] (length=756 residues).
MNTPAIPEREIDLIRVLDTLRNARGTIAAIATACIAAGALYAFVAPPTYQADLMIQTDDATDTASKNLLGDAASFFNVGS
PASAEAQILSSRLVVTRAVEDLRSYIVAKPSRVPVLGAFVARFNDGAVSPGVLGFGGYAWGQERIDVARFDVPTRAEGDT
FHVVRLDATRYRLTGPDMTADAVGTVGAAETFATRYGPLHVEITGFDALPGTRFKLIRQSRAETIDTLRTALDVQEKVKQ
SGVLVASLRGNDPAEISATLNAVANRYVEQNIARRSAEAAQSLTFLNTQLPLVKQQLERAETRYASLRSRTGSVDLAEEG
KLVLQQGADLQTRMLELQQKRDELSKRFLPTHPDMAALDAQLATLKRQQGALDTRIARLPAQQGEEVRAQLDVKVNTDLY
TALLNNIQQLELVQAGRTASVRVVDSAVAPADPVRPNRPVVITAAALVGLALGVIAAFAREFLYGGLTAVDEIERHTSLP
VRAVLPAAAHQRRLMRAVERRDAGLHVLAYDDPYEPAIEGLRSLQTALHFSLADIEHPLVLITGPTPGTGKSFVSVNLAA
VQASSGRRVLLIDGDLRKGYLHQYFGLERGPGFAELLGGNASADDVVRRGVAPNLDFLPTGELPSAPTALLQHAHTGELL
ASLRARYDLVIVDSAPLLAATDATWLDTHADATLLVARAGSTRAGELTESAKRLPQRPGRVPAVVLNGLDPRSGASAFGS
KYGGYRYEAYRYTCDTRCTHLARLRAALQRLLRRSA
>gnl|bykdb|A0A095EAX6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia cepacia] (length=741 residues).
MVNTQAKHSYADLTAKTEEEDVVLGQLLQVIMDDIWLLLGIAVTVVALAGLYCFIAKPVYQADVHVRVEGNDNTSQALTQ
TQTGASINSGPQQAPTDAEIEIIKSRGVVAPVVDQFKLNFTVAPKTLPVIGSLAARLATPGTPSRPWLGLKSYAWGGEVA
DIDTINVVPALEGKKLTLTAGPNGTYSLVDENGTRLLAGRVGESAQGGGVTLLVQKLVARPGTQFTVVRYNDLDAISGFQ
AGIQVSEQGKQTGVVQISLEGKDPDQTAAIANALAQSYLNQHVVAKQAEATKMLDFLKGEEPRLKADLERAEAALTQYQR
TSGSINASDEAKVYLEGSVQYEQQIAAQRLQLASLAQRFTDSHPMVIAAKQQLAELQGEKDKFSNRFRSLPATEVKAVQL
QRDAKVAEDIYVLLLNRVQELSVQKAGTGGNIHLIDSALRPGAPVKPKKVLILSAAVFLGLILGTGVVFLRRNLFQGIED
PDRIERAFNLPLYGLVPQSAEQVKLDAAAEKGGSRARPILASLRPKDLSVESMRSLRTAMQFAMMDAKNRVIVLTGPTPG
IGKSFLTVNLAVLLAHSGKRVLLIDADMRRGMLDRYFGLTVQPGLSELLSDQSALEDAVRETPVQGLSFISAGTRPPNPS
ELLMSTRLPQYLEGLGKRYDVVLIDSPPVLAVTDATIIGRMAGSTFLVLRSGMHTEGEIADAIKRLRTAGVDLEGGIFNG
VPPKARGYGRGYAAVHEYLSA
>gnl|bykdb|A0A095EL63 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia cepacia] (length=741 residues).
MVNTQAKHSYADLTAKTEEEDVVLGQLLQVIMDDIWLLLGIAVTVVALAGLYCFIAKPVYQADVHVRVEGNDNTSQALTQ
TQTGASINSGPQQAPTDAEIEIIKSRGVVTPVVEQFKLNFSVAPKTLPVIGSLAARLATPGQPSRPWLGLKSYAWGGEVA
DVDSISVVPALEGKKLTLTAGPNGTYSLVDANGTRLLAGRVGESAQGGGVTLLVQKLVARPGTQFTVVRYNDLDAITGFQ
SGIQVTEQGKQTGVVQISLEGKDPDQTAAIANALAQSYLNQHVIAKQAEATKMLDFLKGEEPRLKADLERAEAALTQYQR
TSGSINASDEAKVYLEGSVQYEQQIAAQRLQLASLAQRFTDSHPMVIAAKQQLAELQGEKDKFSNRFRSLPATEVKAVQL
QRDAKVAEDIYVLLLNRVQELSVQKAGTGGNIHLVDSALRPGDPIKPKKALILSAAVFLGLILGTGVVFLRRNLFQGIED
PDRVERTFNLPLYGLVPQSAEQVKLDAAAEKGGTRARPILASLRPKDLSVESMRSLRTAMQFAMMDAKNRVIVLTGPTPG
IGKSFLTVNLAVLLAHSGKRVLLIDADMRRGMLDRYFGLTSQPGLSELLSDQSSLEDAIRETPVQGLSFIAAGTRPPNPS
ELLMSTRLPQYLEGLGKRYDVVLIDSPPVLAVTDATIIGRMAGATFLVLRSGMHTEGEIADAIKRLRTAGVDLEGGIFNG
VPPKARGYGRGYAAVHEYLSA
>gnl|bykdb|A0A095F5B9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia gladioli] (length=745 residues).
MIQAPAPSQHTTEDGSETDFVAVLDILLESRWLIASITCVVLFAGLSYAIFSKPVFEANIMVQVEDSPDTSAAKSLLSDV
SALFDVKSSAAAEEQILASRLVVERAVDKLKLFIDVSPKRFPLIGDWIARHHDGLSDPGLAGFGGYAWGAEQIDVARFDV
PIRNEGDTFTLTALAGGRYRLEGGDLDAAVEGTVGKLEHFPSPRGPIVLQIASVTAKPGAAFLLVRNSRLKTVEDIRDRL
NVQERVKQSDVVVASLQDTDPKWVSDTMNEIGRQYVRQNIERKSAEAAQSLEFLTAQLPQLKQQLADSEARLTKLRNERG
TVDLSEEAKLALAQTADARTRLLELQQKRQELMSRFTARHPSVVAIDEQIAALGAYRGEAEQQIRRLPDLQQETVRLMLD
AKVNTDLYTALLNNMQQLQLVQAGKVGNVRLVDTAAVPEVAVRPKKVLVALASLLLGLLAGCGTAIVRSMLFHGISDHNE
IERRLGLAVYATVPNSEHQRELAQEAARKRGHQSILSIAFPGDPAVECLRSLRTALQFAMLEAKNDIVLIAGPAPNVGKT
FVSSNLAVLMAGAGKRVLLIDGDIRKGCLHDYLGVPRGRGFTDLVEGSACVDDVVRRDVIEGIDFISAGTMPKNPGELLL
NPSLATRLGDLSSRYDIVVIDSAPVLAVPDTGILGALAGTALLVTMAGKTKLGEIGESAKRFAQNGVRLNGIVFNGVNPR
LGQYGYGSKYGGYRYIPYEYGTQDA
>gnl|bykdb|A0A095FCS2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia gladioli] (length=740 residues).
MNTQVKHPYADMAAKPDDEDVVLGQLIQVILDDIWLLLGIAALIVALAGVYCYLAKPIYSADAHVRVEAADNTSQALTQT
QTGAVINGGPATPATDAEIEIIKSRGVVGPVVEQCKLNFSVAPKTFPLLGAISARLAAPGKLAKPWLGMSSYAWGGEQAA
VDSIDVTPALEGKKLMLTAGADGAYTLANEDGGLLLRGRVGERAEGNGVSLLVSQLVARPGTQFVVVRQNDLDAITAFQS
AIQVSEQGKQTGVVQISLEGKDPVQTAMIANALAQSYLQQHVNSKQAEANKMLDFLKSEEPRLKSDLERAEAALTEYQST
SGSINASDEAKVYLEGSIQYEQQIAAQRLQLASLEQRFTPEHPMVIAANQQLAQLQKERDKYADKFRSLPATEVKAVALQ
RNAKVAEDIYVLLLNRVQELSVQRAGTGGNIRLVDAALRPGVPVKPKKALILSAAVILGLIVGTGVVFLRRNLFHGIEDP
ERVERMFNLPMYGLIPKSVELERLDAAAQKSGSDMRPILAVARPKDLSVESLRSLRTAMQFALMDAKNRVMVLTGPTPGI
GKSFLTVNLAALLAHSGKRVLLIDADMRRGALDRYFGVPRRNGLSELLSDQIALEEAIRETQVPGLSFIPTGQRPPNPSE
LLMSPRLALYLDGLGKRYDAVIVDSPPILAVTDATIFGVLAGSTFLVLRSGMHTEGEIGDSIKRLRTAGVQLQGGIFNGV
PPRTRGYGRGYASVHEYLNA
>gnl|bykdb|A0A095FT16 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia cepacia] (length=765 residues).
MTSTPLHERSHDRDTELDLAGAIDVLVAQRWLIAAVTAACVGAGSLYAFLAPRQYQADIMVQVEDSGDTSAAKSVLGDVS
SLFDVKSSASAEAQILASRLVVTRAVDELRSYIVVQPKRFPIVGEFASRFNAGVARPGVFGLGGYAWGKESAELARFDVP
KSFEGERFELSMLDAGRYRLAGAALPAPVVGTIGEPQTFGTADGPVAIDVARIDALPGTRFTLVRESRAETIDTLRRGLD
VQEKIKQSGVIVATLRGTDPQRVQAQLQAVAHHYIRQHIERKSADAAQSLAFLNAQLPVLKKQLQDAEQRYTNLRNANGT
IDLDAEAKQLLQQSADTATRRLELQQKRDEMASRFAPGHPDMVALDAQLATLAREQRAFEHRVRGLPDLQQEAVRLMLDV
KVDTDLYTALLANAQQLELVRAGKTGSVRIVDMPIVLEDAVRPNRPVVIAAAALAGLVLGVALAFVRDHLYGGVRDADEI
ERHLGIDVYATVPASAGQRRVARRSAQRLPAPHLLSALDPHDPAIESLRSLHTALRFAMHDARNNVLLVTGPVPDAGKSF
VAANFAALLAAGGERVLLVDGDLRKGYLHESLGMPRESGLAELLSGDVTPEDAIRRDVLPNLDFIATGAMPEHPAQWLAD
ARVEALLDGLSAHYDRVVIDAAPILAVSDAVALGRHAGTVLLVARAASTRIAELGEAARRLAHNGVAASGVVLNGVDPRT
TRYGSRYGAYRYAQYRYAPSRSRAAWPARRALQALAARFRRGGER
>gnl|bykdb|A0A095G5R0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia gladioli] (length=777 residues).
MNTPNLNARHSVGLPDEMPDPLGMLRLLRDHAWTVAAITAAVVALAGIYVWLASPVYSASAMIRVEAQGRNALGFAADGQ
QLVVGQGTGRTDAEIGMLQSRSILDPVVNQYGYEIATAPHTLPILGAIARKFATPGRPSRPWFGLDSYAWGGERIDIEAM
QVPPELENRKLRLRALGDGAFALIAPGGAVLLTGKAGETAQMDGVSIRVRRLDARPNTEFDVTAWNGVNALQRFSKQLKI
LEKGSGTGLVQITFASDRPDRSADVANAIAQGYVAATIAESRANDGKTLDFINRELPRLREELRQAEASLMGYQASTGSL
QPTAEAQSYLQGAIEVERQIAMLQLQRTQMAQNFTPDSAPMRNIDQQLAQLTATKARFDARFVRMPESERTNADLSRNAK
VAESIYIAMVNKAEELTVRRASTTGDVHIVDNAVRPADPVSPAVPIIMASSLGLGLMLGTLFVFLRSRYLTGVTDSKFIE
RSLRMPMLASVLYSAQQARLDQAMPRNLAFQPAEARLQRRPALLPSARTAAGAGSAAESLQPASSQYLLARSFPHDASVE
ALRGLRTALHLHFQQEARPDDGVIVLTGPTPDTGKSFVAANLSVLEAETQKRVLLVDADMRCGRLASFFGKPNAGGLAEL
LAGRIEIDQAIQPAGVPGLSLISCGRYPGNPSELLMMPAFRRLLDEFKQRFDLVIIDTPPLLAVSDAAIVSHGGGKTVLV
LRSGMHTEDEIEETITKLDRAGAWTVGAIFNAVPLRRSERLGYGYSSAYLNHSSAVA
>gnl|bykdb|A0A095I8P1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia pseudomallei] (length=739 residues).
MVNTQAKHPYADLAVKTDEEDVVLGQMIQVILDDIWLLLGIALVVVALAGLYCYVAKPLYSADAQVRVEASDNTSQALTQ
TQTGAMINSGPPTPPTDAEIEIIKSRGVVAPVVEQFKLNASVTPNTLPILGAIAARLATPGHPGKPWLGLSSYAWGGEEA
SIDSIDVTPALEGKKLTLTAGADGGYALADPDGAVLVRGKVGEREQGGGVTINVSKLVARPGTRFTVVRQNDLDAITAFQ
SAIQVAEQGKQTGVIQISLEGKDPEQTAQIANALAQSYLHQHVTSKQAEATKMLEFLKNEEPRLKSDLERAEAELTQYQR
TSGSINASDEAKVYLEGSVQYEQQVAAQRLQLAALAQRYTDEHPLVVAAKQQLGQLEAERAKYDGKFRGLPATEVKAVAL
QRNAKVAEDIYVLLLNRVQELSVQKAGTGGNIRLVDAALRPGVPVKPKKVLILSAATLLGLILGTSVVFLRRNLFHGIED
PDRVERAFNLPLYGLVPMSAEQARFDAADKGNRVRPILACARPKDLSVESLRSLRTAMQFALMDAKNRVIVLTGPTPGIG
KSFLAVNLAALVAHSGKRVLLIDADMRRGSLDRHFGTGGRRGLSELLSDQVALEEAIRETSVPGLSFIPSGARPPNPSEL
LMSPRLSQYLDGLAKRYDMVIVDSPPILAVTDATIFGELAGSTFLVLRSGMHTEGEIGDAIKRLRTAGVQLQGGIFNGVP
ARTRGYGRGYAAVHEYLSA
>gnl|bykdb|A0A095S983 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Alcanivorax jadensis T9] (length=738 residues).
MADNSTMTQRQQVSPGGDEIDFGYLFGILLDNKWLIVITALLALGLGALYGMFATPIYKGDTLLQLEKKSSGVPGLSELN
NIFAEEASAAAEIEILRSRMVLGEVIEQLKMNIRVFPDRPAYIGRFMGPDPAPAFVPKPLFAGYRDSETFVTVTNFMVPE
RLEGRAFTLLEENGKPALYMGHDLVATGSVGETLKSQDGSIQLVLNEWQFGNEPLTLVKLTEVAAVNGLRGALAIREVGK
TGLLSLTMTGPSKERIKATLDAISEAYLLQNVERRSAEAENSLEFLGEQLPKIKEKLTEFEEKLNAYRLESESVDLSLET
QSVLQQSVDIEAKINELKAKEGELATRFTKEHPAYQSLLRQKASLTEEKRSLDKQIKSLPETQQEILRLMRDVEVTQQIY
IGLLNKTQELRILKAGTVGSVRIIDKALVQPGPIKPKKAVIALIAGFLGAIGSAGIVLMLALLKKGIESPEKLEEQGVSV
YATIPLSEKQVKANRATDMKQRRSRRLKEGATPIPLLAQDDPTDLAIEALRSLRTSLHFAMMDADNKILMITGPSPTVGK
SFVSANLGAVLAQTGQRVLLIDADMRKGHLHRYFQSDNKVGLSAYLAGQSSKDDIIQSSVIANLDFIPRGKAPPNPSELL
MHERFKSLMGSLSDEYDLILVDTPPILAVTDAAIVGQLAGSSLLVTRFGLNSVKEVDAALTRFAQNKVEIKGAILNCMER
RATNEYGYYAYEYGKSSD
>gnl|bykdb|A0A095SFW4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Alcanivorax nanhaiticus] (length=738 residues).
MVDNSLEKNRQIHNGAHDDIDFGYLFGLLLDNKLLIISTAFLALMLGALYGMLATPIYKGDTLLQIEKKSSGVPGLSELN
QIFDQEPSASAEIEILRSRMVLGEVIEQLNMDIQIAPTRLPIIGRFVAPEPAAAFLPRPLFAGYRDSETFVSVALFILPE
RLEGREFILREEKGNPALYLDESLVATGPASEAIVSEDGSIRLELNEWEYGNEPLSLRKVPGVVAINSLRRSLAIREVGK
TGMLSLEMTGPNKGRIKAILDAISQSYLQQNVKRRSAEAENSLEFLGDQLPKIKDKLTEFEEKLNAYRLKSESVDLSIET
KSVLEQTVSIEAKINDLKGKESEIATRFTKEHPAYQSLLRQKASLAEQKRALDNQIKTLPKTQQEILRLMRDVEVTQQIY
VGLLNKVQELRILKAGTVGSVRIIDEALVQPSAIKPKKTLVALIAGVLGAMSAAGIVLVRALLNKGIESPDKLEEQGVAV
YATVPLSDKQVKANRLSSLKQRRTRKSKDSFAPIALLAQEDPTDLAIEALRSLRTSLHFAMMDADNKVLMITGPSPEVGK
SFVSANLGAVLAQTGKRVLVIDADMRKGHLHRYFKSASTPGLSSYLSGQSSMEDIIQASGVDKLDFISRGKAPPNPSELL
MHDRFRVLVDSLSEEYDLILVDTPPILAVTDAAIVGQLAGSSLLVTRFGLNSVKEVDAALTRFAQNRVEIKGAILNCMER
RATNEYGYYAYEYGRSQD
>gnl|bykdb|A0A095TDI9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Tatumella morbirosei] (length=720 residues).
MSSTVTNKTASPDSDQIDLGRLVGEIIDHRKLIISVTALFTVLAIVYSLFATPVYQADALIQVEQKQGNALLSSLSQMLP
DSQPESAPEIALLQSRMILGKTVDDLNLQAQIEQEYFPIFGKGWARLTGHKEGKLTVSRLYVANQDGKTPSLLVTVGSNG
QYTLTGGEYNLTGHIGKLLEARGISILVSDYNAEKGTKFKINYITRLAAINTLQQSFSAADQGKDTGMLNLVLSGENPER
IKEILQSISDNYLAQNIARQAAQDTKSLDFLNKQLPQVRSDLDAAEDKLSAYRKRSDSVDLNMQARSALDQIVNVDNQLN
QLTFREAEVSQLFTKDHPTYRALLEKRQTLIQEKAKLNKQVSGMPATQQEVLRLSRDVDSGRAVYMQLLNRQQELNIAKN
SAIGNVRIVDDAVTEPKPIKPKKTLIVLIGIILGSFISVAVVLLRVFLRRGIESPEQLEELGINVYASVPVSEWMARQTP
KRSLKVKGKQKENTSFLAVDNPADLAIEAVRSLRTSLHFAMMEARNNVLMISGASPNAGKTFITTNLAEVIAQGGQRVLF
IDADMRKGYAHQIFKHSTDHGLSDILSGKSTVSQGIKPVSGAGFDFIARGAIPPNPAELLMHSRFRELIDWASQNYDLVL
VDTPPILAVTDAAVIGRYAGTTLLVARFEQNTAKELEVSIRRFEQSGVEIKGCILNGVIKKASSYYGYGYNHYNYDYNSK
>gnl|bykdb|A0A095TT74 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia pseudomallei] (length=746 residues).
MNPNPTGTSTPADSEGDTDFIAVLDILIEGRWLIAAIALGVFIVGVAYAVFSKPVYQADILIQVEDSPDTSAAKSLLGDV
SSLFDVKSSAAAETQILASRLVVSRAVDNLKLFIDAKPKRFPVIGHWLARRSEGLSDPGLAGFGGYAWGQERIDVATFDV
PRAMEGDTFELTMLDARRYRLDGGDLERGAVGVVGRLERIAAKGGPIALRVDAFAAKPGATFVLVRHSRLRTIEALQDNL
DVQERVKQSDVVVASLRDTDPDLVSRALNEIGRQYIAQNIQRKSAEAAQSLEFLNGQLPTLKQQLTDSEARLTKLRDEHG
SVDLTEEAKLVLAQSADAKTRLLELQQKRQELLSRFMPKHPSVVAIDQQIAALDGYRGTAEQQIKRLPALQQQFVRLMLD
VKVNTDLYTALLNNMQQLQLVRAGKVGNVRLVDTAAVPEVPVKPKKALVALASLLLGVLAGCGTAVGRSMLFHGISDPNE
IERRLGLSVYATVPRSDRQRALTERAKHKARALSLLCVAHPDEPAVESLRSLHTALQFAMLDAKNNVVVIAGPAPGVGKS
FVSANLAAVLTMAGKRVLLIDGDIRKGHLNDYLGLARGKGFSELIAGSAQPDDVLHRDVIAGLDFISTGAMPKNPAELLL
NARVSTLIDTFSQRYDAVVIDSPPVLAVADTGILAATAGTAFLVTLAGSTKLGEIAESAKRLAQNGVRLSGVVFNGINPR
LGQYGYGSKYGGYRYVAYEYGAKRDA
>gnl|bykdb|A0A095UKV1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Achromobacter sp. RTa] (length=753 residues).
MSLPIESFEPSVPARQQETPLTSHVDAIFSNRWMIIAITLLAFVGALAYVMVTPKVFSADIIVQVEEEMPQGQSRSLLGD
VSTMFDTKAETSGEMEVLRSRMVVGPAVDKFLLYIHAKPRYFPVVGEWLAQRYESLPYPSSLPRGGYAWGGEAIAISQLD
VPNEWLGKPFRVTTLGEGRYTLSDKLTGATFNGTVGKPEHFLLPGGGAMDVHIDALTGRPGTEFTVSRSSRLAAIEDVQS
RLGIFERGRTSGVIGVTLEGNDPALTTAVLNQIGQEYVQQNVNRKSAQAEKSLVFLEQQLPILKGELDAAETKYNSLRNK
RGTIDLSEEAKLILAQSVDAQTKVMELRSKRQEMITRFAPTHPSIVAIDRQISALTGDVNRIGNNIRQLPDLEQDVVRLV
RDVRVNTELYTALLNNAQQLRLIRAGKVGNVRILDAAVQPDKPVRPKAAIIIGVATAFGLIFGMLCAFVRNALFGGLSEP
DDVERHTGLPVLAAIPYSDMQDKLWRRSRRKNATVPALLAQSQSNAPPIESLRSFRNVLQASLRQSANNMVMFTGPVAGV
GKSFLSANFAFIQGGVGKRVLLIDADFRKGQLNRYFGVPKEDGLFEVLSGTIPLSRVRKHSVSEGVDFIATGAVTFDPSE
LLASPVFGETLRELASQYDMVILDTAPVLSSPDAAVVGTHAAAVMVVVRSGMNTVGEIRETAKRLIQAGAPVDGVLFNGL
KLLPERFGFRSKYGSYRYSRAAYYGDFKQNGPK
>gnl|bykdb|A0A095X9Q2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhizobium sp. YS-1r] (length=785 residues).
MDQVNFRPRTIFPGETRDSDTFIDLDKLWAAAFRRLGVIVVCLIATVTLAGLYLLTAQPTYTAMTQILIDENLSRYAEDE
RDSQTAQQIDNRMSSAVEILKSKALALRVVDKGRFDQNEILVNPPQSPVALAKGAVRSIVALVTPGDPPLSEELARMGRR
EKAAAVLQQSLTVERVGRSSVIAVSVRSPDRQLSASIARTYADSYLTDQLNANFDASERASLWLQERLNDLNSRSQQAAL
AVEQYKIEHNLVSPRGELLSTQQLSDLNSQLIVAQADAAAASARYEQYKAITDKGPDAAVQNAVVSARDTDNTVIQDLRK
RYIAINDREQGVIQQFGADHPQAVALKAEKNDVAQQIYRELQQLMGSFRNEFEVASSREKSLRDSIDRVAGRNSEANVSM
VQLHELEQKAAALKSLYESYLGRFEEATQRQSFPIAKARVISDAGIPTAPSSPRKTLTMALSIVLGLLIGGAAATLLEFR
ERFFRTGDDVQDKLGQRFLGYLPRVSNALVEDKSTSSAPPAPPTESEAAGVPAGNPISSRRLMRIAVEAPRSQFAETLRN
TKLACDIMLQDRKCRVIGVVSCLPGEGKSMVAANFAGLLASTGVRTLVIDADLRNPGLSRMLGSEPEVGLVEVILQKTSW
TSAARVDRRSRLTILPMTMRSRNLAHTSELLASSGMSQFLESIKETFDVIVVDLAPLIPVIDAKAFEPYVDGFVFVTEWG
ATPAKAVQSVLRSEPQIASKTVGVILNKTEMSELHKYADPGAPERLRSSYLSYYKDKEGAVPASR
>gnl|bykdb|A0A095XAK3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia gladioli] (length=741 residues).
MVNTQVKHPYADMAAKPDDEDVVLGQLIQVILDDIWLLLGIAALIVALAGVYCYLAKPIYSADAHVRVEAADNTSQALTQ
TQTGAVINGGPATPATDAEIEIIKSRGVVGPVVEQCKLNFSVAPKTFPLLGAISARLAAPGKLAKPWLGMSSYAWGGEQA
AVDSIDVTPALEGKKLMLTAGADGAYTLANEDGGLLLRGRVGERAEGNGVSLLVSQLVARPGTQFVVVRQNDLDAITAFQ
SAIQVSEQGKQTGVVQISLEGKDPVQTAMIANALAQSYLQQHVNSKQAEANKMLDFLKSEEPRLKSDLERAEAALTEYQS
TSGSINASDEAKVYLEGSIQYEQQIAAQRLQLASLEQRFTPEHPMVIAANQQLAQLQKERDKYADKFRSLPATEVKAVAL
QRNAKVAEDIYVLLLNRVQELSVQRAGTGGNIRLVDAALRPGVPVKPKKALILSAAVILGLIVGTGVVFLRRNLFHGIED
PERVERMFNLPMYGLIPKSVELERLDAAAQKSGSDMRPILAVARPKDLSVESLRSLRTAMQFALMDAKNRVMVLTGPTPG
IGKSFLTVNLAALLAHSGKRVLLIDADMRRGALDRYFGVPRRNGLSELLSDQIALEEAIRETQVPGLSFIPTGQRPPNPS
ELLMSPRLALYLDGLGKRYDAVIVDSPPILAVTDATIFGVLAGSTFLVLRSGMHTEGEIGDSIKRLRTAGVQLQGGIFNG
VPPRTRGYGRGYASVHEYLNA
>gnl|bykdb|A0A096EGI9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Comamonas thiooxydans] (length=728 residues).
MYDDEIHLIDLLDVVFDSRWLIAGITALALCIGFAYTLLSPPVYQTDILIQVEDTKVIGANGLLNDVSSMFDIKSPAVAE
IEILRSRMVIGEAIANLHLDLEVTPKYIPLVGRWLARRATGLSEPGFLGMDGYVRGTEALQVANFTVPKSLEGKVHTVVL
TEKGYQLVSPDGELLGEGTIGKSMHIQYPEGEGSLLVVGANGKAGAAFYVTRYSKADVIGQFQDKISIGEKGKQSGMIRS
TLEGSDPLQISQTLNEIGRLYVSQNTQRKAAEAAKSLAFLETQLPQLRKELEESERKFNQYRSQNNVFDLEGEAKVMLDH
GAKLHISLVELQQKRKEIEARFTSAHPSLQIIDNQINSINAELAKLNSRARTFPSVEQDLLRLTRDVKVNNELYISLLNS
VQQLRLVKEGRVGNVRLVDEAIVPELPVKPRSALIVVLSTVLGLIVGLGLSFARNNLRVGLKDPSEIEQHSSLRVLATIP
HSEVQAEQAKAIAGKLPGNHVLAIQAPDDPVVESMRSLRTALQFVMLDMPSSLVLFTGPTQGVGKSFTSVNFATIVAAAS
KRVLLIDADLRKGHLNSYFGQGRTGGLSEVVSGSMAFGDAVRREVVPNVDFLSTGILPPNPAELLTNSATQALLKQVATQ
YDFVVLDAPPVLAASDAAILAPLVGAVFMLARAEVTSLGELQEASKRLAQAGAEVRGVVFNDLHMATRRYSYGLGYRHGK
YRYVNYEY
>gnl|bykdb|A0A097ELE4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas taxi] (length=738 residues).
MNVLTSNLGAGVSMAVPPADQTASSANQLPPIRQYLRMAFRRRYVILGAIAAMFLLGIVGTLLMTPKYTATATIEIARES
SQVTNFQGVERETGLADQEFYQTQYGLLRSRSLSERVAAQLRLIDDPSFYALFRIDRKDSAFQLVNGRYPAAGRDVRQRV
AGEILRGNLSVAPARLSRLVEVRFTSPDPAFSAKVANAWAESYIQINLERKIQATSYGRNLLRRQLAQQKEQLDESQRQL
VAYASRERIINLPGQRGADGSTSERSIVADDLGTLNSALAQATAERIAAEARYRETGAGASTEALRNPAINTLRQRRAEL
RAEYQRLMTQFEPSYPAAQAVQSQIDQLDRSISTEERRATGSLEADYRSAVERERVLQVRVEQLKGSYLDLRRRSIQYNI
FQQEVDTNRALYEGLLQRFKEIGVAGGVGVNNIAVVDQADVPQRPSSPRLLINLALSLIAGTVIGVGLAFALERMDEAIA
DPTEVEQRLGLPLLGSVPKVEGETPKDALLDRKSDLVDAYLAIQTNLAFTTEHGVPRSFAVTSTRPAEGKSTTALALATT
LARGQRKVILVDGDMRSPSVHHLGGVDHARGLSNFLAGEDQIETLTFDMADLGFTAMSAGPIPPNAAELLTGNRLSTLIE
RLLESYDHVVIDSPPVMGLADAPLIASRVEGVVYAVESHGIRSTLVKTALGRLVSANARIFGGVLTKFEARRAHYGYGYE
YGYGYGRDKAAQAKQSRA
>gnl|bykdb|A0A097ELF9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas taxi] (length=714 residues).
MNKMSTLAEQEEASRFDQSRHVGRRAVTLKSVGEAIRRRWIIVVVTALVVFAAALGTALMLTPKYDAFAKVRITPNAASP
LDFGNGTEQPADQTAVNTEVQVIGSRATARKVVTQLGLDRDPEFTGKGPANTAIERATSGVLEHLKINRDDKSYLVLIGI
RSIDGAKAARIANTYASTYVAGTADNLMGTAAKQSQSIQNRLRELGAEVQTADARLASYRAQSGISQSGEGGTITDQQIA
PLSMQLATAESEAAAARSAVSVAERQNATGGTDAISAVLSSGVIADLRRQRTEAEKRRAELSSRYGPRYPLSIQVAQQIE
SLDAQIRQEAQRVVGGLRSQALSAEARAASLRNRLNTLQRGVARDDQASVMAGSLERDAEAKRTAYTRLAQAAQQSTQAQ
RVSTPQANIIENATIPTKPTFPQVKAFAAAGLLIGLVFGLAGVLLFEGLSSTIRKPEDIETMLGLPFVASVPRLPTPWKL
RSRRVANPATTLVAKPMTVYAEAYRAIRSFIVSRNQSQPTQVIALASTLPGEGKTTSALSLARIMALSGDRVLLIDCDVR
RAGVLRALNRSVDTGLADVLEGRASMAQAVIPDEVDGLDLLLVQGSLFTPIDLFGGGRMEAMLAEARGRYDFIILDTPPL
LGIADARTLVGLADAVMLVIKWNTTPIAAVDAALAGLEQSQGEVLGAVLTMVDHRSEAMGGLYYSARYSSYYNE
>gnl|bykdb|A0A097I5A3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter baumannii] (length=731 residues).
MFKLMNQNTNTEDTIDLKELFFSLIAQWKLIALCVILSLVCALLYLRVTPDTYSVDALVQVEDSKGASAALLGDLSQMIE
QKSPAQAEIEILKSRLVLGSVIKDLHLNIQVSSTENTFTHRLLSNPEYKTEYTKKSVIFKDGLKSFDIHQFDIPAYYLDK
NLFLDFDKQSFRLTDPKTEEVILTLPLNQLNQVTGPHGTWKVAIFTKDQFDATYNIRNLSLPAAVNSISSNYSVAERGKL
TGILGLNYQGQDQEHITKVLNAILATYSAQNIERRSAESAQTLKFLDEQLPDLKKQLDDAERQFNKFRQQYNTVDVTKES
ELYLTQSITLETKKAELEQKQAEMAAKYTAEHPAMREINGQITAINKQIGELNSTLKQLPDVQRQYLQLYREVEVKTQLY
TALLNSYQQLRIAKAGEIGNVRIVDTAVEPIEPIKPKKLQILVLALFLGGFIGALVALLRNMLRTGIKDSSQIENELNLP
VYATVPRSPIQESRIKILKKKKSIPILAVKNSDDIAIESLRSIRTAIHFALANAKNNIIMIAGPSPEVGKSFISTNLATI
FAQGDKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQADLQKVLHKTQVANLDVITRGKSPTNPSEILSSNQFKELLE
QLQSQYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSQMKELELTVNRFEQAGVKVNGFILNDIQRASAGYGYGYN
YAYAYKAQKED
>gnl|bykdb|A0A097I5G1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter baumannii] (length=728 residues).
MNQQNTNTEDTIDLKELFFSLIAQWKLIALCVILSVVCALLYLRVTPDTYSVDALVQVEDSKGASAALLGDLSQMIEQKS
PAQAEIEILKSRLVLGTVIKDLHLNIQVSSTENTLTHRLLSDTDYKTEYTKKSVLFKDDLKSFEVREFEVPAYYLDRNLL
LNFDKQSLRLTDPDTEEVILTVPLNQVNQVTGPHGLWKVAIFTKDQFDATYNIKIQSIPAAVNALSANYSVAERGKLTGV
LGLNYQGQDKEHITKVLNAILATYSAQNIERRSAESAQTLKFLDEQLPDLKKQLDDAERQFNKFRQQYNTVDVTKESELY
LTQSITLETKKAELEQKQAEMAAKYTAEHPAMREINGQLAAINKQIGELNSTLKQLPDVQRQYLQLYREVEVKTQLYTAL
LNSYQQLRIAKAGEIGNVRIVDTAVEPVEPIKPKKLLVFILSVFVGGFIGALIALLRNMLRSGIKDSGQIENELDLPVYA
TVPRSPIQESRIKILKKKKSIPILAVKNSDDIAIESLRSIRTAIHFALANAKNNIIMIAGPSPEVGKSFISTNLATIFAQ
SDKRVLLIDADMRRGYMHKYFDVDVKPGLSEFLSGQADLQNVLHKTQVANLDVITRGKSPTNPSEILSSNQFKELLEQLQ
SQYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSQMKELELTVNRFEQAGVKVNGFILNDIQRASAGYGYGYNYAY
AYKAQKED
>gnl|bykdb|A0A097LFX9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter baumannii] (length=727 residues).
MNQNTNIEDTIDLKELFFSLIAQWKLIVLCIILSLICALLYLRVTPDTYSVDALVQVEDSKGASAALLGDLSDMIEQKSP
AQAEIEILKSRLVLGSVIKDLHLNIQVSSTENTLTHRLLSDTDYKTEYTKNSVIFKDGLKSFEIRQFEIPAYYLDKTLQL
NFNKQSLRLTDPATEQTLLTVPLNQLNQVTGPQGIWKVSIFTKDKLDTTYNITSLSLPAAVDTIGSNYSVAERGKLTGVL
GLNYQGQDKEHITKVLNAILATYSAQNIERRSAESAQTLKFLDEQLPDLKKQLDDAERQFNKFRQQYNTVDVTKESELYL
TQSITLETKKAELEQKQAEMAAKYTAEHPAMREINGQLTAINKQIGELNSTLKQLPDVQRQYLQLYREVEVKTQLYTALL
NSYQQLRIAKAGEIGNVRIVDTAVEPVEPIKPKKLLVFILSVLAGGFIGTLIALLRNMLRTGIKDSGQIENELDLPVYAT
VPRSPIQESRIKILKKKKSIPILAVKNSDDIAIESLRSIRTAIHFALASAKNNIIMIAGPSPEVGKSFISTNLATIFAQG
DKRVLLIDADMRRGYIHKYFDVEVKPGLSEFLSGQADLQKVLHKTQVANLDVITRGKSPTNPSEILSSNQFKELLEQLQS
QYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSQMKELELTVNRFEQAGVKVNGFILNDIQRASAGYGYGYNYAYA
YKAQKED
>gnl|bykdb|A0A098FQM3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas xanthomarina] (length=738 residues).
MTTMPRPIYETKEDKDIDLAHLFDTFINNRLLILGITGFFAALGIAYALLATPVYLASAMIQIEPKNGLPSLTDVVNTNP
PVSPAQTEIALLKSRSVVGGAVASLNLDIQITPHHFPIIGGFMARRFEPSEEGELGWHPAGLGAYAWGGETLKVTQLEVP
DKVHGKELTLEAAENNGFILRDEDGEVVVQGVVGEPVETEDYRVTVAELNARPGTTFTVVKNRTYNTTESYQQRLSAAER
GKQSGIVNVTLEDPNPEHAIRVLEEVASRYVDQNVARNAAEATQSLEFLNEQVPAVRKKLEAAQTALNKYQTGSGSVDIT
AETQSVLDRIVDLEKQISEQNLKRTEMERRFTRQHPNFQALMNQINQLQMQKEELEKQIGTLPSTQQELLRLTRDVEVSS
ETYSMLLNKTQELDIIRAGTVGNVRIIDHAAADLENPVKPNKPLVVIVATLLGALLATAFVYVREALKRGVENPEDIERT
GTPVYASIPFTDKQAALEKRLANFKRDKSTASYLLTINDPADLATEAMRSLRTSLHFAMIEAKNNVLMITGPSPAVGKSF
VTTNLAAVVAQSGKRVLLIDADMRKGYLHKVMRCDGDKGLSDILSGRITLFDAIQKTQLNNLHVITHGQLPPNPSELLMH
ENFSRFVKEISHMYDLVIFDTPPILAVTDAALVGSQAGTTLMVTRYALNGVKEIEAAKRRLEQNGLIVKGVIFNAVVRKA
STYGEYGYYQYEYASTSK
>gnl|bykdb|A0A098FRB8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas xanthomarina] (length=736 residues).
MTALTRSSLEYDADNRIDLAGIMRTAYDHKALIITITGFFAALGVLYALIATPIYQATAMIQIEPKKAAITGVPEISARP
DSVSQAVTEISLLKSRAVLGRAVEELKLYIVAKPHHFPVFGAFMARKHDPATDGALATPLFGLTGYAWGGEELEVFQLDV
PEAYLGVELTLIAGTAGSFTLHDDEQQLILRGQVNEAVENQGFKVQIAQLEARPGTEFLLVRNRPQTTALDYQNRLKVGE
AGKDSGIIYMSLEDPDPQLASHVLDEISRLYVSQNIQRSSAEAAQRLDFLRSQLPQVRKELEKAEAALNAYQTSSKSVDI
SIETKGVLDQIVALETQISELSLKRVEYDRLYTREHPTYRTLITQMNELQAQKAQLLKKVDALPMTQQELLRLQRDMEVT
TQTYTLLMNQAQEQDILRAGTIGNVRIIDNAYSMIEKPSKPVKPLVVAIAIFVGLLVSAAVILLRQAFYRGVESPDVIEK
LGVPVYAGLPYSASQDQLNRSRKSRDGKTRLLSLTEPTDLAVESLRSLRTSLKFAMLEARNKVLMITSPTPSVGKSFVSS
NLAAVIAQTGQRVLLIDADMRRGYLHTLFGMAPRHGLSDALASGLNLAEITNRTEQKNLHFISAGFSAPNPSELLMHDNF
SRLLREAEKLYDFIIIDTPPVLAVTDAVLVAQQSGTNLLVARFGLSTSSQIDASKRRLAQNGVLLKGVILNAVKRKASTS
PYDSGAYGYYTYTQQA
>gnl|bykdb|A0A098RLQ6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhizobium sp. H41] (length=752 residues).
MADFDKNGFTADFIDIDAALATVRRQWRIVLAAVAVAGAIGLAFAATAVPIYSATATLLIDRNNSQVVEQLSTIGGVIED
EASILSQVEVLQSETIGLAVVDSLNLTENQEFRATRASFLSSVLGTIRSLVNVSQWFAPATKEAVVDDGTLKRGLSDRLL
QGLSVKRIGRTYALELTYNSTSPVLAAQIVNAVAAAYLVDKLNSKYEATRRASDWLSDRIAELRQRALETDLAVQKFRAE
HNLISTGNNGLLSDQQLAESNSALILAQSETARARARVQRIEHILATDDVDAVVTDILDSSVANDLRKKYLESSKVEAEI
TGRLGANHVQAVRLRNEMQEYRRLMFQEISRIAQSYKSDLEVSEAREKSLAETVAKATNISNSAGETQVQLRELQREAET
YKNMYQTFLQRYQEAMQQQSFPVTEARVISKAVPPRTPSKPNKALILALFMIMGAAAGGGVAMFREFRDRFFRTGEQVRD
VLGLEFLGNTPLVPNKLAADTEPRGQDGGPTVTRPSGVARYAVDHPLSSFAETLRSTRLAIDLGIAAKNGARVVGVVSAL
PSEGKSTISINLAQLLAAQGARVLLLDADIRNPGATRALARHATAGLLEVLLEGRSIREALVHDEKTRLAFLPTVVKQRV
PHSSELLTSAQMHRLLAEASGAFDYIIVDLPPLGPVVDARAMAGRIDGFVFVTEWGKTARRAVRNTIENEVQIRKKCLGV
ILNKVDTEKLKLYRAYGSSEYYHSRYTRYYHD
>gnl|bykdb|A0A098RWR7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhizobium sp. H41] (length=782 residues).
MHHKTFKSNIGFPESGKDSDTFIDLDRLWAAVVRRANVIAASVIAAVVLAGLYLVLATPVYTAMTQVLLDESLSRYAEEE
SPVPAAQIVDNRIASAVEILKSKEMALTVVDKAKLDENDTIVNPPMSPVELVKSSVRGILDLVLPGDPPVSEAAIRAGRR
EKAAAVLQQSLTVERVGRSSVIAISTRSTDRQLAAHIAKTYAQAYLTEQLNANFDASERASVWLQERLTDLNQRAQAAEL
AVQKFRSDNNIVSSRGELMSEGQLADLNGQLIAAQADAATASARYNQYKSIIDRGPETAVDNAVVSARDTDNSVIQDLRK
RYITISDRQRGIVQQFGADHPQAAALDAEKKEVAQQIFQELQQLTGSFKNEYDVANSRVQSLRDSIDKVAGRNSEANITM
VQLRELEQRATALRTLYQSYLGRFEEASQKQSLPIAKARIISEAGLPTSPSSPKKTMTMALSVVLGLMLGGGIAALLEFR
DRFFHTGNDVRDNLRMRFLGYLPFIGERGVENAKTGNSAATPGGENATLEDSGQVSFQKMLRLAVDSPRSSFAETLRNVK
LTADVVIQERQCRVIGVISCLPNEGKSVVALNLAGLIASTGKRTLVVDADIRNPGLSRMLTTRQSAGLVEVVLDEVPWTQ
AVKVDTRTKMGILPVSTSNQFAHSSELLSSSGMRKFIDSAREACDYIIVDLAPVVPVIDAKAFAPQVDGFVFVTEWGKTP
IQMVQNLMANEPQIANKTLGIVLNKTDMTELQRYAGPGGSEHYHESFSAYYGDAKPPVKEDA
>gnl|bykdb|A0A098SVR0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas lutea] (length=738 residues).
MTAMNRTSLDEVQDSRIDLATILRTLFDHKGLIASIVGICVLIGVTYAILATPIFQANAMIQIEPRKVGIEGRTEVNNKP
LSVSQATTEIELIKSRAVLGKVVDDLKLYIVQKPKYVPGLGSYMARRFKPEREGALADPMLGLNSFAWGGEKIDVFQLEV
PDALLGEKMTLVAGKPGTFTLYDEDRNKLLSGPVGQPVEGSGIKLQVAALNARPGTEFTVVRQRTLTSALDYQDRLKILE
AGKDSGIVYLSIQDPDPVLAKRILNEVSRLYVRQNVERSSAEAAQRLEFLRSQLPAVRKQLEQSEMALNNFQMGAKSVDL
SVETKSVLDQVVKLEGTLSDLKMKRVDVERLYTPEHPTYRALMTQIGQVESQKAALLKKIEALPATQQELLRLNRDMQVT
SQTYTLLLDKSQEQDILRAGSIGNVRIIDNADVNVEEPVKPMRKIIVLVAALIGLLLAVATVFVRQAFYRGVDNPEVIEN
LGMPVYASLPYSRLQERMEKAAQGRSTSKEPRLLSVSAPTELAIEALRSLRTSLHFAMLEARNNVLMISSPTPGVGKSFV
SSNLAVIIAQTGKRVLLIDADMRKGYLHKMFNLTPKHGLSDTLAARLGSKEVINHTEVRGLDFISCGYAAPNPSELLMHD
NFNKMISDLSPLYDLVIIDTPPILAVTDATLVGRQSGTCLLVTRFGLSTAKEIEACKRRLMHNGILIKGAIFNGVLRKAS
TADYDCAAYGYDYTTVRK
>gnl|bykdb|A0A098Y7V2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter idrijaensis] (length=727 residues).
MSQTANTEDTIDLKELFFSLIAQWKLIALCIILSLICALLYLRTTPDTYAVDAMVQVEDSKGTSAALLGDLSSMIEQKSP
AQAEIEILKSRLVLGEVISHLNLNIRVSGTEDSFWNRLMANNEYATEYSEKSVLFKDNQNSFDIRQFDIPQYFQNKNLIL
SFELGKYSLTDAITEQVVFSAPLNQLSQSSSEYGLWKVAIFSKDSFDAAYNIQKQSLPAAMQSLTANYSVAEKGKGTSVL
GLSYQGEDKQHITQVLNAILAAYSQQNIERRTAETAQTLKFLEDQLPELKQQLDVAEREFNRFRQQANTVDVTKESELYL
TQSITLETQKIQLEQQVAEASSKYMDEHPMMQQMNAQLAAINKKIAELDGTLKRLPELQRQYLQLFREVEVKQQLYTGLL
NSYQQLRIAKAGEIGNVRIVDTAVEPIQPIAPKKLQILILSIFLGGFLGTLLALLRNMMRSGIKDAAQIENELDLPVYAT
VPRSLIQESRINLLKKKKNIPILAVKDSGDIAIESLRSMRTAIHFALMNASNNVIALSGPAPEIGKSFITVNLATILAQG
GKRVLVIDGDMRRGYLHKYFNADIKPGLAELLNRQNSYEDVVQNSTVENLFFVTRGKSPVNPSELLSTDKFKAFLDQASA
HFDHILIDTPPVLAVTDGIIIAQYAGVNLLIARHGKTQIKELEITVNRFEQANVKVNGVILNDVQKGAAGSYGYNYAYAY
TAHKDND
>gnl|bykdb|A0A099KDI4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Colwellia psychrerythraea] (length=751 residues).
MSVNENITQPSMRNQQTMNISSKGAENEIDLMALLGVLIDRKMFIVSITALFAIVGISIAIFSTPIYNATAMIQVEESGS
SVPGLDDMAGMFESSSKSITEIELLKSRSVIGEAVDELKLDIVALPKLFPVVGNRSFRKFNPIKEGDLAESSLGASSYAW
GGEKIDVFRFDVPKYAIDEEFIVLAGENQNFKLLSESGEVILQGKIGQELTNGRFSITIKALVAKVGTEFIVTRKDRLNT
ILDLQTTIGASEKGKDSGIVNLSFQHAIPEYAERILNKIAEIYVLRNVERNSAEAKKSLDFLEIQLPEIKKQLEYSEALF
NDYQRDQQSVNITLETQGVLEQIVELDTKLQELDLKRLAMSRMFKRNHPNYQGIVEQIEAVQQQRDGLAGKISNLPERQQ
KLLRLTRDVEVGNEIYMMLLGKVQELDIVRAGTVGNVRIIDVAEVNTTKPVKPKKAIIVIIATMLGSVLAIAIVLLQKAL
HKGVEDPSEIEGIGMPVYASVPFSVNQDKLTGFIKGRKRKIHKNKNVLAVENPADLSIEALRSLRTSLHFAMMEAKNNVI
AISGPSPGVGKSFISANLGAVLAQSGQKVLVIDADMRKGYLQKQFGLVWENGLSDYLSGQLSLEQVIKTTNVEGLNIITR
GQVPPNPSELLMHSNFSDLISEIKANYDIILIDTPPILAVTDPAIVGGHAGTMLLVTRFGQNALKEIDYARQRFEQNGID
VKGVVFNGVVKKASNAYGYYGYYNYEYKSDK
>gnl|bykdb|A0A099KUK6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Thalassotalea sp. ND16A] (length=734 residues).
MSNIETIPTRLQPNYQETSNGRGEHVDEIDLAQLLRVILRRKWQIILLSTVVALFASVYAYSITPIYTASATFYLEADNA
KLMSLEDVYSQEVGQQEYYYTQLEIIRSQPIAEKVVKNLDLANHPFFRITKQELLTTTPEYLSLTDDELTALTQQYQYES
ALGYVYGGIDANPIKDTQLVILSFTSPEPELAAIIANAIGIAYIDNHMEVNLERIEKSAQWLNRSLSGLKNKLGQSEEKL
QAFQEQESIIDVVGIKSLAAIELEELSAELVLAKQSFQQTDTIYRLVNAEQNNIEGLASLPDILNHQAVTAANSQKRQAE
EQVAELALTYGKKHPKMIAANADLRREQQNVTKNIERLVSSLGNDYRKAENKVDQVNNAINQAKLNYQKLTRIENKRREL
KQEVETNKNLYEAFFIKLNETAQLEGLEVSAGRIIEYATTPVSPIKPRKKLIVVLAVLLSGMVGVGATLLLEALNSTIRA
VVDVETKLHKNLLGIVPLVATGKLGKLNIKHFFDGDDHSFAEAIRTLRTSLLLLNLEDKAQVVSVTSTLPGEGKTVVSTN
LAFALGQLDKTILIDTDMRRPSIAKNFNLAGNTPGLSNYIAGTNSLDECIQHDQQANIDVLVAGQLPPNPQELLSSNQFK
QLLHTLREKYDRIIIDTAPVQAVSDAMIVARLTDSHIYVVKADSTKEKQIKTGIKRMALAGINVDGIVLNQVDLEKAKKY
EDFNGYYDQYGYNS
>gnl|bykdb|A0A099KUL8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Thalassotalea sp. ND16A] (length=752 residues).
MSETKEKSQKTRVQDNSANDEIDLARLFGLLLDSKWLIVSVTALFMFIGVFYALMATPIYKADALIQIEEKSAGMPGLDS
LGEMFATESEAVTEIELMKSRYVIGQAVDEVKLDVVATPKYFGSLGKFFARRYTRISKVSFNQPWLASFTSDSYAWGGEV
INVASLTVPKGLEEKALTITYLGNNKFNLLLNEQHILTGTVNNIAQSATGDIKILITDLSANTGTEFLVTKRNRIEAIKD
LQKSLSISEKGKQSGILYLAIEGPDKALAEKTLNAVNAAYLLQNVQRMSAEVQNSIDFLDQELPSIKDKLETAESLLNNY
RLENESVDLSLETQSILEQIVVLDTRLHELSFKEAEIAQRFTKEHPSYVSLNKKKEELIAQKKQLSTSVKGLPETQQQIL
RLTRDVEVNQQIYLSLLNNVQQLKVAKAGTVGNVRIIDEAQVARLAVKPKKSLIVVLATLLGGMFSVAFVLIKAAFHRGV
TNPQDFEDIGLTVYATIPVSDTQSKFLDKRKLKEKLSHKVGRKKLKVPEILVAKENPTDLAVEAIRSLRTSLHFAMLEAK
NNIVMISGASPTVGKSFVSANLATVLAQAGQNILIIDADMRKGYVQKLFEQNAENGLSEYLIGDNDLSSSIKQTKIENLS
VITRGKIPPNPSELLMGQRFTELLEQVKNQYDLIIIDTPPVLAVTDASIIGHQVGTSLMLARFNQSSLKEIAAAAHRFEL
NGVDIKGIIFNAVEKKASSYYGDYGYYNYEYK
>gnl|bykdb|A0A099LPK0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio navarrensis] (length=723 residues).
MTTPQTRPSVDNASDEIDLGKLLGILLDAKWFIFAITFIFAVGGVAVALLSTPIYKADALLQIEEKSSGGVSSLVGDMGD
LFSAKSSATTEIEILKSRMILGDTVERFNLTTVTEAKYFPLVGKGIARMAGKVNQIEVSRYQVPDYAQGMSHTILVTDEA
QQSYQLVREDDSVVLQGKAGELAKNDGYELFVTELRSHTGQEFAIGQRNRLEAIEWLKQNLSISERGKQTGILQLSFEGE
NRKQISDILNHISQTYFLQNVERNSAEAEKSLSFLKGHLPDIKDSLTIAEDTLNRFRQENDSIDLGLEAKSTLDVMVKLE
AQLNELTFKESEISQRFTKDHPAYISLLDKRETLLKERERLNLQVQKLPKTQREVLRMTRDVEVNQQIYIQLLNKVQELS
IIKAGTVGNVRILDEAQTFARPIKPKKPLIAVLATLLGGMLSVAIVLVKAALHRGVETPDQIEQIGLSVYASVPKSTLQI
ALAEKLKRKGKHNKELALLSESNPADLSIEALRGLRTSLHFAMLEAKNNVVMISGPAPGIGKSFISTNFAAVAAKTGQKV
LIIDADMRKGYLQQCFGLSWENGLSDYLAGKIDTATAVQHAKVDNLDIITRGQVPPNPSELLMHPRFKQLVEWASENYDL
VIIDTPPVLAVTDPSIVGSLAGTTLMVARFGQNTVKEIEVARNRFEQAGIEVKGVILNATEKRASSYYGYGYYNYSYGDS
KKA
>gnl|bykdb|A0A099RMM7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas sp. HMP271] (length=737 residues).
MTTMPRPIYETKEDKDIDLAHLFDTFLNNRALIMGITGFFAALGIAYALLSTPVYLASAMIQIEPKNGLPSLTDVVNTNP
PVSPAQTEIALLKSRSVVGGAVQSLNLDIIIEPHHFPIIGGFMARRFEPKEEGELGWYPDGFESYAWGGEELKITQLDVP
DQLHGEELVLEAAENNGFILRDPDDEVVVQGVVGEPVETEEFRVNVEKLIARPGTTFTVIKNRTYNTTESYQQRLSAAEH
GKQSGIVNVTLEDTDPEEAVRVLEEVAQRYVEQNVARNAAEATQSLEFLNEQVPAVRKQLEAAQTALNKYQTGSKTVDIT
AETQSVLDRIVDLEAQISEQNLKRTEMERRFTRQHPNFQALINQINQLQTQKAELEKQIGTLPSTQQELLRLNRDVEVSS
ETYSMLLNKTQELDIIRAGTVGNVRIIDHAAADLENPVKPNKPLVVIVATLLGGLLAVAFVYVREALKRGVENPEDIERA
GTPVYAAIPFSEKQAGLEKRLANFKRDKSTASYLLTVNDPADLATEAMRSLRTSLHFAMIEAKNNVLMITGPSPAVGKSF
VTTNLAAVIAQSGKRVLLVDADMRKGYLHKVMRADGEKGLSDILSGRITLFDAIQKTQLNNLHVISHGQLPPNPSELLMH
ENFARFVKEISTMYDLVIFDTPPILAVTDAALVGSQAGTTLMVTRYGMNGIKEIEAAKRRLEQNGLLVKGVIFNAVIRKA
STYGEYGYYQYEYVSNK
>gnl|bykdb|A0A099RP05 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas sp. HMP271] (length=736 residues).
MTALTRSSLEYDTDSRIDLAGILRTAYDHKGLIASITGLFAALGIAYAVVATPIYEATAMIQIEPKKTGITGVPEVVPRP
DSVSQAVTEISLLKSRAVLGKTVENLKLYITAKPKRLPLLGGYLARQHDPAVDGPLAAPLFGLASLAWGGEKIEVFQLDV
PPAYLGEKLTLVAENDGGYRLLDEEQTLLLRGEVGQAVASRGFKVQISELLARPGTEFELVRSRAQTTALDYQDRLKVGE
AGKDSGIIYLSLEDADAQQATAVLDEIGRLYVRQNVERSSAEAAQRLEFLRSQLPLVRKELEKAEAALNAYQTSAKSVDI
SIETESVLEQIVELEKLLSEHNLKRVEYNRLYTREHPIYQTLMKQIGQLQAQKEQLLKKVDALPETQQELLRLKRDMEVT
TETYTLLMNQAQEQDVLRAGTIGNVRIIDDAYTTTEKPAKPIRPLIVGIAIFLGLLASALVILLRQAFYRGVESPDVIEK
LGIPVYAATPFSSRQEQLQKAHKANDGLARLLSLIDPADLAVESMRSLRTSLKFATLEARNRVLMITSPTPGVGKSFVSS
NLAAVIAQSGQRVLLIDADMRRGYLHRVLGLTPRHGLSDALAGGLPLNEVTRRTAQKNLDFIASGCNAPNPSELLMHDNF
ARLLKEAEQHYDFVIVDTPPVLAVTDAVLVAQQAGTSLLVTRFGVSSGAQIEAAKRRLMHNGVLLKGAILNGIRRRASNS
AYDTGAYGYYSYPQKA
>gnl|bykdb|A0A099T9Y8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Thalassobacter sp. 16PALIMAR09] (length=726 residues).
MSNKNDYDDEIDLAEIFHVLWARKLFIAAFVVGFVIIGFLYAKSQTPIFQSTALVQLEERSSGGDLPAELQALMGSGSGG
RAATEIEILKSRSVASDAVHALGLHIDAAPRALPFLGNIFRHLGVPHFGTSWLKAYSWQSETIEVGVLRVRSEWIGEEIV
VVKTDERSFDVELPDGSALSGQVGTPVAGGEDFALRVDALTGPVGREYIVSSRDPVLIATELSEDLGVAEVGRQSSILRL
TYRHPDRAMASGVLDAVMAAYVRQNIQRGAASAEKSLQFIQDRLPDAEAQVQAAQLALNSYQRSVSSVDLTFETQQVLSS
AAKIETQLNDLKMQQAELALDVTPNHPSYKRLEENRVILEERLAAIREETQGLPEQQLEVFNLNRDLQVAQEIYQSLLQR
RQELQVVRASTIGNIRVIDNALTERFAVAPRTKIIVMLAAVLGLITGVGAILVPRMLRRTVDGVEDLENLGLSVFASVGF
SKLADQSSNKNKTMSILAVDRPTDLSVEALRSLRTSMHFGMIDAKSQSLAITSPAPGVGKSFICVNLAAVMAQAGTRVVV
IDADLRRGVLRKYFNCPRDTNGLSEVLADDVMLEDVIRKGPIENLFYITSGHYPPNPSELLMRPKFEQVIKQLSEQFDFV
IVDAPPILAVTDPVILSKYVGATMIAARHKVTAAPELEAAIRIFEAGGGKFIGAILNGYKAEASGKGGYYYYYNKRYAYD
DKGSKE
>gnl|bykdb|A0A099TA83 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Thalassobacter sp. 16PALIMAR09] (length=748 residues).
MVQQPPAYEADDDTIDLRSLFTTLWRGKWIVVICTIIASVFGFLAVSQMEPTYRASAKVMFDIQQTNVVNIEEVLVNQQF
DASALEDQVEVLRSTNLIERVIEELRLDQNPEFNPVLRIPEPTILDRINDIVAIPPEVTDLAMNIGLISPPPPEPDPIEA
ARRERLEVINNVLAGLSLQPVGRSRVIQISYVSDNPRTAAQVVNTIAEQYIVDQLEAKLEATRAATSWLSTRVEELRLRV
QTAEENVEAARSELSDETGQTLEVTQQQLEALNASLATARANGSRLEALYNRLTDAVENDRDLGAISEFRASALIQRYRQ
QQDELLAQRVALEGTVRAGHPALVRLEQQLTEVQRNISAEAGRIVSASEIDLKAAQAQEASLMDEVRRLEQKALEQSRNQ
VQLRQLDREAEASRVLYENFLGRLQETSEQEDLQEADARVLSPAEQPLFPEGQVKRRALMIAVLLGGIVGVGLVFLLDRL
NNTFRSPNQLEDLSGENVLGVLPAIGSRMKRSDIIKHFREKPSSSLAESIRNLRTSILFSNIDKPPKVVMFTSSVPREGK
STSSMLIAMTSRQMGKSAIIVDCDLRLPALARLLNAADGQPGLISVLEGTTEIEDAVFKDPESGLHVLMTRSGERNKNIN
AADILSSKKFEELIEELSQEYDLVILDTPPTLVVTDARIISKLADAVVYAVRWDSTPRGAVMEGLKELKSIDAPLAGVVM
TLINEEKASRYSYEGYSYYKGRYKDYYG
>gnl|bykdb|A0A0A0F8H5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli G3/10] (length=726 residues).
MTTKNMNTPPGSTQENEIDLLRLVGELWDHRKFIISVTALFTLIAVAYSLLSTPIYQADTLVQVEQKQGNAILSGLSNMI
PNSSPESAPEIQLLQSRMILGKTIAELNLRDIVEQKYFPIVGRGWARLTKEKPGELAISWMHIPQLNGQDQQLTLTVGEN
GHYTLEGEEFTVNGMVGQRLEKDGVALTIADIKAKPGTQFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDDPQ
LITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDNQL
IELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISK
SSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISLGAVLARAMLRRGVEAPEQLEEHGISVYATIPMSEWLDKRT
RLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSD
QKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDH
YDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASIAYSYGYNYYGY
SYSEKE
>gnl|bykdb|A0A0A0FGW5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli G3/10] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQNSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDNK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHARPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEEEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKIIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A0A0G657 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQSSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDNK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHARPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEEEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A0A0QH79 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Haemophilus parasuis] (length=695 residues).
MNENNHDEIDLVKLLGALLDYKWWIAIFTLLVTLFGVAYVLLATPVYTANASIQVESKSSGGGLKDFAGILEGKSSSSTE
IAILKSRMVLSNTVEQLNLTTVVEPQFSIPFLSKGIHRLMGYEPQLSVSLFEPKNPQMKEVILEVGENAGEFSLFFADEK
VLEGSIGKKYQTEDFSFEISELEAKPGQLFKIKKNDVLLAISTLQKQISVTDSGKQTGIIEISINGENKAQIKKIVKSVS
ENYLLQNIVRNSAEASKSLEFLSKQLPEIKARLSESENNLNEFRLKNESVDLSLEAKSALDTIVQLEADLNELTLKESEI
SQKFTRNHPAYVALIDKRKVLNEEKIRLNKQVERLPTTQKEVIRLTRDLEVSQQIYIQLLNKMQELEIVKASAIGNVRIL
DEAQVFPNAVSPRKMIVVALAFMLGLIFASITAIAKTLLHRGIEGTSELDVLGLPTYATIPYSNEQPIFSKHKVQRFELL
SESTPTDPAVEALRSLRTSLHFAMLEAKNNILMISGASPSVGKSFISTNLANVLAKAGHKVLLIDADLRRSYLRRLLGLA
KEVGLSDVIAQQIPFEQVIQHYDNFDIIVKGETPPNPSELLSNARFQALLEWAAKEYDLVIVDTAPILAVTDAAIIGRYA
GTSLLVGRFGETTLKEVGLAKERFERAGVFIKGFILNGIKRKASNRYDYYQYDYK
>gnl|bykdb|A0A0A1ABU5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQSSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDNK
NYTLISDGGFSARGQAGQMLKKEGVTLMVEAIHASPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRNRLDVAENKLNTFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQKNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVKWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A0A1FBC1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Collimonas arenae] (length=748 residues).
MTKLTQPLHITAGKDDELDLAALLDVLVDNRRMIAIVTSVFFLIGALYAFLGTPVYQADILVQVEDNSASAAASNMLADM
SSMFDVKSTAAAEIEILGSRLVVSRSVDALHLFIDQNPKYFPLIGGWIARHNKKLSTPGLFGFGGYVWGNESMDADIFNV
PQVLEEKKFKLEVLSRGRYRLTSGEFDNVFEGSVGKLEKFTVEDGDLTLRVANINARPGAVFRLVRNARLKTILDLQDQL
VIVEKGKQSGVIGATWEGPDARIVSETLNQIGQQYVRQNIERKSAEAAKSLDFLNEQIPELKNELELAEDRYNALRNKLG
SISMSDEGAMVLKKAVDTQTELLELKQKRKDLAMRFAESHPSLKAVDAQIQALNGEQGKVNGLIKRFPNNEQDVLRLTRD
VTVNTTLYTGLLSNIEQLKLVKAGKIGNVRLVDVAALPEIPVKPKKLIVLPVALLLGLFGSITAAFVRNMLFSGVTDANE
IEQHTGLSVYSTIPRSDAQLALSRQARTRPHEVSLLAVAQSNDLAIESLRSLRTALQFAMLEAKNNIVLLTGPAPGVGKS
FIAANLSAVVASSGKRVLLIDADLRKGHLNEYFGFERDGGLSELVSGTLSVSIAIHKDVVAGLDFMSTGKLPPNPAELLM
ARSVGEMLQTVARQYDIVIIDSPPVLAVADPAILAEFSGTTFLVARSGVTKIGEILETARRLVQNGAHPKGVLFNGLDPN
VGRYRYGSKYGSYRYTAYSYKKGKPLTT
>gnl|bykdb|A0A0A1FKJ2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Collimonas arenae] (length=739 residues).
MNAPIQAVSSGEPQHENEIDLAACLDLLFDHRWLIVSITMAVTLLGAIYAFSVKPTYSADILVQVEDGPNSSKSLLGGVS
ALLDVKAAANSEMELLRSRLVVSRAVDTLQLYVDARPKHFPLFGAWWSGRWPQLSNPGLFGYGGYAWGAERIEVALFNVS
EALQNRNFVLTVEPSGQFLLKDDDADINLQGKVGTPLKANNSHGEIELTVAKIVAKPGTQFLLTRKSRLDTIRKLQGAML
ISEKGKQSGIIGITLTGENPRLTSNILNEIGHEYVRQNVERISEEYEKSLVFLNEQLPEIKRELEQSESKYNQFRNMHGT
IDLGEEAKLALQQSVAAQTKLVELRQKREELLVRFTSDHPAVVGLDRQMKDISIEMRSIGEQIKGLPKLEQDTLRLTRDI
KVNTDLYSALLKTAQQTRVAKSGKVGNVRLVDAAVVPEHSVAPRRGVIIALSVFLGLVLGVMCAALRKMLYGGIDSPHEL
EQALGLSVYATIPHSKKQEELYVEIVAKASKNLLLAQVDPTDLAVESLRSFRTALQFSMLDAASNILLITGPTPGLGKSF
ISANVAVVLAAAGKRVLLVDVDMRKGQLHQYFGFARENGLSELVAGANTVEQSLRRDVIENLDFLSTGNLPPNPAELLMH
ENFAKLLQSLAPDYDYVMLDAPPVLAVSDSLIVARQAGAIYMVVRANVSTMGEIKESLKRLQQAGMSNKGILFNGLRMRP
GRYGHGSKYGKYRYTEYAY
>gnl|bykdb|A0A0A1GEN9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas sp. MT-1] (length=736 residues).
MTTMPRPIYETKEDKDIDLAHLFDTFLNNRALILTITGFFAALGVAYALLATPVYLASAMIQIQAKGGLPSLTDVVGTAP
AVSPAQTEIALLKSRSVVGGAVEDLNLDIIIEPHHFPVFGGYIFRGFEPTEEGELGWYPEGFESYAWGGESLRVTQLIVP
DKMHGEELTLEAAENNGFILRDPEGEVVVQGVVGEPIETPDYGITVAELNARPGTTFTVIKNRTYATTEDYQNRLNAGER
GKQSGILNVTLEGTDPEKAVTVLEAVAQRYVDQNIARNAAEATQSLEFLSEQVPEVRKKLDAAQTALNEFQTGNRSVDIS
AETQSVLDRIVDLESQISEQNLKRTEMESRFTRQHPNFQALMNQINQLQAQKTELEKQIGTLPSTQQELLRLNRDVEVSS
ETYSMLLNKTQELDIIRAGTVGNVRIVDHAAADIDEPIKPNKPLIVIVATLLGGILAVAFVYVREALKRGVENPEEIERV
GIPVYAAIPFSEKQGLLEKRLANFKRDKSSASYLLSINDPADLATEAMRSLRTSLHFAMIEAKNNILMITGPSPAVGKSF
VTSNLAAVIAQSGKKVLLIDADMRKGYLHKVMRCQGEKGLSDILSGRITLFDAIQKTQLNNLHVITHGQLPPNPSELLMH
ENFSRFVKEISSMYDLVIFDTPPILAVTDAALVGSQAGTTLMVTRYGMNGVKEIEFAKRRLEQNGILVKGVIFNAVVRKA
STYSEYGYYQYEYQSK
>gnl|bykdb|A0A0A1GGD1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas sp. MT-1] (length=733 residues).
MNSPVRPDRPWQRPAGPAADSDFIDLKKIWHAIWSRKWGIVLLVAVVAVLTLFLLSRMTPIYKAVATVLIESKGTPVLSF
QPAADTPVELSEYLQTQLSLMQSRGVAERVVRDLNLTEHPEFDLRQQPGPLVDIGGLIDTLTGEEPEPITEAEVMDYATQ
KFMERTSVWVEGKSQLVYLAVSMADNLTAAQATNQLAQAYIEAQLEAKVDMSMTAASWMNERLVSLRENLQASEDRLQAY
LDAEGLVDLNGVGTISANELSLTGDRMIDARRQRAEAESQYRQVQSMRSQGWERLASVPAVLGHPLIQQFKADQAHARSR
VEDLSRRYGNRHPAMVSARSDLNAATASLKQQVEQVVASIERNYQLAVANESSLKASFDENKDRIQDISRKEFKVRDLQR
EVESDRALYDTFMTRLQETTATSDLSSTNARVVDAAIPPTEPSAPNKKLILVVALFLALVLGIAQAIIREILDNTFKSSE
EVESKLGLPVMGIVPQVPRKLRKEVSHLFERSGDKRFCEAVRTIRTNLLLTEASQPRQVLVITSTAPGEGKSSVSANLAF
AMGQLHRVLLIDADLRRATLDKAFDFKPGTPGLVNLIGGNAKLEDCIHTVGNVDMIAAGAVPSNPLELLSSPRFAKLLEV
VKGRYDRIIIDSPPSQAVSDAAVLSTLADAVIYVVKSDSTLIPHVQKGVSQLQNSNAPVTGVVLNHVDIEKAKKNGQFRG
YYDHYGYSEPQTV
>gnl|bykdb|A0A0A1GJZ3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas sp. MT-1] (length=736 residues).
MTAMARSSLDYDGDNRIDLARILRVAFDHKRLIFTITTLFALLGVAYAIVATPIYEATAMIQIEPKKAGITGIPEAVPRP
NSVSQAITEIELIKSRAVLGSTVNDLKLYITARPKYVPLLGSYLARQHDPLEDGELAAPLLGMDSYAWGGEKLDIFQLDL
PEAYLGEKMLLRAGTAGSYRLYDADEKLLLTGKINEAVQHDGFRVQVAELKARPGTEFIVVRSRPQTTALDYQKRLKVGE
AGKDSGIIYLTLEDPDSEKANRVLDKISRLYVLQNIERSSAEAAQRLEFLRTQVPLVRKELEKAEAALNDYQTSAQSVDI
SIETKGVLDQIVALESQISEHNLKRTEYNQLYTPEHPTYQTLMKKIGQLQAQKAALMGKIDTLPMTQQELLRLNRDMQVT
TRTYTLLLDKAQEQDILRAGTIGNVRVIDSAYAVVEKPAKPIKPLVVLVAIFVGLLVSAMVILLRQVFYRGIESPETIEN
LGTPVYAALPFSPKQEHLYRLRKIRDGRSKLLGRADPADLAIESLRSLRTSLKFAMLEARNQVLVITSPTPSVGKSFVAS
NLASVIAQAGQRVLLIDADMRRGYLAGMFGMAPRNGLSDALASGLQLAAVINKTDQANLHFIASGHCAPNPSELLMHENF
ARLLKEAEREYDFVIIDTPPVLAVTDAVLVAQQAGTCLLVARYGLSTAGQVEASKRRLAQNGVLLKGAILNGVKRRASSS
AYETGAYGYYSYSQKT
>gnl|bykdb|A0A0A1RTF0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Citrobacter pasteurii] (length=720 residues).
MTEKEKQSATSVTGNDEIDIGRLVGTVAEARWWVLGITAAFALCAAVYTLFVTPIYSADALVQIEQNTGSSLVQDIGSAL
SNKPPASEAEIQLIQSRRVLGKTVADLNLDISVTKDSFPLFGAGWDRLMGRQNETVNMTTFTLPTSMNEQTFTLSVLNDK
SYQLVSDGGFSARGQVGQLLNHDGVTMMVEAIHASPGSEFTVSKFSTLGTINNLQNNLMVTETGKDTGVLSLTFTGEDRE
QIRQILDSITRNYLQQNVERKSEEAAKSLAFLAKQLPEVRNRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLFTKAHPAYRTLLEKRQALEDEKNKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITE
ASTVGDVRIVDPAIAQPGVLKPKTALIILGSILLGLMLSVVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
NVQTIKGVKRYKQSQLLAVGNPTDLAIEAVRSLRTSLHFAMMQSRNNVLMLTGVSPSIGKTFVCANLAAVISQTDKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILSGKGDILSCAKPTSIAHFDLVPRGQVPPNPSELLMSERFGELMTWASANYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFGQNGIQVKGVILNSIFRRASGYQDYGYYEYEYTSDSK
>gnl|bykdb|A0A0A1Y4V9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. BHC-A] (length=697 residues).
MAGPGLLIDAAMEGRPARFAAAANGAWTAVRRHRIILFVTMALCVLAGVVFILLSTPDYRATASVEVEDVPAGAAGAAAA
QRQATPSDNEALMQTELEVLRSRALAEDVARELALVGSRTFFDGMDVRRPERGAGSLSQRQVETEMVVNLLRDNLHVELP
GKSRVIRIGFTSANAVLSARVANSYADSLIRADLKRGFESGVQARRFLLGELDGARKDLERAERDLAVYAANAGVMAPPE
SNDGDSPPPEGTTATRLAQLNAFRAQATADRIAAQKRWESARLSSVETLPEVLNNGAMQQIMTERAQARAQVVQERQFRK
DAHPEMREARARLAALDDQAEGMANTIRASFKEQFDVAVHGEKQIQSEIAKVERQAQAERGRGVQMSILERQVDTYRLLH
DSLLQRYRDMASQAGFQAGRIQPLDRAAVPSRPSSPNIGVTMLFASLGGLILGLMAVAGRHIFDDAVTSADTLAERINLP
LLGAVPAGEKPAAEIFAPMASALLLGSAAGLPRSILVTSAQEGEGKSSTLYALAKALAKLDKRVLVIDADMRRPKQHSLF
GIAPTRGISELMTGQAKMDEVIVDSGVPGVSLLPCGAIPPSPAELLVTPAMDSLLATVRERYDTVLIDAPPVLGLSDACL
LASKAQVTLLVVEWGRNHHGGLRVAVDRLRRAGGAIIGAILTKQEGRPFEYDYHRGG
>gnl|bykdb|A0A0A2HT71 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobulbus sp. Tol-SR] (length=671 residues).
MHLRDYLAVIRKRRTVVLIVLGLIFFSTVIATFTATPIYTAASQVLIERNRSNSGLEYQSYAYEPEFLDTQTEIIRSANV
ARKVVARLKLATQYRHYFLEDDKNGLSLIGTVRKAFSGMIAGIGSFFAGDDDRKTGSKDIFETVLPKSDEEIIAGIIQGG
LSVKPLKNTKIVTITYADKNPAVAKLVADAVVQAYIDELLEIKLATSNYSLKWMNSKAAEERDKLEKSERDLQSYMREND
LVTVENKLTVLPQKLSEVGVQLSXXXLSKKFGRKHPMMVKANDELRILREERRFEIDRIVSSVKNSLALASSKKKSLDEL
LASTKLEVLNLNERFVQYSIMKREVDSNRLVYDTLQAGIKKEGVTEQSQSINVWVVKPAELPGAPTKPNKKRNILIGLIL
GLCSGVGLAFFIDYLDNTIRQPKELEERFGLTVLGAVDDMRGDGQDIESFIKLQPLSPTAESYRLIRTSLLLSSAEHPPK
TLLVTSMEAQDGKSSTTVNLARTLAQGGNSVLVIDCDLRRPRMHSLLGMDNSVGLSRFLAGNCGPDIIFKIQDEAISLIP
SGPVPPDPAELLGSKKMKDLIDQMNGQFDFVLLDSPPIQSVTDSLALSRFVSGTILVVRAGKTTFEVLEGGLKKLGDINS
RVLGFVLNGIKQRDAGKHYYGYHSYYARDDD
>gnl|bykdb|A0A0A2WM72 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Lysobacter dokdonensis DS-58] (length=753 residues).
MATYLSTRTTPPPHIAPTSVRDEEIDLRTLFTTVGDHKKAIFFGTLMFFLASVLYCVLATPKYEANATVQVERRTAQFPG
LSANSAAQSAQAESPATTEIQLLTSRSVLSEALDNLDLDVQVKAARFPVFGDYIARSFTTDHPNEVNDPWFGMARYGWGG
EHVSIARLDVPQELVDQPLKLVAGDSNRYTLYGPDGDVLVNGFVGQPAQAAGVNVLVRQMAANPGMKFEVTRLNTLAILS
QLRKDISASEQGRDSGVIALSYQNEDPILARSVLEQISRAYVHQNVARNSAEAAKRLQFVKRQLPNVRKELDKAQAALTQ
YQTRTQTLDVTVQNQSLLNQTVSIDSAISQLRIQQADLASRFTPQHPMYKALLAQIGQFESQKAQLRGQIAALPETQQNL
FRLTRDVEVTNQTYASLLDQAQQLDIARASAIGNARVIDPAAVDYESPAWPKPIPVILGGTLLGALVMFAFVLLRQMMRR
GVEDPADIELLGLPVYASIPYSERGRELTVNPARFANGHQRLLALNAPTDLAMEALRSLRTSLHFARFKTKNNLLMISAP
SPGVGKTFVCANLAVTMAQAGQRVLLIDADMRRGTLHHAVGVRSEGGLSELIAGQIPLEDAIRKVAGAENMSFISRGSIP
PNPSELLMNPAFNEMLEQVGPNYDIVIIDTPPVLAVTDAAVIGHMVGTCLMVVRFGLNQQREIALAKQRLEQNGVEVKGA
IFNGVQKRSGGHYAYTYYEYLPSQQTGTHKAYR
>gnl|bykdb|A0A0A2WPP3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Lysobacter dokdonensis DS-58] (length=717 residues).
MTLVNLQAQPAPDGREDEDTINLREYWQVLRDRRWVIAGVTAAVVALALAVTLLATPIFRASSTLQIERDTMKIMDVEGL
TPTESPMDRDFYQTQYELLRSRSLARRVVQDLRLVQAPLFADLVANVDAGLEDKQATPAAQREARERALVETALESLTIE
PVRNSRLVRVNFDSADPALSARIANAWADAFIASNLERRFDASSYARKYLEERLAQSKARLEDSEKALVAFATQEQIVNV
GENQPSLSAQNLGELNAALALAQAARIRAQAAWDQARAGDGLGLPQVVQSPLIQKLRESRSLLAAQYQEQLRTFKADYPD
MRRLAGQIAETDRQIATEVAHIRAAVRSEYDAARAQEGLLEGRMSGLKNDVLDLQGRSIQYNILRREAETNRQLYDGLLQ
RYKEIGVVGGVGANNVSVIDRAFVPERRHSPRIPLNLAVGVLLGLFAGVLTAFLLHHLDRRMHSPQALEEALGLPVLGAI
PRLPNGTSPQMASTDARSPFAEAYRSVRTSLQFATDHGLPRSLLITSAGPSEGKSTTARELARNIAQTGKRVVLVDADLR
KPSLHRLLDVSNASGLSNVLAGAADIADVLRAAPGETFSVITAGPLPPNPPELLAGDRLARMLDALRDRFDIVVIDGPPV
LGLADAPLLAHVAEGTLLIAAAGHTRRDALRGALRRLSSTRGRMLGTLLTRFDLERKGDDYGYGSYAYYGYGTKQAA
>gnl|bykdb|A0A0A3Y022 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Bradyrhizobium japonicum] (length=770 residues).
MLQTNMLQAERLRAPAFNQEAEGGGIGEIISAALGFLWRQYLVLILAAVLGLTASLIYLLITPPTYTAQVQVMLENAKTQ
FIQQQSILAEPAFDLTLFETQVQVLKSKAMAIKVINQLKLADDPDFKQPPPSAPSTWQRLRAALLPPPPDDLQPPPTGEP
LEGIITTFQKRLVVERIGFSNLIEINFSSSNPTRAAQIANAIAKIYLADQEKAKLETNRRARNWMQERLQELGEQALEAE
RAVSAYKSKNNVISTGGKPIDDQQITELSSRLVAARAQTSDAAAKLNRYEAILEANPANSPTIGNLDAAGSDALSSPIIT
SLRQQYMELERRVAEWVPRFGRDHAAVVNLRNRMRELRGSILDEVKRYAETSRSEFEVAKQRQQEIEKQMSGAVEQSRST
NLAEITIRELESKAKSLRNLHDTFLQRYVGAAQQESFPIAEARVMYVAVPPQSKSKPKGAMVMALGLVGGLGLGLGLGLF
REMMDRVFRTSAQIESTLGLPCLSLVPALRAKRAWAWSLDHDMRRRRMSSSSTFHGTVVGKPLSRYAESIRAIKLAIDLN
PSKASNKVIGITSTLPNEGKTTIAASLAQLIAHSGKSCIVVDADLRNPSLSASLAANATTGIVDVISHGRSLEETIWRDQ
KTNLAILPAVSPMPVLHTSEVLAADSMRKLFDQLRSTYDYVIVDLPPLTPLVDVRSTTTFIDCYVLVVEWGQTKAEVVKH
ALHTAPNVYECLIGAVLNKTDIKAMSRYDTQCRDYYRDEHYIRYGLTGSN
>gnl|bykdb|A0A0A3YVC6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Enterobacter cancerogenus] (length=723 residues).
MNIKNKVMTAPKEDSSGWDLAHLVGQLIDHRWIIVAVTAFFMLAGTLYTLFATPIYSADAMVQVEQKNTASVLNELQDVI
PTTPASDTEIQILESRMVLGKTVNDLGLDTVVEQNYFPVIGKGLSRLMGNKPSEIAISRLEIPRTIDKRTVQLEVTGPQT
YTVTSEGDELFKGRVGQLEQHGEVTMLVSGIQADEGTSFNVTKLTDLQAIRAVLNALTVADKGKTTGVLGLEYQDEDPVR
ASQVLNQIVNNYLLQNVDRKSEQAEKSLEFLRNQLPQVRSSLDDAENKLNAYRRQNESVDMSLEAKSALDSSVSVQSQLN
ELTFKEAEVSQLYTKDHPTYRALLEKRKTLEDEQAKLNKKIAGMPQTQQEILRLTRDVQSGQEIYMQLLNRQQELGISKA
STVGDVRIIDRAETAGSPVAPKKLLIIAASFILGLILSVGLVLLKALFHHGIENPEQLEELGMNVYASVPLSEWQRKKDT
EALARRGHKEKSDPHNTLLALGNPTDLSIEAIRSLRTSLHFAMMEAKNNILMITGASPGIGKTFICANLATLVSKAGQRV
LFIDGDMRRGYTHELLGSENKMGLSNVLSGKSEFSPAMIQKGVYGFDFLPRGQVPPNPSELLMHRRMSELLDWASKNYDL
VLIDTPPILAVTDASIIGKLAGTSLMVARFETNTTKELDVSYKRFAQNGIEIKGVILNAVVRKAANSYGYGYDYYNYEYK
QKV
>gnl|bykdb|A0A0A4ADA8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Erwinia typographi] (length=725 residues).
MNIKSKAPSLPKEESNGLDFAHLVGQLIDHRWVIMAVTALFMLVGTLYALFATPIYSADALVQVEQRNPNTVLSDLSEML
PGMTPQSDTEIELIESRMVIGKTVSDLGLDTIVQQDYMPVIGQGLARILGNKPSNIAVSRLDIPLTWDKRTIGLEINDAQ
SYTVTRDGDEIFKGKVGQFEQHDGVSILVSGTNAEKGTSFTITKLSDLQAIQMVLGNLVVADKGKDTGVLGMTYTGEDPI
LISKVLNQIANNYLLQNVQRKSEEAEKSLEFLKVQLPQVRNNLDVAEDKLNKFRRENESVDMSLEAKSALDSSVSVQSQL
NELTFKEAEVSQLFTKDHPTYRALLEKRKTLEDEQDKLNKKIAGMPQTQQVILRLTRDVQAGQEIYMQLLNRQQELGISK
ASTVGDVRIVDRAETAGMPVQPKKLLILLASLVAGFILAVGGVLVKALFHHGIETPDQLEELGMNVYASVPLSEWQRKKD
TEALARRGKSKANPNNSLLALGNPTDLSIEAIRSLRTSLHFAMMETKNNVLMISGASPGIGKTFICSNLATLVAKAGQRV
LFIDGDMRRGYTHELLGADNTVGLSSVLSGKAEIGPGLIQKGEYGFDFVPRGQVPPNPSELLMHPRMEQLLAWATQNYDL
VLIDTPPILAVTDAAIIGKLVGTSLLVARFEANTVKEVEISYKRFAQNGTDIKGVILNAVVRKAANSYGYGYDYYDYKYT
KDINS
>gnl|bykdb|A0A0A5HX23 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio sinaloensis] (length=738 residues).
MLNNTHTTQSRNEQLIDIGYYVHLIKSRWFSISFFALLCTALAVMVVLSITPTYKATATLLIESSTAKAVSIEEVIGIDT
KAQEYYLTQYEILKSNQVAQRVIDKLRLSELEEFNPSVESSEKSLLGSLKQQILSHPIVESYFPQKEITELDLKSVEESI
NRKVLTAFKGKLSISPIRKTQLVNISFESTDPELAAKIANEVGLAFIENNLESKLVATEQATGWINQRLAELKSQLDESE
QALLSFLKQQELIDDSGIIALTSSELSNLTDRIAKATDRRIETQALYNALKSNSAKDVATLASISQISNHPQIRDIRFAE
SNAEREVSELAKRYGPKHDKMIQANAQLKSIQQRAAKVVKKLINGIEKELASAINQEELLKRELLSKKDEFQSLSVIKRE
YDALKREVDTNAKLYDLFLTRQKETTATSDFSAANARFSDYALTPQYPNKPNKKLIVVLAFVASLGFATVLVICLDAFNN
TIESARDFENKLGLLPIGTLPIVKDKEYRKSPIDSRVFTNNKFAVFQESVDSIRTSLYLNLQNSERKMLAISSSVPGEGK
TTTSVNLALSFSKLEKVLLIDCDLRKPSIAARFGLSVSQPGLTNILLMNTPFEECIATIGDSNLDVLGAGMLAPNPQEML
SSKAFEKLVTYLASKYDRIIFDTPPVLPVKDAFIIGKLTQGILLVIKANSTSKSVYKHTMTLFTKHQITIDGVVLNQVPS
PKKGSHNYSEYAQYAQNS
>gnl|bykdb|A0A0A5IC48 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio tubiashii] (length=739 residues).
MSNNFKSGVSEREQLIDIGYYLHLIKTRLLSIGMFAFLCTAIAILFALSITPTYKATATLLLEATTKKAISIEEVVGIDT
RAKEYYQTQFEILKSNQVAQRVIDKLDLAQYVEFNPSIEEKEPGFFDEIKESIYSSPVIASYVNSDEGTEVDPYAQAAAI
NRHVLKVFKSKLTITPIRHTQLVKISFESRDPVLAAEIANEVGVAFIENNLESKLLATEQATGWINERLASLKQQLDQSE
QALLSFLQRQELIDDSGIVALTSSELSNLTDRIAMATNKRIETQSLYNALRSNRNADVSTLASISVISNHPQIRDIRLAE
SNAVKQVSELSKRYGPKHDKMIQANAQLKSIQERAQALSQKLINGIEKELASTREQEAMLKSELISKKEEFQSLSVVKRE
YDSLKREVDTNAKLYDLFLTRQKETSATSDFSSANARFSDRALVPEYPNKPNRKLIVMLAFCASIGFAVLLIICLDAFNN
KIESARDFENKLGLLPTGTIPQIKDKQFKKAPLDSKVFSNEKFSVFQESVDSIRTSLYINMRNSERKLLAVSSSVPQEGK
TTTSINLAMSFAKLERVLLIDCDLRKPSVSARFSLPASQPGLTNVLLMNTPVEECITNVDGSNLDVLSAGMMAPNPQELL
SSQGFEALLQQLAEKYDRVIIDTPPILPVKDAFIIGKLTQGILLVLKANSTTKSVYKHTMTLFTKHQISIDGVILNKVSA
PKKGHHNYSEYSKYAYGKA
>gnl|bykdb|A0A0A6DB28 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas chlororaphis] (length=742 residues).
MQLPSVIGTRDNDQDSIDLLGIFGSLIDQKWLIGALTGAFMVTGVAYAVLATPVYLANALVQVEPKKNDMLGFSDLNSML
GGQSPSVTEIGIIKSRAVIGKTVDDLRLDIDVTPNTFPMIGGFLARRYRGETETSVAAPRFGLNSYAWGGERLEFARLNL
PKELLGKKLTLIAGEQKRFQLLDDNDNLLVEGTAGEAFAQDGVEGQVTQLLANPGTRFEVVRNPRIVTIQGYQDALDISE
QGKESGIIKLALASSDAAEAVKILNKIAALYVDQNVRRTSAEAAQSLAFLQSQLPQVKRDLAKASDALNAYQTHGKTVNI
SLETQSVLGQSVALETRISELKMQQAEMDRKFTKQHPAYRALMSQIGELTQQQKSLEGKVGDLPATQQELLNLTRDVEVA
SQIYTQLLNKSQELDIVRAGAVGNVRLVDAADVDLTSPVKPKKALIVLIATFLGAFVGVALVLLRKSLSRGLEGPEAIEQ
LGLPVYASIPYSALQDEEDNKKGRARDGVDKPAYLLALRNPTDLSIESIRSLRTCLHFAGLDSTNNRIMISGPSPQVGKT
FVSSNLAAVMALSGQRVVLIDADMRKGHLHKTLNTPITNGLSDLLVKRCSIDQAINKIEVDNLHFISRGQVPPNPSELLM
HANFRELLAELSERYDLVIIDTPPLLAVTDAAIVGREAGISLIVTRFGVNPAKEIELTIRRFAQNGIELKGAVFNGVEKR
AASYYGNGGYGYYNYEYASDKS
>gnl|bykdb|A0A0A6HIF3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Enterobacter cloacae] (length=720 residues).
MTEKTRPSAAPTSGSDEIDIGRLVGTVIEAKWWVLGITAIFAVAAIVYTLFATPIYSADALVQIEQNTGNSLVQDIGSAL
ANKPPASEAEIQLIQSRLVLGKTVHDLGLDIAVTKNTFPVFGAGWDRLMGRSNDTVKVTDFVIPKGAGDQTFTLTVLGPK
QYQLTSDAGFSARGEVGQMLTKEGVSIKVSAIQAHEGGEFTVTKFSTLGMINNLQNNLTVTENGKDTGVLSMTFTGEDKD
QIRDILNSITRNYLEQNVERKSAEAAKSLAFLSKQLPEVRARLDDAENKLNAYRQDKDSVDLPLEAKSVLDSMVNIDAQL
NELTFKEAEISKLYTKRHPAYRTLLEKRRTLEEEKAKLNDRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITE
ASTVGDVRIVDPAITQPGVLKPKKALIILGSIILGLMLSIVGVLLRSLFNRGIESPQVLEENGISVYASIPLSEWQKSRD
SVKTVKGVKRYKQSQLLAVGNPTDLAIEAVRSLRTSLHFAMMQAKNNVLMMTGVSPSIGKTFVCANLAAVVSQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILLGKGEISESAKPTSIPKFDLIPRGQVPPNPSELLMSERFTQLIEWASKNYDLVL
IDTPPILAVTDAAVVGRHAGTTLMVARYAVNTLKEVETSLSRFEQNGIEVKGVILNSIFRRATGYQDYGYYEYEYKSDSK
>gnl|bykdb|A0A0A6P6D9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Candidatus Thiomargarita nelsonii] (length=739 residues).
MLKRREEEIDFSVYWAAIAERKWFITLIILLVLGVAVFYTLVATPVYQTDAMLQLEPQKSAASGLDDISQLLLGGNEEAL
AELEIIRSRQIIGKVVEKLKLDISAKPHYFPIIGAAFVRYYKKYAGDDTDKPMEPLWELSQFAWGGEKIEIASLTVSPNY
ENQALKLIAGENNRYQLYDAEDNLLLKGTVGKRAVATKKKVLVEIVVAELQARPGTEFIVTKQSHSLTVLKLQEQLKASE
KGMKTGILQLSLEGSEPDKITQILNTIAQVYVQQNIERKLQEVGNMLDFVNSQLPTIKANLEAAEAKLRTHYNKYGTVNV
ELETRTLLSQLAELEKRISSLELVEVQYKRQYTRENPHLIAFEKQLNQLKNERTLFTKRISQLPKAEMNLVKVMRDVEIA
REVYSLLLNKAQEFKIAKAGITGNVYIVDPAIIPTEKIKPKKRLIIGAALILGLFFGVFIALLRKAMQVGIDSADIIEQR
LNLPVYAIVPHSEKQVKLAKRRKKVAAKPQVLALEDPGELAIEGLRSLRTNLQFALIGTQRPIITITGPTPNIGKSFISV
NLAYIMANTDKRVFLIDGDMRKGHLHQFLGREISPGLSEVISGKCELEAAIHHISDNTGDKEISISFLSGGTRPPNPSEL
LMHERFQNLLETVSKQFDIIIIDTPPTIGMTDATIIGRLAGDTNFLVVRAEQQMLEEVELSLKLFEQASAKITGVIFNDV
SPRSGYGYSNYYKYGYKYR
>gnl|bykdb|A0A0A6P8E3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Candidatus Thiomargarita nelsonii] (length=735 residues).
MTSQSDEDEIDLRVFWHIFIKHKWTIFLLTSLIGILTTIVVFSLQPIYRSTAVLLIESDKANVISIKEIYGIESFGKEYY
QTQLEILKSWTLVEKVVKKLNLVSHPVYNQKKEESFLRNWLPSSWLSPEVPLTAEKKRDAIIASLRDQLTISAIRNSRLV
TISCDSSDKQLAAKVPNTLADLYIESDLEAKLEMTNKAASWLTERVEGLRQNLSNSEKTLQEYMERKNLINVEGVKSVAK
KQIEETASNLVNARQEYAQANSVYRQVKALRGKGSEAYESIPAVLNNGLVQSLKQAELDAERKVSELSERYGQRHPKIIA
ATSDLEKAKANTARQIQRVVEGLTKEYEVALANVKALERVLDDNKRKIKELNRKEYELKKLERDVAVNRQLYNMFLTRFK
ETDASQDVQSLQSTIGRLIDLALVSNWPYKPKKRMIVAISLLLGFIFSTMLAFSLEYLDNTIKDGEDVEQKLGLPMLGSL
PKLKLSNTEEFEPLWKFLKEPKTAFAESVRTLRTGAILSCLESEEKIFVITSSVPGEGKTTFSTNQALALGQMEKTLLID
ADMRRPSIGKAFGLTKAPGLAELVAGTRKLDECIHHLGEDQKVNLDVIPSGKVPPNPLELLSSPRFKTLLEKLSKEYAYI
VIDTAPTMLVSDALVLAKVATKVLYVVKADATPHQVVLDNLKRLRRVDAPVDSIVLNQIQTQKTSKYYYYGKYGYYKNYY
KSYYGGGHGYYNSDS
>gnl|bykdb|A0A0A6PN53 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Candidatus Thiomargarita nelsonii] (length=529 residues).
MLKITFNKHKWLILGLTLFLSLLTTFYVASLPSIYRSTAILLIGVEHNKEINSSQSNNYYQTQLKILGARMLAEKLIDKL
NLATHPAIAGKTIVETLMKGLNMTLVPNSQLVEISFESTDAQLAAQIPNTLVELYIENTLKTKLAMIKKASSQLTKHIEA
LRNNLIKSEMALLTYKENHAPVDQKESQLKIKILQEEVDSNNKLYQKWVLRLQTLQEPQTTVGRLIEPASVSAIPYKPQK
KWIVAISLILALFFSTLLAFFLELMDKSLKTPEEVEKKLGLPLLTVLPKVKIDKTEDKIKARWMFLREPKSGYSESIRTA
RTGILLSKLDTQHKVLIVTSSIPNEGKTTFAINIAVALGDMEKTLLIDADLRLPSLAKSLGLSDDTPGLSELITGERDLD
ECIHDHLSDNRRNLDIMPSGMAPPNPLELLSSPRFGELLYELSQEYEYIIIDSAPTIAVSDTLVLTKYASSVLYVVKANA
TSYKLILEGLKRLRQVKAPVHNIILNQLDSDNPSKYYRYGYGYGYGKND
>gnl|bykdb|A0A0A6QIL2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Paraburkholderia sacchari] (length=744 residues).
MVSTQQAISQPAPAARTEEEDVVLGQLLRVIFDDIGWLVMIAAVVVGAAVFYCFVAKPVYTADTQVRVEQQDYTTQALTQ
TQSGANVTSGQQGSLPTDAEIQMIQSRSVLEPVVKQFKLNFTAAPVALPVIGSLAARLATPGSPARPWFGLKDYAWGGEV
LNIESIQVAPELESKKLTLTALDDNRYVISGPDGGRLLEGTVGQRVQGGGVTLLVNELKARPGERFKVMRLNDLDAVAAF
QNAVKVQEQGKQTGVIDISLEGHDPQAAADIANAVAQSYLREHVASKQADASKMLDFLRSEQPRLKADLERAEAALTAYQ
SKSGSINASDEAKIYLDGSVQYEQQISALQLQIASLQQRFGDQHPVLVAARQQLAQLQGERAKYDAKFRNLPGTEVKAVQ
LQRDAKVAEDIYVLLLNRIQELSVQRVGTGGNVHIVDVAMRPGAPSKPKKLLIISAAAMLGIILGTGFVLMRRNMFKGIV
DPDQIERTFDLPVYGLVPLSAEQAALEKRAPTRGGTRLREVLANVAPKDLTVESLRSLRTSLQFSVADARNRVVVLTGSV
PGVGKSFLTANLAVLLAHSGKRVLMIDGDMRRGALERYLGGSQANGFSELLSGQISLDEAIRATEVDNLHFISCGRRPPN
PSELLMSPRLNQYLEGLAKRYDILLVDTPPVLAVTDAAILSGHAGSTFLVLRSGIHTEAEIADTLKRLRNAGVHVTGGVF
NGVSARAHGKYAYGYAAVQEYLSA
>gnl|bykdb|A0A0A6QL79 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio caribbeanicus] (length=720 residues).
MTTQQSRQTTDNSSDEIDLGKLLGILLDAKWLIIAVTAIFTVAGVAIALLSTPIYKADALIQIEQKSSGGISAMVGDMGE
LFSQESSATTEIEIIKSRMILGDTVDKFNLTTVASPSYLPLVGKGIARLSGDLNQITISRYELPDYALGMEHKLIVLDAE
KKQYQLVREDERVVLEGTAGKLAKNEDYTLFVTDLQSSTGFEFGIAKRSRLEAIEWLKRNLSISERGKQTGILNISFEGE
DRTLISDILNHISQTYFLQNVERNSAEAEKSLTFLKQHLPEIKTNLTSSEDILNQYRQENESVDLGLEAQSTLKVMVELE
AQLNELTFKESDISQRFTKDHPAYRSLLDKRQTLLNEKERLNQQVQKLPKTQREILRMTRDVEVNQQIYIQLLNKVQELS
IIKAGTVGNVRILDSAQTYMVPVKPKKPLIAVLATLLGGMLSVAFVLVKAAFHRGVENPDEIEQIGLSVYASVPRSEMQE
SLFSKVKKKHRDGQMALLAEANPADLSVEALRGLRTSLHFAMMEADNNVLMISGPAPGIGKSFVSTNFAAVAAKTGQRVL
LIDADMRKGYLQKPFGLKWDNGLSDLLSGKIDTAQSIKTTSIENLDIIARGQVPPNPSELLMHRRFKELLDWASSEYDLV
IVDTPPVLAVTDPSIVGALAGTTLMVARFGQNTVKEIDVARDRFEKAGIEVKGVILNAVEKKASSSYGYGYYNYAYKSDS
>gnl|bykdb|A0A0A6QUH3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio caribbeanicus] (length=741 residues).
MNHNQFENKEHEPLIDIGYYAHIIKSRWISIFLFTVLCSAISILVALSLTPTYKATATLLIESSQKKAISIEEIVGIDTR
AKEYYQTQFEILKSNQVAQRVIDKLDLKQYPEFNPSLKNTENGIVDFLKKSITSNSIFRTYFPEDNTPEISDSVKEEKVN
RGVLNIFKSKLTISPIRNTQLVRISFESTSPSLSADVANEVARAFIENNLESKLLATKQATSWINTRLAELKNKLDVSER
ALLTFLEKQELIDDSGIIALTSSELANLTDRISEATERRIETQALYNALKGSTNTDATTLASISTISNHPQIRDIRSAES
EAEKRVSELAKRYGPKHDKMIQANAQLKSIKLRADKVIKKLVNGIGKELDSAKQQEQLLKKELINKKDEFQSLSVVKREY
DALKREVDTNAKLYDLFLTRQKETSATSDFSASNARFSDYALVPESPSKPNRKMIVVLTVFFSAGFAMALVIIIDAFNNK
ISTARDFENKLGLLPTGTIPLVKDKKYRNKAIDYEVFNDKKYNVFHESLDSIRTSLYLNMQTSKRKVIAISSSVPEEGKT
TASINLAKSFSKLERVLLIDCDLRKPSISRRFDLPQSQMGLANIILMNAPVRDCIVSIPNTKLDVLTAGMIAPNAQELLS
SKMFSNLIERLSDKYDRIIIDTPPVLPVKDAFIIGRLTKGIVLIVKSNSTTKSVFKHSMTLFAKHEITLDGVVLNQVVAP
RKGTHTYSEYANYAYSHESNK
>gnl|bykdb|A0A0A6S4Z5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Candidatus Thiomargarita nelsonii] (length=745 residues).
MVGDEQAKSATENDTKEKKFDFRTYWHTINKHKWIILGLTLLIGLFTALKTASLPHIYRSTALLLIEFNQANVISIKEIY
GLGSRTQAYYQTQLKILKSRVLAEKLVDRLNLLKYHQAKDTVQQSGSSWLPGVWSPPEEASPTTTADEKGRRNALVEDVM
ESLSIQAVRNSQLVAISFESTDPKLAADVPNALAEIYIENDLEAKLAMTNKAAEWLSIRLEGLREKLSESEKTLQQYIES
QGLVNVAGVKTLATKQIEETAGTLVEAHLQLAQVENMYKQVQKLRGQSSTAFESIPAIVNHPLIQNLKQAELEAARKISE
LRERYGQKHPQIVAAQAELKATKKHIATQIRRAVDRITKEYDLARANVRTLENILEQNKNKIQAINRKEYQLSALEREVE
VNRKLYDLFFTRFKETDASQDVQALQSTVGRVIEPAIIASIPYKPQKKRIVVISLILGLLFSTLLAFFLEYLDNTLKNPE
DIEQKLGLPLLTALPKLKIGKTDNKMKAMWMFVKEPKSAFAESVRTARTGIMLSNLDNKHKVLIVTSSIPNEGKTTFAIN
QAFALGQMAKTLLIDADMRRPSIAKSLGLNDDGPGLSDLVTGERNLDECIDDHLSQDGRNVDIIPSGVAPPNPLDLLSSE
RFGEILKELSQKYEYIVIDSAPTIAVSDALVLAKYASGVLYVVKANATPYQLVREGLKRLRQIKAPVHHLVLNQLDIHKP
SKYYGYGYGYGKNYYGYYKSYYGEK
>gnl|bykdb|A0A0A6SPS6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Paraburkholderia sacchari] (length=738 residues).
MTLLKQNHPAEQSDDDEIDLSEIFNVLREGWQQIVIVAVCVLLLGTTYAFLGAPVYRADAIIQVDDDSGAGSINDKLGDL
ASLFQNKATADAEIELIRSRMVVGETVNRLHLDVSAKPHYFPLIGGAIARRSQGDGRPELAKPALGLGSYAWGGERISVS
QFEVPAALYEKTFRLHSIDAERYELTDPDGSVVLRARVGEAASGTVAEGPVQLTVASLVARPGTRFDLKRYSTQQTVEEL
QKKLDLAEKTKQSGIIGVKLDGEDAQRITATINMIASLYVQRNVDRKSAQAEQMLTFLGDQLPKLRADLDQSEARYNAYR
AKTGAIDLDAQGKLLLQAVVDTKSRLTEMQQQRAELVQRYTPSHPAVAAVDARIAELDQLQDQYEHQVSGLPQTQQEALR
LMRDVKVNTDLYMKLLDSTQQLRVLKAGQLGNVRTVDFAVVPEKPVRPKKLLVIPLAALLGLLLGCAVALGRRMFNRGLE
SPAEIEHAVEVPVYAIISHSDKQLALEQSVRRNPSKPGVLAVAFPDDVAVEGLRSLRTALQFGVLKPENNIVMITGPRPG
VGKSFVSVNLATVLASTGKRILLIDADMRRGDVHSYFSINGKPGLSEVLTGRESAEVIHRQVLPNLDVMMAGAIPERPSE
LLLRERFATVLKSLAATYDMVIVDSPPVLAVTDPVLIGKEAGATLMVVRHGRHSAAELRETTRHLASAGVAVDGVLLTDV
PQRGAAYGAYSDYRKKGD
>gnl|bykdb|A0A0A6SZJ8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Paraburkholderia sacchari] (length=746 residues).
MIHRDYMLEGPAEVVLPQAPEGGHMSNLLDVLYAGRKTIMIVTAIFTLIGCTYALLAPAVYQSDMLIQVEEGQNPAKTAL
ADLSAQFAIKTAATAEIEVLRSRLVVSSAVNATKLYIRATPHYFPVVGRWAARHLNLNGWSGWGGYAWTDEAIDVTQFDV
PDRLHGSPFLLTWQGDGAYTLASGSVKVEGRVGEPLHAPVVGGAIDLLVNRIDGQPGTTFDLMRLSELRAIQTLQTALLI
SEKGKESDVIGVALEGDDPVLTSTILNAIGTEYIRQNAQRTQEEAQKSIAFLDQQLPMLKAQLEKAENEYNTFRSQHGAV
NLGAEATALLQSSALAQQRIADLRQQRAQLMARFTPDNPALVAVDGQLAEAQKSLGDLVGQTRALPPVEQGLVRLQREVT
VDTNIYTNLLNNREQMRLLKAGRVSNVRMIDAAVPGEQPVRPKRVVLLVAAFFTGLFVGAAIVLMRQRFKRGVSMVDEIE
VHTGLAVYAAVPRSRIQQSLTRRLPRTAPGVNTVLARTAVFDAAVESLRSFRSALEYSLADAANHVVLLAGPTPMVGKSF
VSVNLAAVFGASGKRVLLIDADLRRGSLNRHVGVPSAPGVTDIVDRSQNFGEAVRHEVMPGVDFVPTGGYVTNASELLRE
ESFTEFVAWANDAYDLVLIDAPPILPVADAGIVGKLAGTVFVIARQGSTSVADLRESVRRLEQVGVPIRGVIFNDMTSRP
GRYGHKYGTYGYASYGFAKDVGPAHR
>gnl|bykdb|A0A0A6ZQ12 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Shigella dysenteriae 1617] (length=726 residues).
MTTKNMNTPPGSTQENEIDLLRLVGELWDHRKFIISVTALFTLISVAYSLLSTPIYQADTLVQVEQKQGNAILSGLSDMI
PNSSPESAPEIQLLQSRMILGKTIAELNLRDMVEQKYFPIVGRGWARLTKEKPGELAISWMHIPQLNGQDQQLTLTVGEN
GHYTLEGEEFTVNGMVGQRLEKDGVALTIADIKAKPRTQFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDDPQ
LITRILNSIASNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDNQL
NELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISK
SSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGVVLARAMLRRGVEAPEQLEEYGISVYATIPMSEWLDKRT
RLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSD
QKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDH
YDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGY
SYSEKE
>gnl|bykdb|A0A0A7EFK0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudoalteromonas piratica] (length=716 residues).
MESNVNNGLDIKLILNAVKRNFLKVLLFAVCVAIITFVIVSKMSPVYTAKATIHVESTESRALNFDPVYGADFSKREYFE
TQFAIIKSETLARNVIGTLSLWENEEFIISENEQSKLTFIYDLLGLPQLDASRDSQEIKMQRILKQFSDKLSVNSRRGTR
LIEISFDSADPELAALVVNTITSTYQNSEISSKSEKVKEATDWLNNRLVTLRKALDESEIKLQEYLERENLIEIDGSVSL
VSQNIASVSERLSKSQNEIARLRGIQSIINKYGQADILQLESIPEITSHPLIQNVKKDVIAVERKFSELTEVYGPKHPKL
IAAQSELRAVRGNLEAQIKLLTSSVQKELSNEIENSEMLNQRLKSLKVEFQSTAKKETEYLQLKREVESNRKLYNAFVDR
SKETTIAGDSHSSMIKVIDKAFVPTFPVKPKKKLIILASFVVSFCVGLGLIVLLAILNDTIKSSRDVENGLSQRMLGVIP
LLDKNHVSDSHTFFNNDNKHFSESIRTFRTNLMLSHLDKANKLIEVTSSVPNEGKTTTSINLCFALSQMEKVVLIDADMR
KPSVCRHFGIPQYHPGLANFIAGTASLEECLYLDEQSGVYIMPSGQIPPNPLELLAHNRFSELLSVLKQRFDRVVLDTAP
TQAVSDSLMISKNMDIVIYVVKADDTRQQFVKRGLGRLLEVNANIAGIVLNQVDVNKTEQYGGYYDYYGYAEDKNS
>gnl|bykdb|A0A0A7KSQ6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter baumannii] (length=727 residues).
MNQNTNIEDTIDLKELFFSLIAQWKLIVLCTILSLICALLYLRVTPDTYSVDALVQVEDSKGASAALLGDLSDMIEQKSP
AQAEIEILKSRLVLGSVIKDLHLNIQVSSTENTLTHRLLSDTDYKTEYTKNSVIFKDGLKSFEIRQFEIPAYYLDKTLQL
NFNKQSLRLTDPATEQTLLTVPLNQLNQVTGPQGIWKVSIFTKDKLDTTYNITSLSLPAAVDTIGSNYSVAERGKLTGVL
GLNYQGQDKEHITKVLNAILATYSAQNIERRSAESAQTLKFLDEQLPDLKKQLDDAERQFNKFRQQYNTVDVTKESELYL
TQSITLETKKAELEQKQAEMAAKYTAEHPAMREINGQLTAINKQIGELNSTLKQLPDVQRQYLQLYREVEVKTQLYTALL
NSYQQLRIAKAGEIGNVRIVDTAVEPVEPIKPKKLLVFILSVLAGGFIGTLIALLRNMLRTGIKDSGQIENELDLPVYAT
VPRSPIQESRIKILKKKKSIPILAVKNSDDIAIESLRSIRTAIHFALASAKNNIIMIAGPSPEVGKSFISTNLATIFAQG
DKRVLLIDADMRRGYIHKYFDVEVKPGLSEFLSGQADLQKVLHKTQVANLDVITRGKSPTNPSEILSSNQFKELLEQLQS
QYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSQMKELELTVNRFEQAGVKVNGFILNDIQRASAGYGYGYNYAYA
YKAQKED
>gnl|bykdb|A0A0A7PIF4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingopyxis fribergensis] (length=762 residues).
MSVADAYYRRLATGLFRPLYLVLAFEAGNSMLQTINPMPSGAVGDISDNQEDQASLAPPILLQYWQVVLRWKWVIAGVVL
AALATGLLVTLLATPQYTAMSRIEISRDQKKVTNVEGLESADAGRDIEFYQTQYSLLKARSLAERVARQLRLASNDAFFA
AHDISPDEGTLFSGGNGGRLSASERQRREKLVVDLLLDHVAVAPIRGSALVDISYTSASPDLSAKVANMWTQQFIVQSMD
RRFASTADARQFLEGRLADLRLRLETSERQLVNYAAEKGIVALGKSKSADGRTEVDRTLVSSDLEALNEALAKSTADRIA
AESRARSGGGVTAEALANTGINQIRQKRAEAAAEYAKMLVQFEPDYPPAKALAEQIRALDSSIAREEGRVFSSRSTEYRE
AAARESDLRARVEQLKGRMSQQQRDNIQYNIVQREVDTNRELYDGLLQRYKEIGVAGIGANNISVVDAAKTPDRPSSPHL
LLNLALALLAGLGLAAIATIALDQIDEGLRDPSQVNRLLQVPLLGSVPEAGEGDALDLLRDAKSPLSESYLSIRSNLAFS
TDHGVPKSLMVTSTRPAEGKSTTSLALATVLGRTGKNVLLIDADMRSPSMHQFTGQANKAGLSNFLAGDNDWQQLVVNTD
AKGLSLLPAGPMPPSAAELLSSDRMLLLVDHALKHYDHVVIDSPPILGLADAPLLARAVEGCIFVAEAEGVAVRGIKASL
GRLHAVHAHVFGLILTKLRHRQAGYGYGYGYGYGYGTDGAES
>gnl|bykdb|A0A0A7PQ36 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingopyxis fribergensis] (length=722 residues).
MVRRAPPQRETDPQVDRGALIDLRRVGGVVRRRWMILCAAMLAAIVVAAAAYLVAEPRYLATAQVALERTAEQVIKVDSV
IPTTDPDSAAVDTEVQVLRSPELIGRVVDRLKLDRDPAFNEAAGQGAPAKQPDLIGRQRAIGTILSGLTVKRDGLSYAIS
VSFEGATPVQSAQIANALVDNYVSGQTGAKTEATHRARGFLEQRLQDLRAQVVGAEREVADYRAAHNLFAVSEASTVTQQ
ELSGLSTQLAQAKAENAAAQARLSAARAQLNGGRSGEELGDSLDSPVVSQLRAQRAEVGREVAGLEKRYGPRHPDLLRAQ
NQLRAADQQIAAEVQRIVANASIQASIANQRASSLAGSVAQSQGKLASDNEASVRLNELERNAESARTLYQAFLDRYRQT
VAQSGLERSDAYIVSRARVPGAPSSPNMLVYAAMAVVGGLGIGVLLVVLLQLLERGLETSDAIENALGLPTLAAIPDANT
LPGYRKAGLPAPPAELLIKRPQSTYAEAFRTLRTSIQFAEAAKPIRVVAITSAVPGEGKTTTAMGLARAMAAAGGKVLLI
DVDARRRASSRQFTDNVILGLDEVLAGQATLEQAIVKDSLSDAWLLPQRLDSQGLGLTESPRLAELIEQVRDRYDLVILD
TPPVLPVDEARVIASMADGVVFLVRWRKTASKAASVALRRLYDVHAEILGVVLTLVDVREQERAGYEDGGTFLKAYRSYY
AD
>gnl|bykdb|A0A0A7RZQ7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Frischella perrara] (length=715 residues).
MATNNTDKLTSTYDEIDLLGLFYELIDKWKIIVTITCITTFLGILYVIFATPIYKADALVQIEQKVGNSLFKDFSSVLTG
DKPTSTTEIELIRSRMIIGKTINDLSLDVEIKEVFFPIFGKGLARILGSNNQIALTRYNVAKELYDIPLELRVIDNNHYA
IFNGNEEFLKGTVGEYASNQYVSLLVSDIKAKPNTKFKITKHSYLKTINTILDNLSITDKGKDSGMLELSLIGEDPAHIQ
SILAQICNNYLSQDVEHKSEEAAKSLQFLKTQLPRIRAELDDSENKLNEFRQKNDSIDLSLEAKSVLDTSVQLEAQLNEL
TFKEAEVSKLYTKEHPAYRALLEKRQTLINERSKLGEKISFLPQTQQEILRLTRDVKANNEIYIQLLNKQQELNISQAST
VGNVRIIDNALTQPESVQPKKFLIVSVAFLLGLILSSGTIIVVLILRKTIDSVEQLEDIGLNVYASIPVSEWQSKQNRIS
KRNKHGRKHKNVRARQLVSVGSPSDFSVEALRSLRTSLHFAMMEAKNNILAISGCSPNIGKTFVTTNLAVVIADLNKKVL
LIDADMRKGYLHELMNVKVKCGLSEYLSRRQNIDDIIHKTGINEHLDFIPRGEVPPNPSELLMYPRFKELLDWATQQYDM
VLIDTPPVLAVTDACIAGQYAGTMMMVVRYGENTISEIELGLQRFEQNNINVKGAILNCVVRKTGSYYQYGYHYK
>gnl|bykdb|A0A0A8FBE0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Dickeya zeae EC1] (length=723 residues).
MSERIAVKTAEADKADEIDLGRLLGTVLDHRWLIISITTIFTMLGILYALLATPVYQADAMVQVEQNVSDSLMSDISKVL
PDTKPQSAPEVELLRSRMVVGKTVQDLGLDTEVEQQYFPLFGKGLARLKNEEPARVVVPRLSVPDSWLDEKMTLAIGENG
TYRFSAGKDADFTGHIGQVASQHGFSLLVSSTDAPPGTVFTVRKKNTLTAINDILAELSVADKGKDTGVLQLTLEGSDPA
LVKRTLTSISDNYLQQNVDRKSEEAARSLAFLKEQLPLVRASLETAEDKLNKYRQQKDSVDLSLEAKSVLDTIVDVESQL
NQLTFREAEISKLYTREHPAYRALLEKRVTLEKERDSLNRRVSSMPKTQQEIVRLTRDVNVGQEVYVQLMNKQQELSINK
ASTVGNVRIIDPAVVQLKPVKPKKTLVIVLAAMLGGVAAIGFVLLKTLLHRGIESPEQLEELGINVYASVPLSEWQQKKD
REFVGKNRKRNARSDSLLAVGNPADLAIEAIRSLRTSLHFAMMEAKNNVLMISGASPGIGKSFISANLGAVIAQAGQRVL
IVDCDMRKGYAHHLLGATPERGLSDILSGQIETQQALRTTVVENLFFIPRGQIPPNPSELLMHSHFTDFINWATRQFDIV
LLDTPPILAVTDAAIISRQAGTSLLVARFETNTPKEVEISIRRFEQNGAPIKGVILNAVIRRALSYYSYGYDSYQYSYGS
DKK
>gnl|bykdb|A0A0A8GJB5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhizobium etli bv. phaseoli str. IE4803] (length=757 residues).
MLSPDKLTPRIDPSRDTGNEADFIDFDKLIAIARRQWRIVAACAFAFGILGIVYVLTSVPVYTADTSVLIDRSDNQVINQ
LAAFGQLDDDEGTVLSQVELLKSDTIAYAVVDKLKLVDDPVFNAPKNSLFSVATLKSLMNFRSWFADDAAVAPDPQAKRR
AAAETVAGNIDVERVGKSYVLDVSYTSQSPDLAREIAAAIADVYMVDKLNSKYEATRRAGEWLQERIEELRQQALDTDLA
VQKFRSEHGLVESGSGTLLSEQQLSELNSQLITAQAATAQAEAKYARIKSIIQAKQTDAIVTDVLDSSISNDLRKKYLEA
SKLEAEIEARLGPDHVQAVRLRAEMAEYERLMFDELNRIAESYQSELQVAQSREKSLRDSVDQATGVAATAGETQVQLRE
LERTRDTYKNLYQNFLTRYQEAIQQQSFPITAARIITIAETPTKPSAPKRSLVVAFAMFLGCAFGSGIGAFREFRDRFFR
TGDDVKDMLDVESLGVMPLIENNVEDPTLVDPGNPRSIARGGKTTTYVEEHPLSAFAETLRSAKIAIDISAADQRCKVIG
VVSSLPGEGKSTTAINFAKLLAMQGARCLLIDGDMRNPGATRAIGRHAEAGLLEAIVDNRPLKDLILLDPKTKLAFLPTV
ARYRVPHSSELLASRGMDQLLEMARQSFDYIIVDLPPLAPVVDARAINPKLDAVVFVIEWGKTSRKVVQSTLLSEPDLYT
KCVGAILTKVDPSQMKLYRTFGSSEYYYKRYSRYYTE
>gnl|bykdb|A0A0A8GNY2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhizobium etli bv. phaseoli str. IE4803] (length=755 residues).
MTISTVPPDRNLPISPMRYDPRAQVETKADNLDLASAFRMLRRRMVLIIAITLLLVAPAAIMISGLKPTYQASARLIVHQ
PLATSLGADDTSRGNPLDVKSETERLLSRSIAERVVREMRLDMRDEFNPALRKVSFFESIRANLRGLFDAEKPASTARDS
IEATIREYYQALGVWHEERSEVIQISFTANDAELAAAVPNRVVSIYLDERKGSVSARLDAAETWIRQRIAEQKGRAVIAR
DAARNYQESMDILSKEDAQDERIKTLLELTGREGKIEESRLEVKATISALEAADNPSAAVQNIVVPDSITTKQRDLRAQE
EDLSRLLELYDSNAEAVVDLRRKIEQSRIDLDLATKQYLQSMRAKLAALDHEANAVQSILAVAKEKRTRDALAQTELTRL
QRIAENEQAALDKLEDQRRDLAAKATLPGAELEVFSPASVPLVSQGRGRLFYLVGALLAAISAAVTAAFVLEMWDQSVRS
FDQIAGMARTIPAGLIPRLARRENPKTIFRLVQVPMFDEALRTVILTLKQSNGGKVPNSIVVTSAHSGEGKSLVARSLAI
ELSAAGIPVLLVDGDLRRGELESFFRSGLQQGLNEYLNGQADIRDIVYHHPSGIDFIPSGKFSLQRRVRPNGLADIIEVA
GAAGRIVIFDSAPVLASTDTVLLTALAERTLAVVRWGKTSRRAVEFSLQQMKSPRNSEILVAINNVSPDKHALYNFSDSE
LFSKSLMKYYQPHTDDTPRTIINNIFSLKSKIIHK
>gnl|bykdb|A0A0A8J9M5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella pneumoniae] (length=724 residues).
MSSGNKQTNTKEADEIDLGRIIGELIDHRKLIISITALFTLLALVYAIFSTPIYQADALVQVEQKQANAILSNLSQMLPD
SQPQSAPEIALLQSRMILGKTVDDLNLQIRVQENYFPLFGRGWARISGKKESEVKISNLYIPKKDGDTPQVNLIVQDEKN
YIIETDDFKFKGVVGELVEEKGISIKVDSISAQPGTSFTVSYVSKLKAISDIQEQLTVSDQGKDTGILILSLIGDNPKLI
EDIIDSISNNYLAQNISRQAAQDEKSLEFLSAQLPKVRNELDNAEDKLNLYRRQNDSVDLSLEAKSVLDQIVNVDNQLNE
LTFRESEISQLYTKEHPTYKALMEKRKTLQDEKGKLNKRVAAMPETQQEILRLSRDVESGRAVYMQLLNRQQELNIAKSS
AIGNVRIIDNAVTQPKPIKPKKAIIVLLGIIGGGVVSIGLVFLQIFLRRGIESPEQLEEIGINVYASIPVAEAFSKQAMQ
AAKTISVKKKANSEYSAGFLAVENPADLAIEAIRGLRTSLHFAMLESRNKILMISGASPNAGKTFVSTNLAAVIAQTGKK
VLFVDADLRKGYTHKLFNVSNDNGLSGILSGTVTVDKAVKRLKEPGFDFISRGIVPPNPAELLMNSKFNELLDWANHNYD
LIIIDTPPILAVTDAAIIGNYAGTTMLIARFELNTAKEIEVSYKRFEQSGVKVKGCILNGVVKKASSYYSYGYNHYGYSY
TDKK
>gnl|bykdb|A0A0A8TN20 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter bereziniae] (length=731 residues).
MNQNSKTNDDTIDLKELFFSLIAQWKVIALCVILSLICALLYLRVTSPVYSTDAMVQVEDGKSAASTALLGELKDVAGGL
GQKSPTDAEIEILNSRLVLGKVIQDLNLNIQIQDNADTFLHRLISEDKTRTTYSTKSVDFQKNQSHFSILSFVVPQYYYD
KQLVLKFLDKNQFSLSYQDQVVFKGNLNQLNQAQDSKGLWSVQINSSTPFQQDFTITKLSLPTAVKLLKQNYKVAEKGKM
TGVIELNYNGNDQQHITQVLNYILDVYHQQNIERKTLESKQTLSFLDQQLPELKQQLEASEIKFNNFREQYNTVDITQES
ELMLRQNVELEKMRIELKQKQAEYSAKYTPDHPLMAEINAQLAAIQSKTTNLNQAIKRLPETQRLYLQLYRDVKVNTELY
TSLLNSYQQLKIVKAGEIGNVRIIDNAVEPVKPIKPQKLIVLLLSIFVGGFIGILIALIRNMLSSGIKDSSRIENELDLP
VYATVPRSPIQESRVQLLKKKKSIPILAVKNGEDIAIESLRSIRTTIHFALNNAKNNIIAISGPAPEIGKSFISTNLAAI
FAQGNKKVLLIDADIRRGYLHKYFDHDTAPGLTEYLTNQSSLEQCIVHSSTVSHLDFLPRGKNQGNAAEMLSSPRFSELL
SQLSQQYDHIIIDTPPILAVTDGIIISQFAGVNLVVARYAKTQMKELELTVNRFEQAGSKVNGIILNDVQATAGGNYGYN
YAYAYTSTKDD
>gnl|bykdb|A0A0A8U638 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli O26:H11] (length=726 residues).
MTTKNMNTPPGSTQENEIDLLRLVGELWDHRKFIISVTALFTLIAVAYSLLSTPIYQADTLVQVEQKQGNAILSGLSDMI
PNSSPESAPEIQLLQSRMILGKTIAELNLRDIVEQKYFPIVGRGWARLTKEKPGELAISWMHIPQLNGQDQQLTLTVGEN
GHYTLEGEEFTVNGMVGQRLEKDGVALTIADIKAKPGTQFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDDPQ
LITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDNQL
NELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISK
SSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEHGISVYATIPMSEWLDKRT
RLRKKNLFSNQQRHCTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSD
QKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDH
YDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGY
SYSEKE
>gnl|bykdb|A0A0A8UDT9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli O26:H11] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQNSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDNK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHARPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A0A8XKC8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter calcoaceticus] (length=727 residues).
MNQNTNTEDTIDLKELFFSLIAQWKLIALCIILSLVCALLYLRVTPDTYSVDALVQVEDSKGASAALLGDLSQMIEQKSP
AQAEIEILRSRLVLGSVIKDLHLNIQISSTENTLTHRLLNDSEYKTEYTKKSVLFKDNLKSFEVREFEVPAYYLDRNLLL
NFDKQSLRLTDPETEEVILTVPLNQANHVAGPHGLWKVAIFTKDQLDPTYNIKNLSIPAAVNALSLNYSVAERGKLTGVL
GLNYQGQDKEHITKVLNAILVTYSAQNIERRSAESAQTLKFLDEQLPDLKKQLDDAERQFNKFRQQYNTVDVTKESELYL
TQSITLETKKAELEQKQAEMAAKYTADHPAMREINGQLSAVNKQIGELNSTLKQLPDVQRQYLQLYREVEVKTQLYTALL
NSYQQLRIAKAGEIGNVRVVDTAVEPVEPIKPKKLQVLILSLFLGGFIGTLIALLRNMLRTGIKDSGQIENELDLPVYAT
VPRSPIQESRIKILKKKKSIPILAVKNSDDIAIESLRSIRTAIHFALASAKNNIIMIAGPSPEVGKSFISTNLATIFAQG
DKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQADLQQTLHKTQVANLDVITRGKSPTNPSEILSSNQFKELLEQLQS
QYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSQMKELELTLNRFEQAGVKVNGFILNDIQRASAGYGYGYNYAYA
YKAQKED
>gnl|bykdb|A0A0B0HB80 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Solemya velum gill symbiont] (length=762 residues).
MADNEQIADDELSYESYKAHRQAPQPDPTHIRKDEKRINIHQYVKVALKHKWGIVSLTLVAAIIAYLYAASLEPKYKALA
MLEFTPQTQDQGTVKESSFNEFERRFKGERIFNTQSVILKSRDFAERVVDRLELWNHPYFDPENMKESRATLQIDWLSYL
PDWMATLLRPTEPVTSLQTKETLKVQALAMIQGGIEFEHIENTMLYRFGFNSNDPDFAAEMANKIANLFIEFDLESRLDS
YKNATQYLTDRTMDLKASINESEKKLLAFREKEKIVNLESGSSILGRQMEDAFNNLTDAQKNRITLEKIVKDIDRLRELP
FNEAVNHPSLIEYENIKEAKREELDSELEIAQLAKRYGPKHPKMIAAKAGHQTRISRMKKEVDIVLNNIDKEFERAQWLE
TKLQKQFDDLKLQAHAIDSKQAEYRALERNLGADQKLYDTFLTRFKETNISSGNNTPNARIIDEARVPGGHYWPNLERIV
VIASLGGLFLGLLLAFLLDYINDTLKNSQDIEEKIGIATLGNLQVLKSDKSDLSPERMYIDDQKSLFSESIRTIRTGVLL
TSLDSPDKVVAVTSSVPGEGKTTVSINLAVALGQLEKILLIDADMRRASLGPHFGIEKNTPGLSDLVAGTEEEANCIHHN
EDAGIDILPAGMIPPNPQELLSSQRFSEALQKLASHYDRVIIDTAPTQLVSDAILVANQASGVIYVIKAESTPYHLVKEG
VKRLHQVDSHIIGGVLNQMHQGASGYGGYYKYGKYRNYDYTY
>gnl|bykdb|A0A0B0KGQ2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter sp. neg1] (length=727 residues).
MSQNTNTEDTIDLKELFFALIAQWKLIALCIILSLVLALLYLRATPDTYSVDALVQVEDSKGASAALLGELSQMMEQKSP
AQSEIEILKSRLVLGSVIQALHLDLNISSPEDTFSHRLFNKADYATEYGPKAVTFHDEEKTFDIQTFEIPAYYLDKKLSL
SFKNNNFSLTNPATDEVLLTAPLNQLNQLSTSFGVWKIAIFTTDKFDTHYLIQKKSLPAAVQAINANYSVAEKGKLTGIL
GLNYQGQDKGHITKVLNAILAAYSAQNVERRSAETAQTLKFLDEQLPDLKKQLDDAERVFNKFRQEYNTVDVTKESELYL
TQSIALETKKIELQQKQADLTAKYTTEHPAIREINAQIAALNKQITELNTTLKQLPDIQRQYLQLYREVEVKTQLYTALL
NSYQQLRIAKAGEIGNVRIVDTAVEPVQPIKPQKLQILILSIFLGGFFGTLIALIRNMLRTGVKDSAQIENEFDLPVYAT
VPRSPVQETRMSILKKKKSIPILAVKHNDDIAVESLRSIRTAIHFALSSAKNNIIMIAGPSPEVGKSFISTNLATIFAQS
NKKVLLIDADMRRGYMHKYFNLDVKPGLAEYLSNLADLNQVIHQTDVSGLSVIARGKNPANPSEMLSSEQFKALMEQLSQ
QYDHIIIDTPPILAVTDGIIISQYAGVNLLVARYAKSQMKELELSLNRFEQANVKVNGFILNDIQRSSAGYGYGYNYSYA
YKANKDD
>gnl|bykdb|A0A0B1K1K0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=726 residues).
MTTKNMNTPPGSTQENEIDLLRLVGELWDHRKFIISVTALFTLIAVAYSLLSTPIYQADTLVQVEQKQGNAILSGLSDMI
PNSSPESAPEIQLLQSRMILGKTIAELNLRDIVEQKYFPIVGRGWARLTKEKPGELAISWMHIPQLNGQDQQLTLTVGEN
GHYTLEGEEFTVNGMVGQRLEKDGVALTIADIKAKPGTQFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDDPQ
LITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDNQL
NELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISK
SSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGTVLARAMLRRGVEAPEQLEEHGISVYATIPMSEWLDKRT
RLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAMIAQSD
QKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDH
YDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGY
SYSEKE
>gnl|bykdb|A0A0B1NBR5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQNSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDDK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHARPGSEFTVTKYSTLGMINQLQNSLTVTENGKDVGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEEEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A0B1PZ11 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Aureimonas altamirensis] (length=768 residues).
MNQNHFPMHGKVQALSGMDDRRDEFIDLDRLVGVVRRNWKLAATGGAVGLVLGGLYLLSAPSVYTASTRILLDQNLSRFA
EDEPQSRNPLQMDSVVMNEVEILGSSRLARTVAQNMGLDENDAFLNPPESFFGWVKSGLRSIVSIVSPPPELTEAEAANA
RLGKAQYLLQSGLTAERVGRSFVIEVSYRTNDRILAGDITRAYAAAYLSDQLDANFEATQQATAWLQGRLEELRTSSQSA
ALAVERFRAENGLTSARGELISEQQLSELNGQLILAQAETARASARYRQFQSIVDSGPENAVQNSTISNAEQPGTEAIVD
LRQRYLQVAQRKTAIEEQFGAEHPQAVALGRQEAELTQQIFRELQQLTNSYRNEFEVAQSREQSLRANLDILTGQVPETN
TAMVRLRELEQQANTLSTLYQAFLTRYEEASQHQSFPIAKARVISPAGNPVSPSSPRKSMTMALSLVLGLMGGAAVAGLR
EFRERSFRTGAQIAPELGLKFLGYLPYFDRRIVAAAAAQSAANGEGEALMPPEMRFAAMAPGSSTAESLRHARMMVDAAL
PDKASRVIGFASVLPGEGKSTTASNFAALLAASGRRTLLIDADMRNPGLSRALLRPPETGLVDVLAGTTAWHGALLQDKY
TQTILLPSVLRRNFTPTAELLAGAESATLIREAREHFDYIVVDLPPLGALLDARAFEPICDAFIIVAEWGRTPRELLRSA
LESHREIGSKAAGVILTKTDMQKLGLYGSVAGPEQYAGHYGAYYNDKS
>gnl|bykdb|A0A0B1RF65 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pantoea rodasii] (length=725 residues).
MNIKNKVMTAPKEDSNGWDLAHLVGQLIDHRWIIVAVTAFFMLAGTLYTLFATPIYSADAMVQVEQKNTASVLNELQDVL
PTTPASDTEIQIVESRMVLGKTVDDLGLDTVVQQNYFPVIGKGLSRLMGNKPAQIAISRLEIPKSIDKRTVQLEVTGPQT
YTVTNDGDELFKGRVGQLEQHGDVTMLVSGIQADEGTSFNVTKLSDLQAIKNVLGALTVADKGKTTGVLGLEFVDEDPDQ
ASRVLNQIVNNYLLQNVERKSEQAEKSLDFLRNQLPQVRANLDDAENKLNAYRRQNESVDMSLEAKSALDSSVSVQSQLN
ELTFKEAEVSQLYTKDHPTYRALLEKRKTLEDEQAKLNKKIAGMPQTQQEILRLTRDVQSGQEIYMQLLNRQQELGISKA
STVGDVRIIDRAETAGSPVAPKKPLIIIASFILGLMLSVGLVLLKALFHHGIENPEQLEELGMNVYASVPLSEWQRKKDT
EALARRGHKEKSDPHNTLLALGNPTDLSIEAIRSLRTSLHFAMMEAKNNILMITGASPGIGKTFICANLATLVSKAGQRV
LFIDGDMRRGYTHELLGSDNKLGLSNVLSGKSEFSPSMIQKGVYGFDFLPRGQVPPNPSELLMHRRMSELLDWASKNYDL
VLIDTPPILAVTDASIIGKLAGTSLMVARFETNTTKELDVSYKRFAQNGIEIKGVILNAVVRKASNAYGYGYDYYNYEYG
KETKS
>gnl|bykdb|A0A0B1YJY3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia sp. A9] (length=741 residues).
MNRSSSRVVDTDFDDESELVRYLDLVLSNRWLVVSVAAIVLAIGTAYAFLASPIYESNILIQVEESPGSAASLLGDISSL
FDVKTEAAAEIEILGSRMVVDNAVENLRLYIDAKPSYFPLIGATIASRADRLPTPGLFGIGGFCWGTESIDVDTFDVPSK
FLERTFKLTVLPNGRYRVDQSDLDHPIEGEIGKRVESNQSAGSFVVKIAGIQGVPGAAFKIVRYSKLKTLEKLQKDLTIE
EVGKQSNVISASLQGKDPDDVANILNTIGSAYVAQNIKRKSAEAEKSLAFLEGVVPKIKRDLELSETRYNAMRNRRGTFN
LGIEAQAYLQDSVTSQAALLDLQQKRAEAATRFADGHPAVQALDRQIANMKAKVGELSSRMQTFPNVEQDELRLMRDVQV
NNDLYIGMLNNVQQLKLVAAGKVGNVREVDNARVPEEPVKPRKPMVVVLSAIMGLMLGVIAAVAREALYGGVMNSEDIER
NTGLSVYGTIPFSQSQRELSSSDEKHRMLLADESPHEPSIESLRSFRTALGFATLDAENNRLLLTGPSPGVGKSFIASNL
AAVIASGGRRVLLVDADMRRGHLHEYMGVKREGGLSDLLSGQKTLPEVIHRNVSDGLDFISTGAIPPQASELLLSERTIR
LFDEMSASYDLVILDTPPVLAVSDTSIIAPHCATTFLVARFKQTTISELTEAAKMLDRISARLRGVVFNGVDARAFGYRS
KYGAYRYVQYDYASNAKDLRR
>gnl|bykdb|A0A0B1YP75 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia sp. A9] (length=741 residues).
MVNTQAKHSYADLTAKTEEEDVVLGQLLQVIMDDIWLLLGIAVTVIALAGLYCFIAKPVYQADVHVRVEGNDNTSQALTQ
TQTGAMINSGPQQAPTDAEIEIIKSRGVVAPVVEQFKLNFSVVPKTMPLLGSLAARVATPGEPSRAWLGLKSYAWGGEIA
DIDTVNVVPALEGKKMTLTAGPNDTYTLVDQNGSRLLSGHVGEAEQSGGVTMLVKKLVARPGTQFTVVRYNDLDAIAGFQ
AGIQVTEQGKQTGVVQISLEGKDPDQTAAIANALAQSYLNQHVIAKQAEATKMLDFLKGEEPRLKADLERAEAALTQYQR
TSGSINASDEAKVYLEGSVQYEQQIAAQRLQLASLAQRFTDSHPMVIAAKQQLAELQGEKDKFSNRFRSLPATEVKAVQL
QRDAKVAEDIYVLLLNRVQELSVQKAGTGGNIHLVDSALRPGDPVKPKKVLILSAAVFLGMILGTGVVFLRRNLFQGIED
PDRVERTFNLPLYGLVPQSAEQVKLDAVAEKGGGRARPILASLRPKDLSVESMRSLRTAMQFAMMDAKNRVIVLTGPTPG
IGKSFLTVNLAVLLAHSGKRVLLIDADMRRGMLDRYFGLTAQPGLSELLSDQSPLEDAIRETPVQGLSFISAGTRPPNPS
ELLMSTRLPQYLEGLGKRYDVVLIDSPPVLAVTDATIVGRMAGATFMVLRSGMHTEAEIADAIKRLRTAGVDLEGGIFNG
VPPKARGYGRGYAAVHEYLSA
>gnl|bykdb|A0A0B1ZG62 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Novosphingobium malaysiense] (length=733 residues).
MVAGDEKVYDASSYEQDQFISIDLKQIIAAVRRNLKWIALIVLGALVAGFILTLLIIPRYEATAQVLVEQNADTIIEGSE
LQDNSSQQWDAERFLNTQVDILNSRSLAKRVAQSAKLSENQSFYDAMDEEMPQVDDLDGGVSNANALADLRLDTVVELLQ
ENLHVDLPIDSRVIQITFRSTDPVMSANIANLYAENYLESNLKRKFESSAYARKFLSSQLEEARSKVEASERELNQYSRA
AGLIRVSGQGQNADRETTLSVTNNALIQVNGAAADATTERLAAQDRWDTIANQPVLSIPQVIQNLAIQDILQKKATLEAQ
LANERSRHLEGYPSIRVLEAQINELNNRIATIGGNIKNSIYLDYRTALAREHSLKEQVAKLRDEAMGEQERGVGYAVLKR
VAETDRALYDTLLERYNELSASAGSTSNNVTLVDRADIPREPSSPNLILNLLIAVLLGGVSALAFVLVREHLDDAIRSPD
DVERKLGLSLLGLIPRVTDEEASSAAEDAKSTLSEAYHSLVANLRFSTPNGFPTVLAVTSTNESEGKTTTAHAIAMDLAR
LGKSVLLIDGDLRRPTLHRRMPVKNAPGLTELLVGDAQFDDVLHHSSYDNLTYMTALPIPPEPSLLLGGDRFPSVIAQAQ
QRFDIVIVDSAPMLGLSDTASIASHTDGVLFVVDASRFHRGAVKSALRRLGMVDARMLGAVVTKFDARAAGGDYSYYGYN
YYTYGAERPEVEA
>gnl|bykdb|A0A0B1ZSF1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Novosphingobium malaysiense] (length=693 residues).
MQVLRRRRVVILIVSLLMFGAAAAAYFMTPPRYTAVATVALERGAEDVVKVDQVVPDVVPDSASVDTEVQVLRSPKLIGT
VVDKLNLTRDPEFNPALKEGRSAPEDVERNWAISTILSHLTVKRSGFSYAIDLQYEAGSPTTAAKVANTIASTYIDQQVS
EKAGATARASDFLEGQLDKLRVQVEAAEAAVADYRARHGLFDLGQDSTVTQAELSSLNTQLAQARAQEAEARARLNTANA
QLSRGGTGEELGEALDSPVVSQLRAQRAEVSGKVASLSQQFGPKYPELAKAREQLKDIDQQIAGEVKRIVANLSIQANAA
SQRTASLNQSLQRAEGTLAVDNKSAVGLAELERKADSTRTLYQTFLDRYKQTLAQRGLERADSYIVAPARVPGSPTFPNV
VVFGVIGLIAAVAVSTIVVAILQLLDRGVETTSALEKRLGVQVLGSIPDTKHLPELTDREDRSRPTQLVVDKPHSSFAES
FRCMQTSINFNLRDLHPVVAITSALPNEGKTTAALSLARSAAMAGKRTILVDCDLRRRVSNAESSSMSSAGLLALLYGES
KLHESIYVEPETGLHVLPRGSDEHHVQPFADSEAFSQLIAALRERFDFVVLDTPPVLTIDDSRVIAAKADCVVLMVRWRK
TPTRAAELALRKLEAVDANVIGTSLSMVDVTAQARIGYDDASYYYSAYKSYYV
>gnl|bykdb|A0A0B1ZUM9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Novosphingobium malaysiense] (length=713 residues).
MSTNSLVPADARSRDIASLGDPVSNGRDRLDLDGSLVFFRRHAALILATMSAVLALALIGSLVMTKTYRAQARVMLTGNV
SAAGQADPTQAGRAAISNQLVDTQVEIITSRDMVERVAKAMGLTDKRTPAEREALIDQLQSRVSAERSGESYAITISYDA
DTPASAMNIANAFAREYTQWELQLEQNQNSKTRKDVEAKLSRLRDQAQADTQALQNYRIANNLLSTSGTSLTEQEISNYE
QQVAVAKAQASEDQARLNTALAQLRSGSDGDDVGEALNSSVVSNLRAQEAQLAGQVANLSSRYGDNHPELIRVRSQLSQV
RNQIREEIARVISNLRAKADVSSQRLASLSATLGVARGKLSQNNEAMVGLSELQRNAEASQEIYETYLGSYKQLLAAEGS
ERPNARVLSWASLPSAPVSPNLKLNFALAIVVGLGLGVLAAYIVEALFQGLTTPEEVENLTGQHFLASIPLLTSIPSRGA
GRSKAIATVRDEPYGVFTEAFRALGASIDQRTNGKAQVVAVTSALPDEGKTVISCCLSHVYAVSGMRTILIDCDLRRRGF
SRLLGKESRGAGLLEVLNGSAQLNFDHNDNETVFWTLPIAGDDEDGDHLLTGKPFEDLIENLRTQFDRIVLDLPPVLPIA
YTRVLAERADAVVVAARWRKTTAFALKAALRRLPSDQVHVAGVALSQVDLRQRAYFGKLDPAFYYKQYQKYYA
>gnl|bykdb|A0A0B2BYC4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Porphyrobacter mercurialis] (length=721 residues).
MATTTDTFDGNDRAETPRTGNGRRPRTVGALIGGIGGALRRRWKLAALVAAIVLALALAAIMTITPSYQAVSRVRVDPSL
NPMEQEGAQSVLNAEAIETETGLMSSRALAEAVVRDLELYRDPEFAGDAALAEGAPTPGLISSTVNAVRRRTAIGRDQLS
YIISLSFKSEEAEKAATIANSLVETYIDLRVRSTSGTSERQAGFFRERLGELAGEVTAAESRLANYRASTGLPQTGSSGT
VADQQITTLSSQLASAEGEAASARSNAQVASAQLASGNVDAVAAVQGSNVIRDLRNQRAEILREKGEIETRYDSRHPEAI
RVRDQLAEVDRQILGEGQRVVLSLQAQARASAAEVGALRGRMSSLEGQRATNTRASAEAERLERDAASARAQYDRMNELS
LESTQSTGAVITQVEVVDAAEPPVSPDGPPRALLAVLAVLVAGASGIGCALAVEMSRGGLRTIEDFEDELGLRLLASIPL
AGRPGSRLKPRRGPDPADTIRADRATLYIEAIRNLRASISRAGGGRGKVVAFTSAIPGEGKTETALSYARLLAINSSRVL
LVDCDLRNGRVSRRLPHRPEQGLVELLEGEVTLDQAVSVDETSGLAILSVATAHFTSQDLFEGPAMAEMLSRARQEYEYV
VLDLPPVLAVADARTIARHADGVCVVVRWGHTKPHATMQAVDQLRNDGVTILGGAYTMVDPDAPVMAGGYFTGSLYRSYF
G
>gnl|bykdb|A0A0B2JJK1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudoalteromonas flavipulchra NCIMB 2033 = ATCC BAA-314] (length=735 residues).
MNKFENNSIDNEDVIDFSVYLKVIQRAKWRIIGFSVVVTLLTIMFALTLIPQYKASATLLIESEQSKAVSFEEIYGLDTT
KKEYYLTQFEILKSDSIGREVITKLNLEEHGDFIPKPSLMGEIKGYVKGLLPFLNKNEERYLSGEEKADQKMLFLLSIYK
SKLGIEPIRNTQLVNISFESSDSALAALVANTIGEVYIDNQMRAKMGITQQASNWLNSRLSQLRIQLDDSEERLQDFRED
QHLIDIEGIAGLATQELEQISAQLIEARNGKNKLESINRVIAEYGNNNLELLGSMPEITSHNVIQNVKRDVVTVERKLSE
LSEVYGPKHPKIISASAELITVKNNLNKQIKGLITGIEKELNRVTRTVSALENDLSNIRARYQDITRKETQYNQLKREVE
TNRNIFNTFLSRSKETEVTSDFTSAAARFTDRAYAPNNPSKPNKKLIVVLAFVASFIFAIVMSLIFDALNDTVKTKPDVE
SKLAQRMLGLLPQVSLPKKSVLPMHAYLDETYRRFAESVRTFRTSLLLTQLDKQHKIIAVTSTSPGEGKTTTSSNLAISL
AQMGKVLLIDGDLRKPTIAKRFEIPVYHPGLTNLIVGTEELSECVHIDEKSGVVIMPSGQIPSNPLELLSNIKFTQLIGH
LKTQYDHIIIDTPPTQAVSDALVIAQSADSVIYVVKSDVTRIKPIKAGLERLFEIKVHVAGVVLNQVDMSKSNDEHSYGY
YDYHDYSQKPEQPTA
>gnl|bykdb|A0A0B2TDV5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pectobacterium carotovorum] (length=726 residues).
MTEKTSVKVSETSSDEIDLGRLLGTLLDNRWLIIGVTAVFTLLGIMYAMLATPVYKADALIQVEQSSGNSLLNDISSMLP
DAKPQSAAEIELIKSRMVVGKTVSDLALDISVQQKYFPLVGKGIARLSGNEPGKIAASRLDVPASWQDEVLSLEVLPNQE
YAVEAGDSVKFTGRVGQLENHNGITLLVSDIVAEPGTIFRIQRLNQLTAINNLLDDFSVADKGKDTGVLALSLEGEDPVL
TTKILSSISQNYLQQNVERKSEEAGKSLEFLKEQLPNVRNSLNEAENKLNQFRQQNESVDLSLEAKAVLDTTVAVEAQLN
ELTFKEAEISKLYTREHPAYRALMEKRKTLEQERDKLNKRVGAMPKTQQEILRLTRDVQAGQEVYMQLLNKQQELSINKA
STVGNVRIVDNAVIQPRPVKPKKSLIVLLAMILGGMVSTAFVVLKTLLHKGIESPEQLEELGINVYASVPLSEWQQKKDR
ALLGKKNKKSNIRATDLLAVGNPADLAIEAIRSLRTSLHFAMMEAKNNVLMISGASPAIGKTFVSANLGAVIAQSGQRVL
IVDCDMRKGYAHELMGTHGTDGLSDILSGQCGTEKSVRKTAVENMDFIPRGQVPPNPSELLMHSRFIEFLKWAGEHYDLV
LLDTPPILAVTDAAIISRHAGTSLLVARFEMNTVKEIEVSIRRFEQNGAEVKGVILNAIVKRAASYYGYGNYHYYTYDYK
SDDKGK
>gnl|bykdb|A0A0B2UAC3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter oleivorans] (length=727 residues).
MNQNTNTEDTIDLKELFFSLIAQWKLIILCVILSVVCALLYLRVTPDTYSVDALVQVEDSKGASAALLGDLSQMIEQKSP
AQAEIEILKSRLVLGSVINDLHLNLLISSTEDSFTHRLLNNTQYKTEYTKKAILFKDGLKSFEIRQFEVPAFYLDKNLLL
NFDKHSVRLTDPDTDEVILTVPLNQANQLSGAYGIWKVSVFSKDQFDVAYNIKKLSLPSAIKNISSNYSVEERGKLTGIL
GLNYQGQDQEHITRVLNAILATYSAQNIERRTAESAQTLKFLDEQLPDLKKQLDDAERQFNKFRQQYNTVDVTKESELYL
TQSITLETKKAELEQKQAEMVAKYTAEHPAMREINGQLAAINKQIGELNSTLKQLPDVQRQYLQLYREVEVKTQLYTALL
NSYQQLRIAKAGEIGNVRIVDTAIEPVQPIKPKKLLILILSVFVGGIIGAIIALLRNMLRTGIKDSGQIENELDLPVYAT
VPRSPIQESRIKILKKKKSIPILAVKNSDDIAIESLRSIRTAIHFALASAKNNIIMIAGPSPEVGKSFISTNLATIFAQG
DKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQADLQQVLHKTQVANLDVITRGKSPTNPSEILSSTQFKDLLETVQS
QYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSQMKELELTLNRFEQAGVKVNGFILNDIQRASAGYGYGYNYAYA
YKAQKED
>gnl|bykdb|A0A0B2XP50 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter baumannii] (length=731 residues).
MNQNSKTSEDSIDLKELFFSLIAQWKIIACCVVLSLICALLYLRITPDTYSVDAMVQVEDSKGAASAALLGDLSKVSGGL
SQKSPADPEIEILRSRMVLGQVIQNLNLDINVKDNQSGLIDKLISQDKSRLEYRHESVLYSNQNNNLIIRELKVPEYYLD
KPLKLESKGANQFTLTYKDQVVFNGQLNKKNILNTNRGLWQVQLNAQGNLKEQSYTLTKLALPTAVKNFNDIYSVAEKGK
VTGVIGLNYLGQDPEHITQVLNNVLTVYHQQNIERKSLESKQTLAFLEKQLPELRKQLEDSEIKFNQFREKYKTVDVNAE
SELLLKQNIDLEKLKIELQQKQAELSAKYTNDHPLIRQIDAQITEINKKIADLNNRLTQLPETQRLYLQLYRDVKVNTEL
YTSLLNSYQQLKIANAGEIGNVRIIDTAVEPVKPIKPKKLIVLILSIFVGGFIGILIALLRNMMRSGVNDSTQIENELDL
PVYATVPRSPIQETRMSILKKKKSIPILAVKSSDDIAIESLRSIRTAIHFALTSAKNNIIMIAGPSPEVGKSFISTNLAT
IFAQGNKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQADLTQVLHKTQVANLDVITRGKSPTNPSEMLSSTQFKDLL
EKFQTQYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSHMKELELTVNRFEQAGVKVNGFILNDIQRSSGGGYGYN
YAYAYKAQKED
>gnl|bykdb|A0A0B4CXM3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Brevundimonas nasdae] (length=723 residues).
MGGSRQPADDAIDLHALIVAFRRRLGLFVAVAAVVCLIVLALMLGQPPVYTATASLQINTRKEQVVAGQAVLSALDAEAA
IVDTEVEVLKSPQLAAQVVQTLDLIRDPEFNARLRSSPLTKHLPRATSASTDAQIERQQVIDAVRRRLTVRRVGLTYSMA
VGFTSESPIKAARIANAFADAYLQSQLTAKFDANAQANTFLGARLEDLRRQVEAADAAVSAYRIDNGLLSAQGATLTEQE
ISAYNQQLALARAQQAEQDARLRTARAQMAAGSNGDDVGEALSSPVVQNLRAQRAAISTRVADLSVRYGPLHPDMIRARQ
ELADIDAQIQAEIRRVVSNLDAQAQVARQRAASVQSSLDAARGALADNNAASVRLRELEGEAEAARAIYRAFLDRYRETS
AQTGVEQADARIVSRATPPTAQSAPNLMISLALGLLLGAAAGTGAVIIANAMQTGLSGPDDIERRLGVGAVGAVPLASSV
ATAEDQTLHPIDLVVQRPLSVFAEAFRALRTSITPIVSVVGEPSARIVAVTSALPGEGKTTTAVCLARVAARSGGRVLLI
DGDPRRRGVTRMLGLNPDHGLAEVLHGAAAWRNVAVLDPASGAQVLPLSGSGLSADDLFGAPPMTALLDDLRQAFDLIVI
DTAPVLVLADARILAAKADTVVLLARWRKTPARAVVAALRILHQSGARPLGVTLTQVDVRAQSGQGYSHADYDYRAYRKY
YAA
>gnl|bykdb|A0A0B4D147 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Brevundimonas nasdae] (length=736 residues).
MTDSGVPSLPSSAAETFSFRNLINIFRRRVRLFGAVALLVFLAALLVTARATPRYTAQAQVMLNVRQSQVLDTQQVLSNL
PAETGVVDSEVEVLQSRDLARQVAEVLRLENDPEFNWALRKPSGLGALIARVQGRSLAPPAPPTTPDEIRLGRERAASAL
RGGLKVQRMGLTYIIGVSFTSLNPEKAARIANAFAGQYIANQVSDKGGANRQANTFLEERLNQLRGEVQSAEAAVESYRS
ANNLLTSSGATLTEQEVSTYNQQLATAQADQAVEEARLRAARSQLARGSSGGDVGEALQSSVVGSLRAQRATVAARVADL
QARYGPDWPALVRARQELAAIDGQIQAEIQRVISNLEARVQVARDRTASLRSTLGQTRGALASNNAASVRLNELERNAES
VRKLYEGLLERYQETTNQSGNETADSRMLQAARASGAPSSPNVPVNLVLGFILALGCGLAAVVIVELMDDGLITSEDVQR
RLGLPMLGTVPLLMSTADRKDRRMAPTDYLLNRPLSAFAESFRTLRTSIMYAKLGAAAKVVVVTSALPGEGKTTTAVCLA
ISAAQAGLKVVIVDCDIRRRNVSRLLGVDADFGLMDVLDGSKPLTEVLLKGEASGAWVLPVAKRDFTPREVFNTAEMTAL
LSRLREDFDMVILDTAPVLAVAETRVLASQADAVMFLARWRKTPSKAAEAALRSLEQSEATVAGAVLTQVDVQEQARYGY
GDPGYYYTAYKGYYTN
>gnl|bykdb|A0A0B4DW14 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Brevundimonas nasdae] (length=736 residues).
MTETGVPSASPSAAEAFSLRNLINIFRRRVRLFGGVALLVFLAALLVTARATPRYTAQAQVMLNVRQSQVLDSQQVLSNL
PAETGVVDSEVEVLQSRDLARQVAEVLRLENDPEFNWVLREPGGLGAFIAKVQGKALPRPTPPTTPEAIQLGRERAASAL
RGGLTVQRMGLTYIIGVNFTSLNPEKSARIANAFAGQYIANQVSDKGGANRQANTFLEARLNQLRGEVQSAEAAVEAYRS
ANNLLTSSGATLTEQEVSTYNQQLATAQADQAVEEARLRAARSQLARGSTGGDVGEALQSSVVGQLRGQRSTVAARVADL
QARYGPEWPALLRARQELAAIDGQIQAEIQRVISNLEARVQVARDRTASLQSTLGRTRGTLASNNAASVRLNELERNAQS
VRTLYEGLLERYQETTNQSGNETADSRLLQAAQASGAPSSPNVPVNLVLGFILALGCGLAAVVLVELMDDGLITSEDVQR
RLGLPMLGTVPLMMSIADRKDRRMAPTEYLLNRPLSAFAESFRTLRTSIMYAKLGSAAKVVVVTSALPGEGKTTTAVCLA
ISAAQAGLKVVIVDCDIRRRNVSRLLGVDADHGLLDVLDGSMTLADVLLKGEASGAWVLPTAKRDFTPREVFNTPEMAAL
LSRLREDFDMVILDTAPVLAVAETRVLASQADAVMFLTRWRKTPAKAAEAALRSLEQSDATVAGAVLTQVDMQEQARYGY
GDPGYYYTAYKGYYTN
>gnl|bykdb|A0A0B4X6Y5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhizobium gallicum bv. gallicum R602] (length=782 residues).
MNQRNLTLHSTVPKASDDSDSFIDIDRLIAILFRRAGSIALCVVAFVALAATYLILSTPVYTSMTQILLDDSMTKYAEDE
APAASAQQVDMQIASAVEILKSNELALSVVDAQNLSENGTILDPGQGAFELVKSGVNLIVSALTPGGPPTSEENARNGRR
QKAAAKLQQALAVERVSRSSVIAVAFRSTDKMLAARVTKAYADAYLSDQLNANFDATERASVWLQERLADLRDRSQQAAL
EVAKFKTENGLTSANGELMSEQQLADLNKQLIVAQADAASASARYNQFKSIVDQGPEGAVNNAAISSGQTDNSVIQDLRT
RYIGVTRREQEITTNFGADHPQAVQLRTEKEDLTRQIFQELQQLTSSYRNEFEVAKSRQESLQENIRHLTGKNSESDKSI
VKLNDLEQRATALKTLYEAYLGRYEEAAQQQSFPIAKARVISEAGIPTSPSSPKKTMTLGLAIVLGLMAGGALTAFQEFR
ERFFRVEGDVRSILGLKFLGYLPLVGKLPKERKVFQPRKTPLPETQEVPEDGASFERIMRIVLEAPRSVFAETLRNAKLA
SDVMFQGKSDRVIGVVSALPGEGKSTTAANFAALLASSGKRTLLIDADLRNPGLTRMLKTPPQHGLVEAVLGEVPWASAV
RVDSRTKLAILPVVSNDNLMHTSELLASQGMFNLMEHARKMFDYIVVDLAPLGPVIDAKAFAPQVDGFLFVTEWGQTPTS
MVRDIVNAEPQIKQKILGVILNKTDMTELGKFSNFGATERYHHKYVSYYTEEIPPKRQSAEA
>gnl|bykdb|A0A0B4XF30 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhizobium gallicum bv. gallicum R602] (length=798 residues).
MNEFIGIGKAKMVQEAIRPYLGQRGTAKQPEAGDERFIDVDRLIQIARRQAKLVVLFAAIGLMLGVTRLVFATYYYTAGT
SVLIDDNLSRFAGDVSPAPANMESDKKIMSQVAILRSSSLAAKVVDRQQLYEKREFINPPLSVTQQIKGLAKMAMDVFAG
MGAQMADADSLDARKGTAVAVLMENLRVEQQPQSFVIDLYYTSTDPTLSAQIANAYAEAYLSDKLDANFDASQRATVWLR
ARLTDLKDQSQEAAMKVERYRTENGLTSAKGALLSEEQLSDISGQYILAQADSAKALALYNQYKAIVAAGQQTAVDNAAT
VSEQQGSTVISTLRARYLTVIKRAQEIEGRFGPEHPQAITLRREQDDIGRQIFLELKQMTESYRNQYEVAVSREASLKEG
LSRITGQTSAANESLVQLKDLERNAEAISDLYKTYLTKYQETAQNQSFPISEARVISPASPPTEASSPKRTLTLGGSLIL
GAIFGIGLGLWREIREGTFRLGEEFTTLGLKFLGYLPPIPGATRPSPDDEGKLIANPDVETMRFAVKSGGTKFAETLRHA
KIMTDTMLGSQNCKVIGVVSVLPGEGKTTIAANFATLVASSPAKVLMIDADLRRGSLTQGLGIRFETGWTEALNGTTKWQ
ETLVVDPQTGVSLLATPRQVKVFNTSELISGPSMATLLQEARSMFDYIIVDLPPIGPVFDAKAFEPFADGFLLVSEWGAT
PRALLKSTLEQEPAIAAKLLGVMLNKADQEKLSTYGGLGSSEKLYSRYASYYLEHGEPIMKARGRRRRKARVQLSKEL
>gnl|bykdb|A0A0B4XN91 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Alcanivorax pacificus W11-5] (length=733 residues).
MTEQDTKRGMAGRMAAGANDEIDLTRLWALLVDHRWQIGLITAMAFIVGVIYTFVATPIYRADALLQIEARQSGLPVLGD
LSEMLGSESSAQTEIEIIRSRMVIGNAADELRADIQVQPASLPVIGRFFGPEEKDNRILFAGWADTEKQLWIDQLAVPEW
LLGSTFILEAGEGGSFTLTLDGEPVLEGEPGKEARSADQRIAIRVAELNAEPGTRFEVVKQSRRRVMQQLLANLSVAEKG
RNTGILTVSMTGANPEKVSKILDAVARNYLLQNVQRRSAEAEKSLEFLDEQVPEIRDELNAAEEKLNAYRLESESVDLSL
ETKAVLDQLVQLEAKLNELKFRESEVNRLYTREHPAYRTLMEQRRSFEEERERLNSQVKNLPETQQQILRLMRDVELNQE
IYVQLLNRVQELRIMKAGTIGNVRIIDNAQVQPEPIKPQKALVVVLATLLGLMGAVGQVFVRAAFNRGIESPDQLEQEGI
PVYATLPLSEDQIRNERLISRISRRRGTPNKTHQLLAQTNPGDLTIEALRSLRTSLHFAMLEASNNVLMISGPSPEVGKS
FVSANFAMVLAQVGQRVVLVDGDLRKGHLHRYFPSDHAVGLSTYLAGRNSREEVTLHTDIPGLDFIGRGEIPPNPAELLM
HPRFQGLMEELSRDYDLVLIDTPPILAVTDAAIIGNLAGTSLVVTRYGRNSIKEVEQTLGRFEQNGVHVKGCILNAVERK
ASNAYSYYAYEYK
>gnl|bykdb|A0A0B5IWK5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Raoultella ornithinolytica] (length=721 residues).
MTSVINNKASSQDGSEIDFGRLLGELIDHRKLIIAVTTGFTVLAVLYALLATPIYEANALIQVEQKQGNAIIDSLSQMLP
DSQPQSAPEIALLQSRMILGKTVDDLNLQAQVAQKYFPLIGRGIARIFGEKEGSIDISRLYLPSGKTSDIPEITLTVKDK
MHYTIEGDSFTLNGTVGSLLEENGISLEVQALDATPGTRFIIKYYPRLQAISNLQDLFSAIDQGKDTGMITLTLTGDNPG
LITRMLDSISQNYLAQNVARQAAQDAKSLEFLNNQLPLVRTELDSAEDKLNAYRKQKDSVDLTMEAKSVLDQIVNVDNQL
NGLTFREAEISQLYTKEHPTYKSLMEKRKILQEEKAKLNKRVSGMPSTQQEVLRLSRDVESGRAVYMQLLNRQQELNIAK
SSAIGNVRIIDSAVTESKPVKPKKLLVIAVGLIFGLFASIAMVLLRVFLRRGIESPEQLEELGVNVYASVPVSEWLAKQS
NKNGRKNKNESDKLLTVENPADLAVEAIRSLRTSLHFAMMEAKNNVLMISGASPNAGKTFISTNLAAIIALTGKKVLFID
ADLRKGYVHKMLGQKHIKGLSDILSGQISAESAIEKVSGGEFDYISRGQIPPNPAELLMHSRFEELVKWASEKYELVIID
TPPILAVTDAAIIGRYAGTTLLVARFEANTVKEISVSVKRFEQSGVTIKGCILNGIVKKASSYYGYGYSHYGYSYSDKDN
K
>gnl|bykdb|A0A0B6RY07 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia plantarii] (length=740 residues).
MNTQVKHPYADLAAKPDDEDVVLGQLIQVVLDDIWLLLGIAALIVALAGVYCYLAKPIYSADAHVRVEAADNTSQALTQT
QTGAMINSGPATPATDAEIEIIKSRGVVGPVVEQCKLNFSVTPNTFPLLGAIAARLAAPGKLAAPWFGLTSYAWGGESAV
VDSIDVTQALEGKKLKLTAGANGTYTLADEDGGLLLRGRVGERDEGNGVALTVSKLVARPGTQFTVVRQNDLDAITAFQS
AIQVAEQGKQTGVIQISLEGKDPDQTAMIANALAQSYLHQHVNSKQAEANRMLDFLKSEEPRLKSDLERAEAALTDYQST
SGSINASDEAKVYLEGSIQYEQQIAAQRLQLASLEQRFTPEHPMVVAANKQLAELQHERDKYADKFRSLPATEVKAVALQ
RNAKVAEDIYVLLLNRVQELSVQRAGTGGNIRLVDAALRPGVPVKPKKVLILSAAVILGLIVGTGVVFLRRNMFHGIEDA
ERVERMFNLPMYGLIPKSAELERLDAEARKSGSDLRPILAVARPKDLSVESLRSLRTAMQFALMDARNRVMVLTGPTPGI
GKSFLTVNLAALLAHSGKRVLLIDADMRRGGLDHYFGVPRRNGLSELLSGQIALEEAIRETQVPGLSFIPTGQRPPNPSE
LLMSPRLALYLDGLGKRYDAVIVDSPPILAVTDATIFGVLAGSTFLVLRSGMHTEGEISDSIKRLRTAGVHVQGGIFNGV
PARARGYGRGYASVHEYLSA
>gnl|bykdb|A0A0B6S2U1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia plantarii] (length=768 residues).
MNARHPGDLPDELPDALGMIRLLRAHMWAIAGIAAAVVALAAVYVGLSTPLYSASAVIRVEAQGRNALGFAADGQQLVMG
QGTARTDAEIGMLQSRSILDPVLNHYGYGITSSPHVLPILGAIARRFATPGEPSRPWFGLDAYAWGGERLEVESMRVPPE
LENRKLRLRALEPGAFALIAPGGRVLLTGRVGEPARADGVSIRVARLDARPNTEFDVTAWNDVNALQRFSRRLRIVEKGS
GTGIVQISFDSEDPARAAAVANAIAQGYIAATIAESRANDGKTLDFINHELPRLRDELLQAEGALMGYQASAGSLQPTTE
AQSYLQGGIDIERQIALLQLQRTQMTQNFTPDSAPMRNIDRQLAQLGAAKASFDARFVRMPGSERANADLSRNAKVAEGI
YIAMVNKGEELTVRRASTTGDVHIVDDAVRPADPVSPAIPIIMASSLGLGLALGGLFVLLRDRYLIGVTDSRFIERSMLI
PMLASVPYSPQQARLDQAMPRNLAFRPAESGLPRRPALLPAGTRAPAGEPLRSVSSQYLLARSFPHDVAVEALRGLRASL
RLQVRDVQRPDDGMIVLTGPTPDTGKSFVAANLAVLEAETQKRVLLVDADMRCGRLASFFGKPNAGGLAELLAGRLGLDQ
AIQPAGLAGLSLISCGTYPGNPSELLMVPAFRHLLDELKRRFDLLIIDTPPLLAVSDAAIVANGGGRTVMVLRSGQHAEA
EIEDTLIRLDRAGAWTVGAMFNAVPLRRGERHSYGYSSACLNGDPVIA
>gnl|bykdb|A0A0B6XLB4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella pneumoniae] (length=718 residues).
MTSELTSKTTNSETDEIDLGRLFGELIDYRKLIVSLTAGFTALAVLYTLLATPIYQANALIQVEQKQGNAILNSLSQMIT
GTQPQSEPEIALLQSRMILGKTVDDLNLQARVEQVYFPVIGRGLARLLGNKEGEINVSHLYIPTFNGEKPELKLTVIDNK
NFSIDGNIGSVKGVVNEMLDYKGLALLVNSINANPGTTFKISYIPKLKAISNIQNVFSVLDQGKDTGMLNLTILDSDPDM
ASKILDSISQNYLAQNVERQAAQNAKSLDFLAQQLPKVRNDLDTAEGKLNNYRKEQDSVDLTMEAKTVLDQIVNVDNQLN
QLTFKEAEISQLYTKEHPTYKALIEKRQTLQKEKERLNKKVSAMPSTQQEVLRLSRDVESGRAVYMQLLNRQQELNIAKS
SAIGYVRIIDNAVTDPSPVKPKKIVIIIAGFVFGLFISIGIVLLKIFFRRGVESPEQLEEVGINIYASIPTSEWLTTEGK
KLNKNKKSQEEILLAVENPADLAIEAIRSLRTSLHFAMLEAKNNILMISGASPNAGKTFVSSNLASVIAQTGKKVLFIDA
DMRKGYIHKVFGNPNKCGLSDILAGKASLNDVISNIPNAGFDFIPRGQIPPNPAELLMHPRCEELFRKISQLYDLIIVDT
PPILAVTDAAIIGRYAGTALLVARFEQDTVKSITVSMKRFEQSGTMVKGCILNGIVKKASNYYGYGYNHYGYSYSDKK
>gnl|bykdb|A0A0B7DBH2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas fluorescens] (length=742 residues).
MQLPSVIANRDNDQDSIDLLGIFGSLIDQKWLIGALTGAFMAAGVAYAVLATPVYLANALVQVEPKKNDMLGFSDLNSML
GGQSPSVTEIGIIKSRAVIGKTVDDLRLDIDVTPNTFPLIGGFLARRYRGETEFSVAPPKFGMSSYAWGGERVEIARLDL
PKELLGKKLTLIAGEQHHFKLFDENDNVLVDGVVGEAFAQDDVEGLIAHLSANPGTRFQVVRNPRIVTIQSYQDALDISE
QGKESGIIRLALASADAPEAVKILNKIAALYVEQNVRRTSAEAAQSLAFLQSQLPQVKRDLAKASDALNAYQTHGKTVNI
SLETQSVLGQSVALETRISELKMQQAEMDRKFTKQHPAYRALMSQIGELTQQQRSLEGKVQDLPATQQELLNLTRDVEVA
SQIYTQLLNKSQELDIVRAGAVGNVRLIDTADVDLTSPVKPKKALIVLIATFLGAFVGVALVLLRKSLSRGLEGPEAIEQ
LGLPVYASIPYSALQQEEDGKKGRARDGVDKPAYLLALRNPTDLSIESIRSLRTCLHFAGLDSTNNRIMISGPSPQVGKT
FVSSNLAAVMAQSGQRVVLIDADMRKGHLHKTLNVPIANGLSDLLVKRCSLEQSIKKIEGADLHFISRGQVPPNPSELLM
HANFRELLAELSELYDVVIIDTPPLLAVTDAAIVGREAGISLIVTRFGVNPAKEIELTIRRFAQNGIELKGAVFNGVEKR
AASYYGNGGYGYYNYEYASDKS
>gnl|bykdb|A0A0B7GKQ5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella variicola] (length=720 residues).
MDNCMTSQKNNGAPSQESDTIDVARLFGELIDHRKLITALTAGFTVLALLYALMATPIYQANALIQVEQKQGNALINSLS
QMLPDSQPQSAPEIALIQSRMILGKTVDDLNLQAQVEPIYFPIFGSAISRLFGNSRPKIEVKNIYISSSEHEPEITVIVK
DDYSYQVKWGDAVYNGRTGEILEGNGISLVISSIKAEPGSEFKIKYLSRLNAIANLQDSLNVVDLGKDTGILNLTLSGDD
PDKIALILENISQNYLSQNVARQAAQDAKSLDFLNQQLPKVRNELDIAEDKLNLYRRQKDSVDLSMEAKSVLEQIVNVDN
QLNELTFREAEISQLYTKEHPTYKSLMEKRKILQDEKAKLSKKVSSMPSTQQEVLRLSRDVESGRAVYLQLLNRQQELNI
AKSSAIGNVRIIDNAVTELKPIKPKKTLIVLIGLVLGSFISIALVLLKVLLRRGIESPEQLEEIGINVYANIPVSETQSK
QIVRNKDFNKESKTLLATENPADLAIEAIRGLRTSLHFAMMEAKNNILMISGASPNAGKTFVSSNLAAIIASTGQKVLFV
DADLRKGYAHKMFGNTNNFGLSDVLSGKLEVDKVITKVNESDFDYIGRGQVPPNPAELLMHPRFESFLKNISERYDLVII
DTPPILAVTDAAIIGRYVGTTLLVARFEVNTAKEIDVSIKRFEQGGVQIKGCILNGVVKKSSSYYGYGYNHYGYTYTDKN
>gnl|bykdb|A0A0B7J8W9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Photobacterium phosphoreum ANT-2200] (length=725 residues).
MTATQNTQANSSPGTDEVDIGKLFGILIDNRWLIIITTFIFAVVGIGYALLATPIYKADALIQIEAKSSGMPALGGDMAE
MFGGSESSSTTETEIIKSRMVLGETVDKLNLTTVVSPEYFPIVGKGLARLMGEQQFINVSRFTVADGREQGGYQIVVINA
DKGEYQLNDSDGRKVLVGKVGELAQENGYQLFITDLQAAKGDEFSLAKITRIDAIQHLQRNLSVAEQGKQTGILQLSMLG
ENRADIKAIVDDISKNYFLQNVERNSAEAENSLAFLKQHLPEIKIQLMAAEDKLNSYRQKNESVDLSLEAKSALETMVAL
ESQLNQLTFKETDISQRFTKEHPAYISLMDKRKTLLKEQTRLNKRIETLPATQREILRLTRDVEVNQQIYVQLLNKVQEL
NIVKASTVGNVRILDAAQVYTNAVKPKKALIVVLATLLGGMLSVAIAFLRAALHRGVESPDEIEALGLPVYASIPLSDWQ
TDLEKKSKSKQQLQISQALLAVSNPADLSIEALRSLRTSLHFAMMEARNNIVMISGPSPGIGKSFVSANMAAVMAKGGQR
VLVIDADMRKGRMERQMCVDSKPGLADYLSGQQTLEQVIKSPGVENLDFIARGAVPPNPSELLMHPRLKTLLDWASENYD
LVLVDTPPILAVTDPAIVGAHAGTTMIVARFGLNPVKEIEVTKHRFEQNGIEVKGCILNAVVRKASSTYGGNYGYYNYSY
VSDNK
>gnl|bykdb|A0A0B8PAG3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio ishigakensis] (length=727 residues).
MTQNNRPNRTQQPPQPDVIDLGKLLGLLLDGKWIIIFTTFVFAVIGVTYAILATPIYKADALVQVEQKTSGFPALSEGLG
EMFAQESQASTEIEIIKSRMVLGKTVDKFNLTIVASPKYLPVIGKGLAQRMGEEAFIKVERFDIPDYALTGGYQITLDDP
TTAAFSLTNSDDQLVLKGKVGELARSENGEFLLFVSQLVGKQGQEYGLGKRSKLDAIQWLNGSLSVSERGKQSGILSFGF
EGENKAQIIDLLNDIANNYFLQNVDRNAAEAENSLEFLQEKLPEIKAELTANEDALNKYRQDNESVDLGLEAQSTLKVMV
ELEAQLNELTFKESELAQRFTKQHPAYVAVLEKRKTLEAQKRRLEGQIKQLPKTQREVLRLTRDVEVNQQIYLQLLNKSQ
ELAIVKASTVGNVRILDGAESYSAPVKPKKPLIAVLATLLGGMLSVAFVLLRAAFHRGIENPDQIEELGIPVYATIPKSA
QQEKIDRQLAKNRSRKKLVHAEEMLLASINPADLSVEAFRSLRTSLHFAMMEAKNNVIMITGPSPAIGKSFVSANFASII
ASAGQKVLLIDADMRKGHLGRGVKLEHDNGLSDYLVNDKEINEVIHSGQLENLDFIAKGKTPPNPSELLMHKRFTELCEW
ASENYDIVIIDTPPVLAVTDAAIVGRQAGTTLMITRFAKTAPKEIEVSIDRLEQAGIETKGVILNAVEKTASSYYTYGYY
NYSYKSE
>gnl|bykdb|A0A0B8Z7A1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Novosphingobium subterraneum] (length=736 residues).
MMNSQIPIASDRGNDPSRSADLMQGAEYDEAWLSPLLMQYWQAVLRWRWIIAAIIAAALVAGMVITLMTPARYTAKTQIE
ISREQKKITNVRGIESDTEARDIEFYATQYALLKAESLAERVVRKLRLAGDPAFLAAHGLEPLQVSGPNSARQRSDAEQR
RAISILLSNIEVSPIRASRLVDVSYTSRSPQLSARIANAWAQEFIGSSMDRQFASTADARKFLEERLGQLRQKVEQSERD
LVTYTSGKGIVTLDAMRDADGRTYTQRTLASADLEALNQAYIEARTERIAAESRATVGSVDNSPEVLTNPTITALRTQRA
EAAARYAKILVQFDARYAAARAIKQEMDALDAAIQRETARAAGSRGQSYAEALKRERDLEAKVNALKAELTRQREASIQQ
NIYQREVDTNRQLYDALLQRYKEIGVAGSVGVNNIAIVDSAKVPSGPSSPKMLLNLAVAALAGLILAAAVVFALEQIDEG
IRNPEDVRNFLKIPLLGNVPMTEESPLSEIQDPKTGMSEAYFSVRSTLAFATNHGLPKSFVLTSTQPGEGKSTSALALAE
VIGRTGKSVLLIDGDLRSPSVHRYVGIENKSGLSNLLAGEDLADQIQQTDHRGLWVLPTGPIPPSPAELLSSDKFGQLIT
TFLDRFDHVIVDAPPILGLADSPLMGRATEGVVYIAQAERTSRRAIRASLQRLRAVGVHVFGLVVTKVDFSKHSYGYGYG
YGYGYGYGYGITKEQS
>gnl|bykdb|A0A0B9FYE0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Photobacterium gaetbulicola] (length=720 residues).
MSVIPNTQVNQNSDDIELGKILGILIDSRWFIITITFLFAIVGISYAMLATPIYKADALIQVEQKSTGMPALGEMGELFA
SESSAMTEIEIIKSRMILGDTVDKLNLTTISEPKYLPIIGKGIARLQGDQRNLTVSRFKVPENVLEPVFELIVIDSSVGK
YELVNKSEDRVLIGEVGKLAKNGELELLVSSLNAEDGDEFTISKRSRLDAIQWLQQNLSVNERGKQTGILQLSFIGESRI
KIERILNSISQSYFLQNVARNSAEAENSLQFLRNHLPDIKSQLTASEDVLNKFRQENESIDLGLEAKSTLDVMVTIEAQL
NELTFKESEISQRFTKEHPAYVALLDKRRALLSERERLNQQIQKLPKTQREILRMTRDVEVNQQIYVQLLNKVQELNIVK
ASTVGNVRILDMAQSYTRAVEPKKSLIVIFLTLLGAIFATVFSLLRAAFHRGVESPDEIEAIGLPVYASIPMSDWQIELE
KKQKSKKQLSIADSLLAVSNPADLSIEALRSLRTSLHFAMMEAKNNIIMISGPSPGIGKSFVSANMAAVIAKTGASVLVI
DADMRKGRMEKQMAATTKPGLSDYLSGQDSINNILKKPGVDGLDFIARGDVPPNPSELLMHPRFGELMKWASEQYDIVLV
DTPPILAVTDPAIVGAHAGTTLLVGRFGQNAVKEIEVTKHRFEQSGIEVKGFILNAVVRKASSYYGGNYGYYNYSYSNDK
>gnl|bykdb|A0A0C1GXV4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Morococcus cerebrosus] (length=730 residues).
MYKQYPSSAPAGNDEIDFGQQMQSLWQNKNKIAAAILAGGLAGAVIGLASTPLYRADAMLEIETKQNQILTEINNMLSNE
PAPSEAEVELVQSRLVLGKTVEDLQLDQEVKATYFPIFGNMVHNLSSSDDPMLKIGAFTVSEDWINKPFKLTVKDSKTYL
LTLPDGTTKEGHVGAPLKINNETVLKVDRILAEADQDFELTKFSKLSAIENLKNKLSVISKGKTSPIINLSYTDTDPKKT
STILNSIADNYVSQNRERDVQVASSGLAFISEELPRLKETLQDAENKLNAYRERSGSLDIPLESKGALESLTSIETQITL
LKTEEAGLAELYTPEHPSYKAVLDKLAVLERAKSKINQQIAGLPNTQQEVIRLTRDVETNQATYVQLLAKQQELNIMKAS
AQGNVRVVDHAYTPEKPIAPRKAVITALGALAAGALASMWFLLQGRMRRGITSSEEIEALDLEVSALIPHSKTQQKRDLI
KRKFKSLKGRSTYLLANEDSTDIAVEAIRALRTNIYFSMLDARNNILMITGATPEAGKSFISANLATVMAQSGKRVLLID
TDMRKGYLDQLLNVTPEFGLSDILSGEVSPAQAVIQTNIPNLHLISAGSYPKNPSELLMDNRFKELLSNAQKRYDYVIID
TPPVLAVTDAVVVGQHAGTVLLVSRYGNTTAKELAISAERLRQNKITIKGVILNGMKREANSTYDYYYSYITPTEGKKTA
KKTTSEKPKA
>gnl|bykdb|A0A0C1NY18 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Smithella sp. SC_K08D17] (length=787 residues).
MNSNIPMTPGNPIRPQEEDIFEYIAVIMRRWKTFVLAFLAVFIVVALYTFMMKPVYEASATLHVKDDKGKGSLLGELALN
TSNPVNAELEILKSRTNAEQVVKRLHLDWQISKKSDGLTFRIIEFSSTAKDPVYDIRLNSEGIFKVKDNDGNLAGEGKSG
SLIKGKDFILLLSDLKGEKGDKFTLAQLPFDEVVTGLRSGIKAVEVGRMTSVIKVSYNSTDPVRARDVVNTLVQSYLEQN
ISFKAEEASRTVNFVEDQIQGLRKELDNSEKDLQVYKSSAGVVSLDNEARELIQKISEMEKARADVTLQKKQIEFALDAL
KRSMRKGTIYSPAIMRDDPLVASVASKLSELEVQKKALLNDYTENHPAVKTVQGQIEEIQRKIRSTYETHLNNLAKQQSN
VTHELSLYEKRMQTLPEAERDLARLTRVSSVNAGIYTFLLQKHEEARIAKASTISNIDIVDPAIVPTHPVKPKKAQNLLL
GLLFGCMLGIGLVFFQEYLDDTIKDAEEAKRVMGLPLLGVIPHINGRDPKQNITIPQGETLITQSEPKSAVAESFRSLRT
NLHFTAINKQKKIMLFTSTFPGEGKSIITANEAVVISQTGARVLIIDCDLRRSSLHEKFSHSKTPGLSEILTGDTTFEKA
KHISGIEGLDLITAGTTPPNPSELLGSEAMRQLLLTQRENYDYILIDAPPVLAVTDAPVLATISDIVILIMEAGRVPVKA
AQHMRETLTTLQASVAGIIINDKTGKGESYGYYGRRYGYGYGYGYYSDAEKKPQGKFNWWKEMIPEK
>gnl|bykdb|A0A0C1QD06 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudoalteromonas luteoviolacea] (length=745 residues).
MNAQSNLAAGMQDKQASQQLHEIDLLAIIGALLDRKFFIISITVLCMLIGVVIATFSTPIYQATAMIQVEEKGGTVPGFD
ELGGMFESTSAAITEIELLKSRSIIGEAVDKLKLDIVATPKHFPLIGERAFRTYIPLQAGGLAEPSLGANSYAWGGEEIE
VFRFEVPSNAVGKVFTLVALENNRFELQNDDGQVLLSGKVGEEVINGEFKLTLKTLHARTGTEFILTKKQRLSTILDLQK
AIGASERGKDSGIIILGFLNANPEYAKTVLNEVAQIYVHRNVERNSAEAQKSLDFLEYQLPQVKKQLEASEQRLNDYQVK
QQSIDISLETEGVLKQIVKLETRLQELELKKLELARKFKQSHPSYQAALEQIEAVENQKRRLAREIKGLPETQQELLRLT
RDVQVNNEIYTLLLAKTQELDIVRAGTVGNVRIIDFAEVNTAVPVKPSKHFIVMLATLFGGAIAVALVLLQRAMHKGIED
PNQIEALGLPVYASVPYSEYQVKLTGFAKARKGKTAKAKSILAMDNPADLSIEALRSLRTSLHFAMMEAKNNVIAISGPS
PGVGKSFISVNLATVLAQSDKKVLIIDADMRKGYLQTQFGLKWENGLSDYLSGRIDLQAATKSTQVESLDVMTRGQIPPN
PSELLMHKNFSDLVEEVSAKYDLVIIDTPPILAVTDPAIVSAHAGSTLLVTRFGQNHVKELELTRNRFEQNGIDVKGVVF
NGVVKKASNAYGYYGYYNYEYKSDK
>gnl|bykdb|A0A0C1VZP1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas fluorescens] (length=740 residues).
MQLPSVIGTRDNDQDSIDLLGIFGSLIDQKWLIGAFTGAFMMTGVAYAILATPVYLANALVQVEPKKNDMLGFSDLNSML
GGQSPSVTEIGIIKSRAVIGKTVDDLRLDIDVTPNTFPLIGGFLSRRYRGETELSVAPPRFGLSSYAWGGERLEFAKLNL
PKELLGKKLTLIAGEQHRFQLLDDNDNLLVEGVAGEAFSQDGVEGQVAQLLANPGTRFEVVRNPRIVTIQGYQDALDISE
QGKESGIIRLALASSDAAEAVKILNKIAALYVDQNVRRTSAEAAQSLAFLQSQLPQVKRDLAKASDALNAYQTHGKTVNI
SMETQSVLGQSVALETRISELKLQQAEMDRKFTKQHPAYRALMTQIGELTQQQRSLEGKVQDLPATQQELLNLTRDVEVA
SQIYTQLLNKSQELDIVRAGAVGNVRLVDTADVDLTSPVKPKKALIVLIATFLGAFVGVALVLLRKSLSKGLEGPEGIEQ
LGLPVYASIPYSALQQEEDSKKVRAKVAADTPAYLLALRNPTDLSIESIRSLRTCLHFAALDSTNNRIMISGPSPQVGKT
FVSSNLAAVMAQSGQRVVLIDADMRKGHLHKTLNTPITNGLSDLLVKRCTLEQAINKVEVDNLHFISRGQVPPNPSELLM
HANFRDLLAQLSERYDVVIIDTPPLLAVTDAAIVGREAGISLIVARFGVNPAKEIEMTIRRFAQNGIELKGAVFNGVEKR
AASYYGNGSYYNYEYASDQS
>gnl|bykdb|A0A0C1YJK2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Noviherbaspirillum autotrophicum] (length=755 residues).
MTNQSIPLLSGPPSIRHDDEEIGMATYFDILWENRWLIASIAFVVTLLGASYAFLAKPVYEANMLIHVEEESQKESKNIL
GDLSSMFDVKTAAPSEMELVRSRLVVSRAIDNLRLYISAEPKRFPLIGSWLSGYNRQLSTPGLLGYGGYAWGAEKIDVAV
FNVPDSFLNREFVLTAENDGQFRVMQKDLGVEFKGKVGQPVSVDTDKGAIELRVDRLQGKPGTQFLLNRSSRLATIEGIQ
NSLTVNEQGGKQSGIIAATLQGSDPKMIHGVLTEISKEYVKQNAARKTEEAEKSLAYLNKQLPELKQQLEQAEAKYNAFR
NSNGTVDLSEESKLTLQQQSNAKIKKMELQQKRLELLTRFTPDHPLVQGLDSQLKEINAEINGMQEHIKSLPMLEQNLVR
LTRDVKVNTELYTALLNTAQQLRLITVGKVSNVRLVDAPMLPEKPIKPNRPVILALAVLGGLFLGVLAAFFRKSLYGGID
TPEQVEKMVGVPVYATIPHSKKQKELYQQVAARQQKVPLLAKVSSTDAAIESLRSFRAALQFSLPQFRNNVVLITGATPG
MGKSFVSANLAAIMAATGKRVLLVDADLRNGLLHLYFGFGRQDGLSDAIAGARTPEQVIHHGVIENMDFISTGTLPPNPS
ELLLRPSFGAMLEQLSVGYDLVLVDAPPILAVADTLIIGSHAGAIYITTRAGVTTPGEINESMKRLAQAGLAAKGVLFND
LKARPGRYGYGYGYGTYRNGSSEGDVPLIEASGAR
>gnl|bykdb|A0A0C1Z8N5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia sp. MR1] (length=745 residues).
MNHGKSPALDRTEESDEYGFVRLIDILIEQRRMMVLITIACVLAGVLYAFLAPPVYQADIMLQVEDSPEISSSRSTIADV
SALFDVKSTAPAEAQILGSRLVVSRAVDAVHAYIITAPKRVPIIGRLVAKEASEVSNPGLFGHGGYTWGTETIKVSSFDV
PTRSEEKTFTLTVLPGDRYELTGPGVEAGVEGRIGHKEVFRVRNGDIRLTVDSLAGKPGAAFWLTRRSRAETIADIQSSL
NIQEKIKQSGVVIATLQGKDNVYLRDLMTQIGKEYVRQNVDRKAEEAAQSLRFLDTQLPLLKQQLRASQERLTRFRDENG
TFDLDMEARVMLTQSSETKARLIQFIQKKQELSSRFSGSSRDVLAVDQQIATLQKQADEFEDRIKRLPGLQQELARVMLD
VKVNTDLYTSLLTNSQQLMLVKAGKVGNVRLVDTPDLPQKGVKPKKSLVLAATLLFGLIAATVAAYARSVLFGGFSSPSQ
IEKSTGLSVFSTVPFSKIQASFSRRGTKRPCKLLAYEAPHDPSIESLRGLRTALQFALDQAKNAVVMVTGPTPGVGKSFV
SANLAALLATAGKRVLLIDCDLRDGHLHLCFGAQANAGFTEVITGEASLDSVIRKIGTDLDFIPRGSLPHNPAELLARRN
VRDLIKEVSLRYDVVLMDSAPILTATDATVLASSTGTVFIVAQAGVTKAGDMTECVKRLSQNGVVPAGVIFNGANPSLGR
YGFGPTYGAYRYTPHPYPEPPRLIE
>gnl|bykdb|A0A0C1Z9L6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio owensii CAIM 1854 = LMG 25443] (length=716 residues).
MANQTISSSAPTDDEIDLGKLFGILIDAKWFIIGITLLFATMGIAVALLSTPIYKADALIQIEQKSSGGISAMVGDMGDL
FAAESSATTEIEIIKSRMILGDTVDKFNLTTIATPEYLPFIGKGLARINGTQNYISVSSFVIPRTAQGFKHHLVVTDAKK
GTFDLMIEDQVALSGVVGQTIEMNGYHIKVRELVAQNEDTFSISKISKLDAINRLASQLSISERGAKTGIVSLSIEGEYP
ERNQQILNDVVQNYFLQNVRRNSAEAEQSLNFLKDHLPEIKDKLNGSEDVLNRFRQENESIDLNLEAQSTLKVMVALEAQ
LNELTFKESEISQKFTQDHPAYKSLLDKRQTLLQEKDHLNRQVQKLPKTQREVLRMTRDVEVNQQIYIQLLNKVQELNII
KAGTVGNVRIIDSAQSYAIPVKPKKPLIVVLATLLGGMVAVAFVLVKTAFHRGVTSPDEIEQTGISVYASVPKSVQQLEV
ANKLKRKSNKDLLLLAEENPADLSIEALRGLRTSLHFAMMEAKNNVLMISGPAPSIGKTFVSTNFAAVAAKTGQKVLLVD
ADMRKGYLQQCFGLTADNGLSDFLSGKIAQETVIKQTKVENLNVITRGQVPPNPSELLMHPRFVEFVEKASQEYDLVIID
TPPVLAVTDPSIVGAIAGTTLMVARFDQTTSKELEVARSRFEQSGVEVKGVILNAIEKKAASSYGYGYYNYAYKSE
>gnl|bykdb|A0A0C1ZKS1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio owensii CAIM 1854 = LMG 25443] (length=731 residues).
MTGNSMNGTHSTHPSSNHVELIRFGHHFRTLQKYWLSILAFTIIFSLTCTWYIYSKKSVYQATATLLIQEEQKSALSIEE
VYGVDTTKKEYFQTQIAILKSNHIADKVITQLNLTKHPEFTSASGLKQKIDEVKAIPFVQDLLHVAPNPKETSQHTKPYY
QALQTFKRKLEIEPVRNTQLVRIRFRSTDPQLATTIANAVGQAYIDANFEAKLVVTQNAATWLTNNSQKLEERLRASEQA
LQDFLMQEGLIDINGIDDIYANELEELNRKLNAAVNKRIEAQTLIELLKRKSSQDLDSLLSIDEFANQAQIRDLKLSEAQ
AAKNVSELSQRYGPKHDRMIQAKAQLASIQARTQRLIREISFSKQQDLLAAKSQEDLLRAELDSKKSDFQMLGSQKARYE
QLKREVESNKDLYEAFLNREKETNATSDYKNVTARFTDPAIVPLFPIAPQRMKLVLIATLFGFAIACALVIILETLREVI
RISSDVQDKLGVTCLGTIPKVKKRSLKQGGVTYSAYLDQDEKLFSEACRSVRTSLLLRLTNTRQKVLPFTSAIPEEGKTS
TSINMAVSFSTMEKVLLIDCDLRRPSLAKRFNLPESNPGLTNILTMDTPLSECIVRSDEANLDVLPAGIIPPNPQELLAS
ERFEKLLEYLKSKYDRIIIDTPPLLSVSDALILGQKANGLITVIRSESTKASLVNVALSKQIQHSIPSLGVLITQAKSKE
GEALYVQKYAY
>gnl|bykdb|A0A0C1ZPY7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Enhygromyxa salina] (length=769 residues).
MLDDPRDIPSDAQLVGPARGDPRRPEGRTWPRSTHTPPYAEAEPAASWTATMGSALEILAILRRRWLRIAVTCLIVVVTT
VLAVSLLRPQYRAEVTLLLQPSGAQVLDEVQGLGEQLDTNTYRHYYRTQHEIISSRAVAAEALARLGLAEDPGFLGIADL
ADPNERAKAEAEIDPIERLRELVEIREVHDSRVVRIRVEYFDPALAAEIANTVAQAYLDHVGGERSDTGARAAGDLGLER
DRARQRLRAAEQALDAFKAQHQITTIALEDRQSVITQNIIELSLRTKAAQASSFEAKNLYEQAKKLHQRGIAAGAAALLR
PSERNIFDHLLTERLAAEAEFNAIDLQYGPRHPEWKQAKQRLELFERTTKDQAGGHLATFLARYEAAHATEQQLAAELER
ERLRALELTRLEPGFRELARDVADAEEIYLVLSRRDTEVELTNRIEDEPQVRILDPATTPREAVRPRVALCVAASVVVGL
LLGCVLAVSVDLRDHTLRDLRDAERAVAGWDIAVLGQLPKLAPDPAIGPANLRAQRMRRDLQTHLLPQSLMAERARKVRA
AIGFGMGKERCPVLLVTSPGSSEGKSSTALNLALSWCQAGKRVLLIDADMRRPRLHEVFPAGLDAGNVGLASVLQGSCEL
DDAIERGLAGAPEQLAVLRCGPVPETPSELLDTHAFRRLLAKLRERFDLVIFDSPPVLPVVDALLIARQVDGVVLVARAG
ATSEHEVQQSLGLLRQRDTNLLGLVLNDVDLRREGGRYGSAYYRYEATT
>gnl|bykdb|A0A0C2CM93 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia sp. MR1] (length=742 residues).
MAINFDARYSDVSTGDELRLSDYLAAVFGNWKLVTVVMLAVVALGTAYAFIAPPTYRADALIQTEETNANNNANANVNAV
QAVSQMFDAKSTTAAQIELLRSRLVVDDTVRRLHLDISAVPHTVPVIGGAIASAVSMLNMQMPAGYLSQFAWGNEQIDVP
LFDTPKELYEKKFTVVAGENGSYVLNDPDGVAILTGKVGQEASGMTAYGPVKLKIEKLVGAPGVHFDVQRFSTLTTIDNL
QQRLTVAETALQSGIISVSLEGRNPKETAQIVNNIANRFVQQDADKRSAEAEHTLAFLDQQLPVLKKQLDDAEQRYNTFR
NRQGTVDLSEESRLLLQQIVDNKTKLSDLQQQRAELSQRFTPNHPSVQALDAQIGALSGAQTRLGKSVSTLPDTEQTALR
YLRDVRVNTELYTNLLNSAQQLRIAKAGQIGNVRVVDYAQAADDPVRPKRLIVILISAGVGLVLGILFAFVRKSLYGGVE
RPEEIEKQLGVRVFAIVPRSTEQLRLQRKVGMRREGLHVLAAQAPEDAAVEGIRGLRTSLQLQMADAHNNVVMLTGSRPE
AGKSFLSANLATLVASTRKRVLLIDGDMRRGDIHSHFGVRHSPGLSDVLMGADVTSAILHDVLPGVDLITKGSLPSHPSE
LLASDRLGEVLEQLKQLYDLVIVDTPPVLAVTDATVIGKHAGTSLLVVRHGKNQVQEIGETMKRLHHGGVNMKGVLLTDV
PQSKILMGSTYAGYYGYESIAE
>gnl|bykdb|A0A0C2CNZ4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia sp. MR1] (length=756 residues).
MSHLDRHNPSEAFEIDVIAVLSTLRTHVWRIVLIAAVVTALGTAWAFLWPPKYQADILVQIEDVSDGAAAGTLLGDVSSL
FDVKSSAAAEAQILASRLVLSRTVEKQRLFIDVTPARFPLIGDFVSRVTETPHTPGVFGFGGFAWGQESAELTRLDVPKQ
LQEEPFSLIVEPGGRYELRGDDLSAPVHGKIGAERTVSTQYGPVVINVARMNASPGTRFTVVRHGFDETVDLLQKRLEVH
EKVKQSGVLVATLLGRDPERTGRTLRDIGDQYLKQNVERKYADAAQSLAFLDVQLPVLRRKLEDAQDRLTALRIKRGVVD
LPVQTTTGLQRQVEVKAQLVQLQQRRAELMTRYTAMHPEVMATDKQMSVLQAEMEQFDVALRRLPDLEQETARLMLDVKV
NTDLYTATLNNVQQLQLVKAGKVGSVRVVDTPAVLDVPTWPNRCIVIIAAALGGLLLGIAYAFAREFLRGGVNSAEEIER
RVGMPVLTAVPFSAKQKLVQKQAMRSEARQVSLLASEAPDDPAIEALRSLRTALRMRLAGTPSKVIIVSGAAPGAGKSFV
TANLALVLASMGQRVLLIDSDLRRSSLRPYFGIGQGTGWADAIAGRADFASTVHRAESTGLDFVAAGSLVSNPAELLASS
AVGALIDAARNKYDYVLIDTPPILAVDDAAAVASHADSVLLVAQAGVTRIGEVRESAKRLNHAALKQISVVLNGVPARSI
RSTYGSHGYSTYNYATPADANASRLGSWLRSWLGRR
>gnl|bykdb|A0A0C2CU23 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia sp. MR1] (length=789 residues).
MLSYNMRPVMTPVPQRGDGLADLWRSVVRHKTLLGAVTGTCCAAGVLYVLLATPQYRAEALLRVQSKAGTSISALSDVSG
SMAADASASDESDVLTSRSVVSAAIAATGAETVVETQSHFPLIGNYLASRHATDNELAPALFGLDQYAWGGERLKPGVFT
VPEAALKAKFHVVAGQGGRWTLYDKDDNALAQGRVGETVPFQVDTPEGRAPGELRIDMLRARPGVSFELRKYSQQTTFDN
VLARLRTAIPPRDSTLRDPALIRLSYQAESPLVAQGMVNAIIKTYQERDVERRAAQAQTSLGFLKKRLPALKSDLEAAEN
RLNTFRTQTGTVDIAQQNTALITRMSRLEEQQTNLQLALDAAQHRFQPGNENYQSALTQLNQVKHEIAETSKIASNLPTV
QRQYVELARDVAVTTQLYTSVLTNAQQLEVAAASTPPGIAVVDWAVAPEKQSWPRGWIVLLGSIFGGLFVSTVSIYLIAL
NRKELRSPEEIDHFSQLPRLAVIARSTAQLKQDVRALTHNAAPAKLLAMTSPTDPSIEALRSLRSSVRAMLSGAPVPMNH
LGLGGMNPFNQINGMPFNGTTTVMNPSYVADANQPGGKVILFTGPTQGVGKSFVSSNFAYLLAETRASVLLIDADMRQGR
LRHLVDGRTGPGLAEVLEGTARVDEAIVPLGNGGLSIMDAGAAYPENPAELLGRPAFQETLTMLRDIYDYIVIDSPPVLP
VSDALSIAMQNCDLVLLVSRADRTGARQLEETLRRLENVGAKVGGHVFNGFAPGRYGAREEYGFRAVAR
>gnl|bykdb|A0A0C2F6X9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQNSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDNK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHARPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEEEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGVKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A0C2K266 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio renipiscarius] (length=739 residues).
MKLLSDEKTPVEGESVDFGKYVVLLKRSWFKISLFTALVTVLSVLFALSIQPTYNATATLLIESNTSKAVSIEEVVGIDS
TQQEYYLTQFEILKSRRIAERVIEKLQLDQLPEFNPYIDPKPTLISLAKERIYALPIFASEETQPALTDEELAAKTRYAV
LKSFQSKLYISPIRKTQLVRITFASIDAKLAAEVANAVGEAYIVEGLDARLDATEHASSWISGRMAQLQEQLKNSETALI
EFLAAEKLVDDAESGIDVQASAVINDLILRLSEVTDRRIQLESAYSTLSSGGALAVTDVSSLPEISKHPQVINLRSLIAD
ARKDQTELSKTYGPKHEQMIAVQAKRSNLETQLTQLIKQLVGGIGKELQAVRSQEQLITRELDNRKQEFQSLTVKKRQYE
ALLREEETNRNILNIFLNRQKETTATSDFDSRNARFTDYALEPQFPAKPNRKLIVAFAMIASLLSAISVVLLLDAFNNTI
TSIKHCEDKLGLIPLGGIPKLKKLKKQALGSDVFFSKKHMTFNESIRSTRTALALANRGGKFITLSSSLPNEGKTTCSVN
LALAFSKVEKTLLIDCDLRKSAVAERFGHKRYKPGLTNHLLMNTSLEECLFVDTRTGLTVLPAGMPTPNPQELLSSERFS
QLLHQLAEQFDRIVIDTPPALVVSDAMIVSKVTGKVVVVLKASSTRVTTLRNTISRFMAYDVQFEGVLLNQISEGKGKQD
YVYGDYIHHIDHDAEVQQS
>gnl|bykdb|A0A0C2MSM7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas sp. W15Feb9B] (length=742 residues).
MQLPSVIANRDNDQDSIDLLGIFGSLIDQKWLIGAFTGAFMAAGVAYAVLATPVYLANALVQVEPKKNDMLGFSDLSSML
GGQSPSVTEIGIIKSRAVIGKTVDDLRLDIDVTPNTFPVVGGFLARRYRGETEFSVAPPRFGFNSYAWGGERLEFARLDL
PKELLGKKLTLIAGEQQHFQLLDDNDNLLVEGVAGEAFAQDGVEGLIERLQANPGTRFEVVRNPRIVTIQGYQDALDISE
QGKESGIIRLALASADAAEAVKILNKIAALYVDQNVRRTSAEAAQSLAFLQSQLPQVKRDLAKASDALNAYQTHGKTVNI
SLETQSVLGQSVALETRISELKMQQAEMDRKFTKQHPAYRALMSQIGELTQQQKSLEGKVGDLPATQQELLNLTRDVEVA
SQIYTQLLNKSQELDIVRAGAVGNVRLIDPADVDLSSPVKPKKALIVLIATFLGAFVGVALVLLRKSLSKGLEGPEAIEQ
LGLPVYASIPYSALQRDEDTKKGRAKITAETPAYLLALRNPTDLSIESIRSLRTCLHFAALDSTNNRIMISGPSPQVGKT
FVSSNLAAVMAQSGQRVLLIDADMRKGHLHKTLNVPIANGLSDLLVKRCSIEQAINTVEIDNLHFISRGQVPPNPSELLM
HANFRDLLAELSQRYDVVIIDTPPLLAVTDAAIVGREAGISLIVTRFAVNPAKEIEATIRRFAQNGIELKGAVFNGVEKR
AASYYGNGSYGYYNYEYASDKS
>gnl|bykdb|A0A0C2MVI0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas stutzeri] (length=736 residues).
MTTMPRPIYETKEEKDIDLAHLFDTFINNRVLILGITGFFAALGIAYALLATPVYLASAMIQIEPKTGLPSLTDVVNTNP
PVSPAQTEIALLKSRSVVGGAVENLNLDIIIKPHHFPIIGGFMARRFEPTEENELGWYPAGFDAYAWGGEKLKITLLEVP
DKMHGEELTLEAAENNGFILRDTDDEVVAQGVVGEPVETEDYRINVEELLARPGTTFTVIKNRTYNTTEDYQNRLSAGEH
GKQSGIVNVTLEDTNPEQAVRVLEEVASRYVQQNVARNAAEATQSLEFLAEQVPAVRKKLESAQTALNKYQTGSGTVDIT
AETQSVLDRIVDLEKQISEQNLKRTEMERRFTRQHPNFQALMNQISQLQAQKAELEKQIGTLPSTQQELLRLTRDVEVSS
ETYSMLLNKTQELDIIRAGTVGNVRIIDHAAADLENPVKPNKPLVVIVATLLGLILATAFVYVREALKRGVENPEDIERT
GTPVYAAIPFSDKQSAIEKRLANFKRDKSTASYLLTVNDPADLATEAMRSLRTSLHFAMIEAKNNVLMITGPSPAVGKSF
VTTNLAAVIAQSGKRVLLVDADMRKGYLHKVMRCDGNKGLSDILSGRITLFDAIQKTQLNNLHVITHGQLPPNPSELLMH
ENFSRFVKEVGTMYDLVIFDTPPILAVTDAALVGSQAGTTLMVTRYGMNGVKEIEAAKRRLEQNGLLVKGVIFNAVVRKA
STYGEYGYYQYEYVSK
>gnl|bykdb|A0A0C2MYJ1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas stutzeri] (length=733 residues).
MTALTRSPLDYETDNRIDLAQIARTAFDHKLLIGSITGLFTALGIVYAILATPVYEASGMIQIETKKVGITAQPEIIPRP
DSVSQAMTEISLLKSRAVLGKAVENLKLYITAEPRQVPLIGGYLSRHHDPLEDGPLAKAPLGLDAFAWGGEKIDVFQLDV
PDAYYGEELTLVAGRDGAFSLYDEDDEFLLRGNVGQSVHNAGFTVQVAALEARPGTEFDLMRERPQTTALKYQKRLKVSE
AGKDSGIMQLSLRDPDPDRANRILDEISRLYVRQNIERSSAEAAQRLDFLRSQLPVVRAELEKAEAALNDYQTSSKSVDI
SIETKAVLDQIVALDAVLSEHNLKRVEYNRLYTPEHPIFQTLMKQIAQLQAQKAQLLKKVDALPETQQELLRLKRDVEVT
TQTYTLLMNQAQEQDVLRAGTIGNVRVIDTAYAPVEKPARPIRPLVVAIALLLGLFVSALVVLVRQAFYRGVESPDAIEK
LGLPVYAATPFSVQQQQARRQRKGRAQLLGIGSPDDLAIESMRSLRTSLKFAMLEARNPVLTITSPTPGVGKSFVSANLA
CVVAQAGQRVLLIDADMRRGFLHRAFGLEPTRGLSEALASGLALSQVVSQTEQPNLHLLGCGFAAPNPSELLMHQNFARL
LKEAEAFYDLIIVDTPPVLAVTDAVLVAQLAGTTLLVTRFGLSTAAQIEAAKRRLSQNGVLVKGAILNGVMRRASNSAFD
TGAYGYYSYAQKA
>gnl|bykdb|A0A0C2NDQ2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio renipiscarius] (length=723 residues).
MTTQQSQHTSEHHSDEIDLGKLFGILLDAKWLIVAVTALFAVIGVTVALLSTPIYKADALLQIEEKSSGGISAMVGDMGD
MFSQESSATTEIEIIKSRMILGDTVEEFNLTTVATPNYFPLFGKGIARLSGDVNRISISRFTTPTFAEMMAHKLVVTNAD
QKTYQLVREDERIVLEGKAGELAQQDGYALFVTDLQSHNEFEFDIAQRSPLQAIEWLKQNLAISERGKQTGILSLSFEGE
DRTLIKQIVDHISQTYFLQNVERNSAEAQKSLAFLKQHLPDIKTSLTASEDTLNNFRQKNESIDLGLEAQSTLKVMVELE
AQLNELTFKESDISQRFTKDHPAYISLLDKRNTLLAEKDRLNQQVQKLPKTQREILRMTRDVEVNQQIYIQLLNKVQELS
IIKASTVGNVRILDSAQTYAAPVKPKKPLIAVLATLLGGMLSVAFVLIKAAFHRGVENPDEIEQIGLSVYASIPRSEMQE
NRFSKTNRKKEATTSKQMQLLAEANPADLSIEALRGLRTSLHFAMMEAQNNVLMISGPAPGIGKSFVSTNFAAVAAKTGQ
RVLLIDADMRKGYLQRSFGMQWDNGLSDLLSGKLDKLQSIKTTSIENLDIITRGQIPPNPSELLMHARFKELLDWASREY
DLVIIDTPPVLAVTDPSIVGALAGTTLMVARFGLNTVKEIDVARDRFEKAGIEVKGVILNAVEKKASSSYGYGYYNYAYK
SDK
>gnl|bykdb|A0A0C2Z856 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sulfurovum sp. AS07-7] (length=776 residues).
MSLEIEKKVKRPDEVDLVSIFKVINQYKISIILIALIAFMTTYIYLYFKPSIYSAYALVEVKGQEDTVNTLTQDFIAKQI
GSGTVEKVDKEMEILKTFYLNNKALKFVDLRVKYFIDSEYKNVEIYNKIPITIKDIKVKDGSSGYLKLQLTQAKNGFYLT
KNQSFISSLVSFNEVSSALMAYDKPLQIEGYEFVVHKNEYSSSPVYFQIYSSNQAIFESTVLPNLHISQANVATPLIKIE
YTDNVPQRAFKYADALAESFISDSVKDKSGKNSKVIDFIDTQLISVKDKLKSTEEQLEEYQAKNNLVQPSIQADTLIKEL
SSLDIKNSENQYRDRLIDSLSDFVSQDRQIDSIAPSLMELNDQPTLSLINQLQQEQLKLDALSVEYTPQHPDVLKAKELV
AAIRKKILQNVKTLKYSSVQKTKNLNELKLKYESMLQGLPNQEKNLINLKRDYEVNSNMYEYLLKKKSENEIIQVSVVSD
YKKIGQTYLQSEPVAPKRGFILLISLFLGLIVGILLAVLRYFINDKIQGKTDIENASRLPIYGIIPTEKGEVGIEVFKSA
KSPFSESFRSLRTNLQFALKSDDANVILITSSISGEGKTTVSANLASIFQITNFKTVVIDLDMRKPSLHKLFGVANAKGM
STYLSYRSELHEIINKTKYPFLDLITAGPIPPNPSELVFVKRLELLIKELKNRYEFIIIDTSPIGMVNDSFTLMKYSDIN
LMVFRENFTKKDFVSSLDRAIKEQHVGKIGIILNGSKVKGSSGYGYGYGYGAEGNG
>gnl|bykdb|A0A0C3IC52 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio mytili] (length=726 residues).
MNRTHQNNNQMNRVELIRFGHHYNTLKKNWLSILAFTVVFSLACTWYIYSKTSIYQATATLLIQEEQKSALSIEEVYGVD
TTKKEYFQTQIAILQSNHIADKVIQQLNLTQYPEFTNTGGFEQKIDEIKSIPLVQDLLNVAPNPKETSQYSDSYYRTLHT
FKQKLTIEPVRNTQMVRIKFSSVDPKLATKIANAVGQAYIDANFEAKLVVTQNAATWLTNNSQKLEERLKDSERALQDFL
RQEDLIDINGIDDIYANELEELNRKLNTAVNSRIEAQSLIQLLKRKSSQSLDSLLSIDEFANQAQIRDLKLSEAQAEKNL
SELSQRYGPKHDRMVQAKAQLESIQRRTQQLIREISNSKQQDLLSAKAQEDMLRAELERKKSEFQSLGSQKARFEQLKRE
VESNKELYEAFLNREKETNATSDYKNVTARFTDKAIIPLFPVAPQRMKLVLIATFFGFALACALVIILETMREVIRNASD
VEDKLGVSCLGLIPTVKKRALKTNGLTYTAYLDNEEKVFSEACRSVRTSLLLRLTNSKQKVLPFTSAIPKEGKTSTSINI
AASFSTMEKVLIVDCDLRRPALAKRFGIPESNPGLTNILSMDTAIKDCIVRIDDANLDVLPAGLIPPNPQELLSSERFNK
LMDYLQSKYDRIIIDTPPLLSVSDALILGTYANGLITVIRSESTKASLVNIALSRQLQHSIPSLGVLLTQTKAKSEETAY
VQKYAY
>gnl|bykdb|A0A0C3IIU8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Halomonas sp. KHS3] (length=751 residues).
MTNFPSPAPSPAPRESDELNLRKLVDTLSDHRWFIVSVTGFFLLAGYFNASSQPRIYQADALVQIETRGSNLAFMESLGE
PQQGNPTSAELEILQSRMVLGETADRLDLAIQVEPRRLPVVGDFLVHHGVNQQWFESLTPEFIRQWLADSVDDAWSNPYV
WAGESLRVARFDVPEENVGGEHVLRLLDGGEFELLLEEETLLTGSVGETVQNDELGYRLFVSQAEAHPGAEFTLVRTSAL
SAISELKNRFEIIPRGLESGVYELTLNGADQNQIQPTLDTLTSVFLTQNVQRHSEEAEKQIAFLNEQIPQVSNQLSDAEG
MLNDYRAQRDSVDLTFETQNLLTRVVDVENQLGELAMREADLAERYRPSHPNYQTLLRQRGQLEAERDRLNALVSELPET
QQEVLRLTRDTQVNQQVYVQLLNQLQEMRLVKAGTVGNVRILDAAMLSPGTIAPRIPLITAVSGLFGALLAMLLVIVRML
LSRSIKTPEQLEELGLPVYATLPNSGEQAGLTERIRPRRAKKAQEVFRGLLAVKKPAEIAVEALRGLRTSLYFAMLESDN
NRLMITGASPGVGKSFIAANLAAVCAQAGQKVLLIDADMRRGHLHHAFHGKGIKGLSELLARRISVEEAIRHSELDGLDY
VARGSVPPNPSELLMQQSFHDFLDTISQHYDLVIVDTPPILAVTDASVVGKLVGTSLMVVRFDTNPPGEIKAAKRRLESA
GVRLKGGILNGVKKPTSSRHGYYGSYLYAYR
>gnl|bykdb|A0A0C3N1U6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Thauera sp. SWB20] (length=730 residues).
MRDDRDDFINLGEIIAVLLEYKWLILAVTFFAVFIGAVVALVSTPIYRADGLVQVQDSKGPKGGLAALRDVEAVLGENSS
VTAELEILRSRMILGRVVERLRLDIRATPDYFPIFGRALARRYNGEQPAAPLLGLGSYAWGGERITVQTLEVPSYLVGLP
LTLIAGDNGGFTLYDDQDQPLLDGSVGQPASSADGKTTLFVAELVARPGTHFDLARISQIQAIAALREDLEVRERARQSN
VIEAAYSDADRAEAERLLNEVLNAYVRQNVEYRSAEADATLAFLEKQLPELKAQLDTAEAAYNDYRQTRGSVDLTLETQS
VLSSIVKVDADVVELQQKRDELRQRFTPEHPQVKAIDSQLGRLRAVRGTLDKDVNRLPDTQQTALRLRRDVEVATALYTN
LLNSAQQLRVARAGTVGDVRVIDAAATAPLPVAPRKALILLLSGVLGVLGALGLVWAIRSLRVVVEDPQTIERELSLPVY
ATVPDSKDEAVLSRAIARGKTDKGQLLATAHPDDDAMESLRSLRTTLHFALLGAEKGSVLITGPAPGVGKSFISKNLGAV
LAQAGKRVMLVDGDLRKGHINKAFGIGRGVGVSDYIMGAASIEQIVKPTGIDNFALVTTGQIPPNPSELLMHPRFAALLA
ELEKQCDVLIIDAPPVLAVSDAAIIGRQVGATLLVARAGRHPVRELEQAIKRFDQAGVEVKGFVFNGFDLTRQRHRFGYE
GYHYQYKYKA
>gnl|bykdb|A0A0C4WSI1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Azotobacter chroococcum NCIMB 8003] (length=738 residues).
MYPTSAPHQQEHDDAGIDLRKLLGALLDHKWPIIGVTALFCLGGALYGMFATPIYRTTALVQIEKKSGTVPGLEMGGDVN
AQASSARTEIELLRSRSVIGQAVDNLHLDVRATPQRFPLIGDYLARRHRGPGLAEPFLGLEEYAWGGEKIEVLRFDVEPQ
WAGKRLVLTAADNGAFSLQDGEGRPLLQGRVGEAIDQQGIRLQIHELQARPGTRFTLSKGSRLSTIRTYRGALQLTEVGG
DTGLITVAMNHPDPRHASRVVDEISRLFVRQNVERMSAEVDGSLKFLRTQLPEVRRDLEKAEDALNDYRKRHGSVDIGME
TGTVLNQAVGLETRLSELRMQQAELDRRFTREHPAYKTLLMQIQGLTQRKNEIARRMQGLPETQQELLRLSRDVQVGTAI
YTQLLNRAQEIDLVRAATIGNVRIVDQAVIEGGTVAPDKTLILLVATLVGALLAIGVVLLRKLLNPGLETPEAIEQLGLP
VYAAVPFSEHQAHFKPRRRRAAGSPAQVSPLLALGQPHDPAVEALRSLRTSLHFIMLGAQDNRLAISGPGPQAGKSFVCA
NLAAVVAQTGKRVLLVDVDMRKGQLHRLLGMEEAGTGLSDLLEGRCDLADAIRPTPVEGLFLLSRGQIPPNPSERLMHPN
FSAVLQQASASHDLVILDTPPLLAVTDAAIVGRQAATTLIVARFGVSSAREIELTVRRFAQNGIEIKGAIFNGMEKRAAT
YGYGHAAYYHYEYKPDNA
>gnl|bykdb|A0A0C4Y873 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Cupriavidus basilensis] (length=747 residues).
MNTFNPHEALPGGHVQREKSIDLTGYLDVLMRYRWTFILIAGTVFALGAAYAFFTKSVYRTDIVVQVEDTGSSANTKLAG
SVAPVFDVKPAAAAEIELLHSRMVVGKAVESLKLFIDARPSYFPVIGQALARYNPGLSEPGIFGWGGFVWGDERITVGRL
DMPTRLEGTRMTVTALDGNRYRLNVKGEQTMATGTVGQPLLVPTSRGNVEILITELEGNPGANFNVTRLPRAIAIAQLQQ
SLQIAERGKSSGVIGITLEGPDPDLIAATLNEIGSEYVGQNVRRRAEEAEKSLAFLDQQLPQVKQQVETAETRYNALRNQ
RGTIDLGEESKLILSQSVQIQTRLQELRSKRQELVTRFTGNHPSIGIIDEQIGSLNAALAGVTTRIQKLPEVEQNVLRLL
RDVKVSTELYQSLLNDAQQLKLTKASKVGTARMVDPAEVPLQPVRPNRSMLVIFAAMLGTVGALIVVCLRHMLDGGVAEA
DDIENLTGFTVYSTIPFSPEQSRLAAQGDPKAALLACRMPDDPAMESLRSFRTALQFSLLGNRHPVVLVTGPAPGVGKSF
VCANFAAVLAAGGKRVVLIDADLRRGSLNRRFDTDRGPGLTELLQGAPVEPAVRRQVVPGLDFIPTGTLPEHPADLLLSP
AMDALLTALKANYDIVLIDTPPVLAASDTGILATKADAVFMVARADSTTVDELEAAGRAIRQVGGEVKGVLFNGLNVQGR
WYRAHYNFGKYRYLNYRYQDVDTVQSR
>gnl|bykdb|A0A0C4YPN7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Cupriavidus basilensis] (length=744 residues).
MATSFDTQYTDVGGPAELRLSDYLVTLVDHWRMIAAVTLLALVLGTVYALLQKPVYRADAMIQVEESKGGNAANANQGSS
LQTLSSIFDPNSSTAAEIELIRSRLVVEEAVRKLHLDIAARPRYFPVIGAWLAAYNSGLAPPTELLGLSQYAWGAESITL
SRLDTPQKYYGKVFTLIADSAHTYTLRDPEGNTVLQGRVGEEAEGTTALGPVHIRVDALVGRGGSRFELVRASTIGTVER
IQRALVVAESALQSGIIRASLEGPDPKLTADIVNTVARQFVQQDIGRRSAEAEHTLAFLDQQLPALRKELDLAEERYNSF
RNRQGTVNLGEESRLLLQQIVENKTSLARLQTRLAEIRTRYTDANPAVVALMAQIETLSAQQSTLRRSVSVLPDTEQTAL
RLERDVRVDTELYTNLLNNAQQLRIIKAGQVGNVRVVDFAEPADDPIRPQRAMLVLISGGVGLVLGALLAFLRKALYGGV
EHPEEIERMLGVPVCAVVPRSQTQLRLQRELRASGSSGLGVLAARAPDDIAVEGVRALRTTLQYALHTARDNVVMLTGSR
QDAGKSFLSVNLAALVASGRKRVLLIDGDMRRGEVHVHFGLSQVPGLSDTLMGTDIDSVVIREVLPGLDVLTRGSLPPDP
AELLMSDRFHATLDLFKQRYDMVIIDTPPVLAVTDATLLGRHAGTTLLVVRHGRHSAAEVTETARRLTSGGVTLHGVLLT
DVPKPPLLLRTGYTEYYGYEGRVK
>gnl|bykdb|A0A0C4YQ99 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Cupriavidus basilensis] (length=751 residues).
MNQNPPTVPVAGPPEDEIDLVHYLDVLLANRWLIALIAAVVLTLGLAYSFLASPVYQADILVQVEDSPNSAKSLLGDVSS
IFDVKAEATAEIEILRSRMVVGKAVDNLHLYISAAPKYFPFVGSWIARRSKGLSEPGLFGFGGYVWAGEAIKVELFDVPE
VLEGAPFKLVALGAGRFRLEQESLDRSLEGRVGEVLQATQEVGTLNILVSDLKAKPGAVFNVVRASRLQTLTRLQAQLNI
AEKGKQSGIIGASLDGTNPALTASILNNLGEEYVAQNIKRKAAEAEKSLVFLGDLLPQLKTELERAEVKYNEMRNKRGTF
NLSAEGSALLQESVTAETALLELKQKRLELLTRFTANHPGVQALDQQIATLTAKTGGLTARMGTLPNVEQDTLRLMRDVQ
VNNDLYVGLLNNMQQLKLVKAGKVGNVRLLDNAPIPEAPIKPKKAFVIGISGIAGILLGIIAAFVRNALYGGITDPQDIE
QHTGLNVYATVPLSATQAILTEEIRQRKPGKFLLADRNPNEPSIESLRSLRTALQFAMLDADNNRVLLTGPTPGVGKSFV
SANLALVMATGGKRVLLVDADMRKGYLNQYFGKDRQRGLSDVLVGKIGFEEAVHKQVFENLDFLSTGVLPPNPAELLLNE
RMVKLLQELGEHYDLVLIDTPPVLAVSDTAILAARCGTVFLVTRFEKTTIGEISESAKQLRQANADVNGVVFNGLDANAY
RYGYGSKYGRYRYAYYGYASEEAVQRPPRSV
>gnl|bykdb|A0A0C5KWV7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas hengshuiensis] (length=728 residues).
MIHAATSNQPQETGVETEAASLEIQEILRILREQYRTILACIAGGLLVTGALSLLSAPLYRSSALLQYDPSATEPIEQSR
TMMLRSAVMNQEMVATQVGLLRSDALAMRVAERLNLAGQPGYGGTIGSREDRLQRAASRLKGAIQVEAIKSSLLLRVSVS
AGNAELSTQLTNALAEEFIASSLERRYSSSSYARKFLSDQLAKTKLALEQSERNVNDYAIQARLFRRPGQAADGKVSDEG
VTLSAVDLAALQDALNQARVRRVAAETAWRAGASERPASNEAAISPLIQQRAQLQAQYALNLKLFKPDYPAMREIQAQIA
KLDDQIARERAEGTGETGRALRAAYQAALRAEQVLDVRFDAAKVEMRGERSRSIQYNILQREADTNRSQYEALLQRYKDV
TVAGGIGQSNISLADPPRVPQRPYRPNWPVNLMLGLFAGLAIGVVAAFTANLLFDTIVVGADVRRKLGLRLLGAVPLDRN
SLELDVALANRKSAIAEAYYSTLTGLKFARPEGMPGTLSITSSFPGEGKSTTAFAIAALSARLGRRVLLIDADLRRPTFH
GKGRGVGLANLLASERPATDFIESMEIDNLSLMPAGQVSDSAAELLSSARLPAIVAEVRDRFDLIVLDGPPVLGLTDAPL
LASVVDATMIVIESGKIRTPNVANAVRRVREAGGRVIGVVLTKVTQRNADSGGYGYYEYQSSTASESARFDPNASETKAP
AVARVQRT
>gnl|bykdb|A0A0C5L7Q6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas hengshuiensis] (length=747 residues).
MTGYRPTDDAVGYPLTGGHGRDVLENVLLDDSEGSSRLSMKLTEMLWVLSRNRWLAGAVVVIGLALSIVATVLSTPLYRA
TASVQINQQMPTILEGADVEPAVAMSDANRFIEGQRRVLTSRTLARRVVDELGLARTTAFAKTMGARRVDGGSSKAALEA
RREQAIDLMLANLDAKLPISSRVADISFDSPDPALAARVANRYADSFISMSLETKVGASDYARDFLADQLEESRRRLEES
QQKLIDYSRAEGVIDSSQSGGGSAETAEAPPSLSASNLVALNTAYTEARTRRVLAEQELRGMAGASARSLPQALANPTIQ
ALQQLRAERKAALDDLSQRYIATYPAVRQAAAQVTDLDRSINAQLSEIRASINHSYTVARDQEAALASAVANAQQLALAD
QGKRIQYNILKNEVDSNRSFRNTLLQRSREIGAAAALTLNNISIIDRAEVPVRSIYPKPLQNLAIGLALSFALAVVLILG
REAFQDVIRTPEDVRAKLGLPVIGIVPLATKGMDVLPQLKMPKSPLTEAYNAARTSLEFATATGLPRSLLLISTLPGEGK
TTSAIAIARSMAAVGQNVLLVDGDMRVPSLHRVLDLDNAVGLSSILTNQSAIQGAVQGSELLGFDILTSGPIPPNPVQLL
SGEALGQAMTEFAAYDNVVIDGVPVSGFADALLYANTVDGVVFLVESGRAKTAQIKATLRRIMSVGVTPIGVLLTKFDPR
HAGYSYAYDSYYHKNEPATIDANREAA
>gnl|bykdb|A0A0C5X2D2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Photobacterium gaetbulicola Gung47] (length=720 residues).
MSINPSLQSKNNPDEIELGKIFGILIDNRWSIIAITLIFCVAGILYAMLSTPIYKADALIQVETKSSGLPSLGEMGELFS
TESSSTTEVEIIKSRMILGETVDKLNLTTVVSPKFMPIIGKGISRLKGDSSYIEVSYFEMENSKENLLIRIDENNINKFQ
LLSEDGTKILEGEVGKLAKSNDENFNILITKIDASEGDLFKISKRSKLDAIQYLQSNLLITERGKQTGILQLTFTGENKS
EIENILNDISNNYFIQNVERNSEEAENSLQFLSNHLPDIKAQLTNAEDVLNQFRQDNESIDLGLEAKSTLDVMVKLESQL
NELTFKESEISQRFTKEHPAYVSLLDKRKTLLHERERLNRQIQRLPKTQREILRMTRDVEVNQQIYLQLLSKVQELNIVK
ASTVGNVRILDSAQAHSAPVEPRKPLIVVLALIIGAITSIGVAFLRAAFNRGVENPDEIEAIGLPVYASIPMSDWQVELE
KKQKGKKALNVNDTLLAISNPADLSIEALRSLRTSLHFAMMEAKNNVLMISGPSPGIGKSFVSANMAAVIAKSGQKVLVI
DADMRKGRMEKQMAVEAKPGLSSYLSGQLSIEQLIKKPGVEGMDFIGRGDVPPNPSELLMHPRFKQLMDWASENYDLVIV
DTPPILAVTDPAIVGAHAGTTLIVGRFGQNAVKEIDIAKQRFEQNGIEVKGFILNAVVRKASSYYGGNYGYYNYSYSESK
>gnl|bykdb|A0A0C5XC37 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingobium sp. YBL2] (length=734 residues).
MNSIVSKLGGDTALAALHQSQSEEASIPILRQYLRMAMRWRYVILGAVAICFLIGLVVTLLMTPQYTASSTIEISRESDK
VTDLQGVERDASIADQEFYQTQYGLLQSRSLSERVAAELKLIDSPKFFEMFDAESEDPAFKLVNGRFAPAGRATRQRVAG
EILRKHLSVSPTRLSRLVDVSFTSPDAAFSAKVANVWAQNFIQTNLDRKIQATSYGRNLLQGQLAQLKQKLDESQRQLVS
YASHAKIINLPAQSGSGESSAERSIVVDDLAALNGALAQATANRIAAQTRYEESGKAGASAQALSNTAINGLRQRRAELA
AEYQRLMTQFEPGYPAADAVKAQIDQLDSSIAKEEGRVSNSQLADYRQAQEQEQALKAKVEQLKGDYLDQRRRSIQYNIY
QQEVDTNQALYDGLLQRYKEIGVAGGVGVNNIAVVDPAQAPKLPSSPRLLINLAIAILAGLGIGAALAFGLEQIDEGITD
PAEVKRALGLPLLGSIPKVDAAPRDILLDRKSDLVDAYLAVQTNLSFSTDHGVPRAFAVTSTRPSEGKSTTCLALASTLA
RAGKNIILVDGDMRNPSIHQLGGVANRRGLSNFLSGEDDIPSLLFSMEDLGFVAMSAGPLPPNAAELLTGDRLAHLIGRL
LETYDHVIIDSPPVMGLADAALIATRVEGVIYAVESHGIRTNLVKDAIGRLLTANVRIIGSVLTKFDAKKAHYGYGYGYE
YGYSYGRKTEAQAA
>gnl|bykdb|A0A0C5XKM7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingobium sp. YBL2] (length=713 residues).
MARPGLLIDDSGASTSMEGRAARFAAAASGAWTAVRRHRIILFVTMALCVLAGVVFILLSTPDYRATASVEVEDVPAGAA
GAAAAQRQATPSDNEALMQTELEVLRSRALAEDVARELALIGSRTFFDGMNVRRPEQGTGALSQRQVETETVVGLLRDNL
HVELPGKSRVIRISFTSADPVLSARVANSYADSLIRADLKRGFESGVQARRFLLGELDGARKDLERAERDLAVYAANAGA
MALPGSREAGSKEAGSKEDDGDPSPEGTIATRLAQLNAFRAQATADRIAAQKRWESARMSSVETLPEVLNNGAMQQIMTE
RALARAQVVQERQFRKDAHPEMREARARLAALDDQAEGMANTIRASLKEQFDVAVHGEKQIQSEIAKVERQARAERGRGV
QMSILERQVDTYRLLHDSLLQRYRDMASQAGFQAGRIQPLDRAAVPSRPSSPNIGVTMLFASLGGLILGLMAVAGRHIFD
DAVTSADTLAERVNLPLLGAVPAGEKPGAEIFAPMASSLLLGSAAGLPRSILVTSAQEGEGKSSTLHALARALAKLDKRV
LVIDADMRRPKQHSLFGISPARGISELMTGQARMDDVIVDSGVPGVALLPCGAIPPNPAELLVTPAMDSLLATVRERYDT
VLIDAPPILGLSDACLLASKAQVTLLVVEWGRNHHGGLRVAVDRLRRAGGAIIGAILTKQEGRAFEYDYHRGG
>gnl|bykdb|A0A0C9MX03 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas paucimobilis NBRC 13935] (length=719 residues).
MLMDHSAEPFVDTAPSTGPGVVRALWSATISMFRRRWRIFAVVAIVTFTVAAALILMMPWKYEAVARVKIDPSPSAALGQ
MSGERPDQNIFDTEVNVMRSRDIALAVVDRLKLASDPAFTKGMKPLPATATQAQREKRDTELADRLLGKLSTARDKMTYI
VNVGFTASDPRLAADVANAFANEYIAYSVGRRTGTASRETSYLDQRLAALNQQAMQADARLAQYRAQTGIVSGGDSTVTD
QQISPLASQLATAESEAAAAQARLRVARAQIASGGIDAVSAVLNSQVIADLRSQRAQVIQRQGEVVARYGPRHPENIKVT
EQLTALDKQIKDEANRIIGGLESEANAAQARAASLRGDMGRLRGQQSTDTRASVIADNYQRQADAAHAAYNKLAEQAQQM
NQVARSSLSQAQVIESAVTPDAPTSPNRRMLLMLAGLGAMVLGAMAVVTREVLASGLYSTRDVEALGLPVLASVPRIRSS
KLRNAAGERCSAPALLLEKPMSSYAETFRVLRHALSSGPERQGARIVAMLSSLPDEGKTSSALALARICALAGEKVLLID
TDLRRAGLLEAAKIRPEAGLIEVLTGKLPVDQVLIADQLPGLDLLPVASNSFMAEDLFSGEGMQALLHDMAARYDRIILD
TAPLLGVAESRTIARLVDAAILVIKWGDTPINAVKSALNGLVQDGVPLVGALFSMVDAGEEAYGALYYSSKYNAYYRSE
>gnl|bykdb|A0A0C9N420 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas paucimobilis NBRC 13935] (length=707 residues).
MDLIKAYRRHLTLFLAVAGGILALVAAYSWLQTPRYTATATLVIAPQPAQIGAERTSALSDPAADSSVDTQVELLKSRTL
AGLVVDRLGLAEEARFQALVHNPSILERIPGLERPPTPLPASARRDAAIDRLASGIEVHRNAQTFMLSLSFEHPDRELAT
AIVNSYAQEFVAQSGAVKREGADAAAALLRGQLDEARREVEEADGDLGRYKVAHNLMSVQGGTIAEQQLSSLDGQVALAR
AGEAEATARLQTARQQLARGSKGDDLGEALGSPVIQQLRSQRATVSAQAADLGGKYGPKYPPLAAAQRQVADIDAQIEGE
IKRTISNLEAQRDVAARRTASLAGSASGARSQVVNNNVASIALGGLQLRSDTAHQSYALLLTRLNEIGAQAASTRSDARI
ASLAALPTHPSSPNRPINMLVGALLAIAIGLGVVFMRQGTDRGIRTLEDVEGRLQLPYLAGLPTLNSAVRHIGGSDPISA
LVDHSGSAYAEGYRNLAASVLQSAAAGTVRTIALTSALPNEGKTTAAIGLARIVAMSGVSVVLVDADMRRPSIANALGLR
PAVGLQQVLEGEARLDEALLRDLDSPLTILPMVRAGLGGAAALGGAGFDALIEDLKARFDVVIFDASPVLPVVDGRLVAK
KADSTVLLVRWRKTPDAAVEMAIHLLQTLGVKMTGVALSRVDLHALARSGYGDPAQFMGSYNTYYAN
>gnl|bykdb|A0A0D0FU78 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia sp. MSHR3999] (length=744 residues).
MTQSNQRPDVNVVETAELDLASVLDVLLDNRLLIAAIAAVFIFIGALYALLVTPIYESNILVQIEDSPDASAAKDLLGTL
STMFDVKSTADAEIQILGSRLVVSRAVDKLKLFIHAKPHRFPVIGGWLARRHDGLSVPGLFGIGGYTWGKESIDVAAFDV
PKQLEGKPYKLVALARGRYELSGPGFEQPVNGRVGTAETFPASAGPIHLFVRGINGAAGARFDLVRGSRMDTIEDLQKQL
RIQELGKQSGVISATLRSDDPELLSAILNEIGDQYIRQNVDRKAAQAENSLQFLASQEPKMKRDLEQAENRLNDYRNTHK
VLDLTEEGKSILAQSSDAEQQLFTLRQKRQELLTRFGPMHPGVVAIDEQIAETQGYIGELTDQIKRMPTAQRDAIRLQRD
VQMNTDLYLALRNNIEQLSLLKAGKIGSVRLVDTASLPERAVFPKKMVVVVVATLLGLFVGAGAAFLRDKLFTGVTNVRS
LEAQSGLAVYATVPHSEQQRKLATNMTESTAAGQASLLANLYPGDPAIESLRSLRTALQFAMLDARNNVVLLTGPSPGLG
KSFASANLAVVLAESKRVLLVDGDLRRGILNKYFGEERGAGIADFIAGTRSAADIIRKTSVPNLDLVTTGTLPPNAAALL
MNRNWLSFMQKASADYDIVLIDSPPVLAVTDAAIIATIAGTVFLVARFGQTRVGEVVESVKQLVQSGSHVSGLIFNGMKT
RGGNYRYGGKYGSYRYVSYNYEST
>gnl|bykdb|A0A0D0H5F4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia sp. MSHR3999] (length=741 residues).
MVNTQAKQSYAGLAAKTEEEDVVLGQLIQVIFDDFWTLLGIAVTVVALAGLYCFIAKPVYQADVHVRVEGNDNTSQALTQ
TQTGAVINSGPQQAPTDAEIEIIKSRGVVAPVVEQFKLNFSVMPKTIPVLGSLAARFATPGEPANAWLGLKSYAWGGEVA
DIDTVNVVPALEGKKLTLTAGPNGTYTLADANGGRILSGRVGEAEQGGGVTLMVSKLAARPGTQFTVVRYNDLDAIAGFQ
AGIQVTEQGKQTGVVQISLEGKDPEQTAAIANALAQSYLNQHVIAKQTEATKMLDFLKKEEPRLKSDLERAEAALTQYQR
TSGSINAGDEAKVYLEGSVQYEQQIAAQRLQLASLAQRFTDSHPLVIAAKQQLGQLQAEKDKFANRFRSLPATEVKAVQL
QRDAKVAEDIYVLLLNRVQELSVQKAGTGGNIHLIDSALRPGAPVKPKKVLILSAAVFLGLILGTGIVFLRRNLFQGIED
PDRVERMFNLPLYGLVPESAEQARLDAQAEKSGSRARAILASLRPKDPSVESLRSLRTAMQFALMDAKNRVIVLTGPTPG
IGKSFLAVNLAVLLAHSGKRVLLVDADMRRGLLDRYFGLTPQPGLSELLSDQSPLEDAIRETPVQGLSFIGAGTRPPNPS
ELLMSARLPQYLEGLGKRYDVVLVDSPPVLAVTDATIFGRMAGSTFLVLRSGMHTEGEIGDAIKRLRTAGVDLQGGIFNG
VPPKARGYGRGYAAVHEYLSA
>gnl|bykdb|A0A0D0HAF9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia sp. MSHR3999] (length=774 residues).
MNHLTFNSTPAQRGGEHGQLSGRGLLRLMRDHWVEIVGIAAFIAALSVIYVLLAIPIYSADVLVRVDPPDPNEFGLSSQT
RETPPSVPSPDAEMAVMTSRSVLEPVIQRYRFDITVTPRSVPVLGAIAQKLASPGQPAAPWLGLRSFAWGGEQVRVASLE
VPRALEEEKLTLVARDNGRYELFGPSGEPLLAGRVGEAASSRGVSMKIAELVARPGTNFEVIRWNGLDAVTRFAKSMKVT
DRAKGTGLVEITYLDESPTRAVDVANAISQQYIAYAVAARQRTDSATLDFITKELPRLRAELLRSEQALADYQASAQSMQ
PTMESQAYLQGGIEFDRQIASLQIQRTQLLERYTPGSRWVTSVDTQIKQLHAAKSAFDARFTSMPVSERRNADLARDAKV
AEAVYLGMVQKAEELSVRRASTTGGAHIVDDATVPLHPVKPEKLLIIPGGVALGLFCGVMSVFLRRHVMTGVTDPLYVEQ
RLNIPVVGEVLFSRHQARLDQEMEPPLRRRRVSGGAALMLQRPSARLHRSGSEQQNAVRGHGLTKVLADRFPTDLAVEGL
RGVRTALSRDSAQAPNNVVMFTGPTPAAGKSFVAANLAVLHAEIGSRVLLIDADMRGGHLALNFGQPNRDGLSDVLRCEK
EPRDVMREVGGVQGLWFISCGRPAHNSAALLMSRHFKDLLDRFSAEFDLVVIDTPPHPMTDADIIASTAGATVLVLRSGM
QSEDEIADTVRKLDRAGARVVGAVFNAIPASRGNRYYDYALRIGSAESLGTAAS
>gnl|bykdb|A0A0D0J801 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio harveyi] (length=716 residues).
MANQTISSSAPTDDEIDLGKLFGILIDAKWFIIGITLLFATLGIAVALLSTPIYKADALIQIEQKSSGGISAMVGDMGDL
FAAESSATTEIEIIKSRMILGDTVDKFNLTTITTPNYLAFIGKGLARINGTQDYISVSTFEIPRTARTLKHELLVTDAEK
GTFDLMIEDQVVLSGIVGQTIEMNGYHIKVRELVAQNEDSFSISKISKLDAINRLASQLSISERGAKTGIVSLSIEGEYP
ERNQQILNDVVQNYFLQNVRRNSAEAEQSLNFLKDHLPEIKDKLNGSEDVLNRFRQENESIDLNLEAQSTLKVMVALEAQ
LNELTFKESEISQKFTQDHPAYKSLLDKRQTLLQEKARLNRQVQKLPKTQREVLRMTRDVEVNQQIYIQLLNKVQELNII
KAGTVGNVRIIDSAQSYAIPVKPKKPLIVVLATLLGGMVAVAFVLVRTAFHRGVTSPDEIEQTGISVYASVPKSVQQLEV
ANKLKRKGNKDLLLLAEENPADLSIEALRGLRTSLHFAMMEAKNNVLMISGPAPSIGKTFVSTNFAAVAAKTGQKVLLVD
ADMRKGYLQQCFGLTADNGLSDFLSGKIGQETVIKQTKVENLDVITRGQVPPNPSELLMHPRFVEFVEKASQEYDLVIID
TPPVLAVTDPSIVGAIAGTTLMVARFDQTTSKELEVARSRFEQSGVEVKGVILNAIEKKAASSYGYGYYNYAYKSE
>gnl|bykdb|A0A0D0J9H3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio harveyi] (length=731 residues).
MTGNSMNGTQANHIPSNHVELIRFGHHFRTLKKNWLSILAFTIIFSLTCTWYIYSKKSVYQATATLLIQEEQKSALSIEE
VYGVDTTKKEYFQTQIAILKSNHIADKVITQLNLTKHPEFTSASGIKQKIDEIKAIPFVQDLLHVAPNPKETSQHSKPYY
QALQTFKRKLEIEPVRNTQLVKIRFRSTDPQLATTVANAVGQAYIDANFEAKLVVTQNAATWLTNNSQKLEERLRTSEQA
LQEFLMQEGLIDINGIDDIYANELEELNRKLNTAVNNRIEAQTLIELLKRKSSQDLDSLLSIDEFANQAQIRDLKLSEAQ
AAKSVSELSQRYGPKHDRMIQAQAQLTSIQARTQRLIREISFSKQQDLLAAKSQEDLLRAELDRKKSDFQMLGSQKARYE
QLKREVESNKDLYEAFLNREKETNATSDYKNVTARFTDPAIVPLFPIAPQRMKLVLIATFFGFAIACALVILLETTREVI
RTSSDVQDKLGVTCLGTIPKVKKRNLRQGGVTYSAYLDQDEKLFSEACRSVRTSLLLRLTNTNQKVLPFTSAIPEEGKTS
TSINMAVSFSTMERVLLIDCDLRRPSLAKRFNIPESNPGLTNILTMDTPLRDCIVRNEEANLDVLPAGIIPPNPQELLAS
DRFDKLLSHLKDKYDRIIIDTPPLLSVSDALILGQQANGLITVIRSESTKASLVNIALSKQIQHSIPSLGVLITQAKSKE
GEALYVQKYAY
>gnl|bykdb|A0A0D0JKD7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Stenotrophomonas maltophilia] (length=742 residues).
MTKETSSRAIREDDEIDLRELLGVLIDRKWWILGTTLLFALIGAAYALLSAPVYQAQTLVQVESKMPTIPGLADLTSLGG
GGSTAATTEVALLTSRTIVGTAVDRMQLNVVVEPNRFPLLGGFLARRFEGREPDEVAAPVLGLSRFGWGGESLLIHHLEV
PAKLLNEPMTLVAADTAGTFALADDSGDEILRGKVGAPVEAAGVKIEIAKLQANPGTRFKVTKLRRLDVISQLQEEIRAS
EQGKESGILRIVYENPDPLLAETFVQNIAEAYVRQNVDRSSAEAASQLQFVKDQLPTVRKQVEDAQVAMSTYQSRANSVD
ITMQTKGLLEQEVAVEGSIQQLRMKQAEMDRSFTREHPAYRAMLKQISDLQGRKDSFRREVSALPDTQQELLRLTRDLQV
SNELYTALLNQAQQLDVARAGTVGNVRIVDDAVVDTSKPVKPRKALIVLVSLLLGSFLSIGGVFLARMLNPGVEDPAQIE
ELGLPVYAAIPLSVSSNLLKIQKGRGGKTRVVADGRSHLLAAAEPADLAVEALRSLRTSLHFAMMEAKNNVIAISGPRPG
VGKTFISANLGAVVAQAGQKVLVIDVDMRKGTLHKVLGVSHVSGLSDVLSGKLAVGDAVHAVPGLEQMHYMTRGDIPPNP
SELLMHPRFARMLEELSAQYDLIIVDTPPILAVTDAAIVSSHAGSTLMVTRFGVNQPKEILLSMKRFEQNGVQVKGAIFN
AVERRATGYYSYGYYEYASNER
>gnl|bykdb|A0A0D0JNH8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas fulva] (length=743 residues).
MNSPARTIRQWQPSPSEADSDYIDLRRIWNAIWMRKWAIVLFVVVITLVTALAVSRMTPVYRAVSTVMIETKGTQLVSFQ
QVYDTTGAVNEYLQTQLGLIKSRGVAEKVVRELNLTEHPDFDPRQQPKPLINVGGFVRSVQGMLSVTGLVDEPEPATPMT
EAELLDIVTKMLMDRTSIWVEGKSQLVSISVELPDRLTAAQIANSLASNYIDSQLEAQMEMSLSATTWMNTRLTELRSSL
QEAENRLQAYREAEGLVDVNGVATISNNELSLTGDRMIDARRQRAEAESQFRQVESMGSTDWRRLSSVPAVLGNPLIQQF
KAEEARARAKVEELSRRYGERHPAMAAAKSDLSAASASLRAQVEQVVASIERNYQLAVANENSLNASFNKNKEQIQDISR
KEFKVRELTRDVESNRSLYETFMTRLRETAATQDVNSSNARIIDQAIAPIQAAAPNKKLLIVLAAGLALIFGIALAVIRD
ILNNTFKSADDVENKLNLPVLGIVPLISTNTKYTAAHLFEHGEDARFCESIRTIRTSLMLADTSRSQKVLVVTSSSPGEG
KSTLVANMAFALSQLQRVLLIDADLRRPTLAKSFDFPVGTPGLANLITGSAKVEDCIHNMGNNLDMLPAGAVPPNPLELL
ASPRFAKFLEMIKERYDHIIIDSPPSQAVSDASLLSTFADSVIYVIKSEATSIPLAQRGVGHLLQSGASVMGVVLNQVDV
EKAARSGDYSGYYDHYGYSDRKA
>gnl|bykdb|A0A0D0KIA8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Variovorax paradoxus] (length=753 residues).
MNASQQAAPAMQSLDDDGEGINLTEYWDILVDNRWLVAAVVAVFLFLGTAYALLGKPVYEGNLAVQVEDSGNSAGSFLGD
AASSLLSVKTPAAGEIEILRSRAILGKAVENTKLYISARPRYAPFVGSYLSRRATELSEPGFMGLSGYVTGTEQILVPRL
DVPPDFEEKPFTLTLGTNGQYELSNPDIEVPLKGTVGTLLSANIPNVANGSLGLMVTSISGKPGAQFQLVRSSTQKTLLA
LQDSLKVVEKGKQSGVLDVSWKNADPKKLTQLLNEIGTLYVRQNMERKAAEAEKTLGFLDTALPQFKTQLEQSEDTYNRY
RNQNGTVSLDDEAKNALTQTVDLQSKLLEAEQKRRELAARFTDEHPAIQTLDTQVKAWKSAIAGIDARIRKMPELQQNTV
RMQRDIKVNTDLYVSLLNSSLQMRLAKEGKVGNVRLLDEAIVPEEPVWPKRPLVVALALVLGLAAGIGAAVARSSFFGGI
RNPSEIETHTGLNVYSSIPLSAAQRTLDRNIENKVPGLHVLSHLQPEDPAVESLRSLRTALQFAMLEATNNRLLISGATP
GVGKTFISVNFAAISAATGKRVLLIDADLRKGRVNQFLSISRAGGLSELIAGTLDFEKAVRPSVLPNLDVITTGVLPPNP
AELLMSESFVHVLDRLSPSYDLVIVDTAPVLVAADTASVAPLASTLLLVARAEKTQLGELNETVRRLAHAGRSVNGVILN
AIDLSRRHAGSGGYKYGTYKHLQYSYKSNRDST
>gnl|bykdb|A0A0D0KMD8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhizobium radiobacter] (length=738 residues).
MPVVDFEKLVQIATRRWKIFGAACCAGLALGLVYLFAAQQLYTSEVTILMDDGNASVINELRTVQDAVDNENSILSQVEL
LQSDAVIGGAVDRLKLADNDKFLKSDGFLSDAIKTVRKLVDVKNWFVPDELTGDTATARRRAAINQIVANLDVVRVPRTY
VLNVSFTWADPVLAAQITNEIGQGYLLDKLNSNFETTERASSWLNSRIAELREQSRASDTAVQKFRSDNNLLSAGSVLVS
DQQLDELTRALVVAQDAAAKAEARYSRIMEVLDKGNVNAVVADSLDSNISNDLQKKYLEASKRESEISNRLGPDHIQAIR
LRAEMEQYKLQMFGELRRISNSYRNELEVAKAQERITTENLNKAKVVTAVAGEKQVELRQLERTAETDSNLLKLFLERYQ
QALQQQSFPVTDARIIAKAKVSDVPSHPRKPLLLALFVMAGAAIGLCLAALKEFRDRYFRTGEQVTAELGLQFLGAAPLL
TPAKGEKAPVNTSANEIEKVSSVTNYVVEHPLSGFAETLRRAKIAADLAIPGDGCKTIGIISTLPGEGKSTIAANFAELL
AKQGSRTVLVDCDLRNPGSTRSLARNARYGLLEVILGKMPIRQVLVRNSKTNLGFIPAVISQRVLHSSDLLTSAGMSEAL
SVLAADHDYIILDLPPLGPVVDARAMARKIDAFVYVAEWGKTSRRVVRHTLETENLIASKCLGVILNKVDEQKLRLYRSF
GSLEFYNSRYQKYYIEQA
>gnl|bykdb|A0A0D0KMH9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhizobium radiobacter] (length=735 residues).
MIDLERLFKAVMRQRVIVAAVAALMMVVSGIYAITAVPMFTATSSVMIDKGRSLVLQQLTDLGGSSDDETTVLSQIEVFR
SQAVGYEVVDRLKLVDNAEFMAEDRSIIDVLKSGLAGIFGSDETEGSPDADQLRDSALSRLQAGMDVERVGQTYIINISY
TSPSPELSAKIATGIAEAYLRDSLNSKYEATRRASKWLQERIAELEQKALQSDLAVERFRASNGLLSTGNGLVTDQNLAQ
INSALGTAQSQAATARARYEEITKNIEANDVDAVVKEVLDSPIANNLREQYLLSAKSEAEISARLGPNHEQAVRHRRNMA
EYKALLFGELGRIAQSYNNEAQVADGRVRSLLASLATSSSQSAVADQSQVKLRELQREAETYRNLYQSFLQRYQQAIQQQ
SFSATGARIISRAAPPLIPSSPKLMLSIVGGLLLGGILGGAIGALREFQERFYRTGDGIREDLGKEFLGMLPLVDDRDNT
ALPVVSEQATERSVRAGSLTSRYSLSNPLSSFAETLRSAKIAVDFSTSPNANRIVGIASTLPDEGKSTVAVNFARLLASQ
GHQCVLIDADLRSPGATRMIAPHAKAGLVEVLLGEVSVEDALMTDPLSGMKFMPTVLRERLPFSAELLVSPAMRGVFANL
LSKYEYIVLDLPPVGAVVDARALSSTIDSFVYVVEWGRTARRAVRNAFQTEEQISRKCAGVILSKVDQKKMRLYSLHGDT
EYYASRYSSYYEEAS
>gnl|bykdb|A0A0D0KVN8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhizobium radiobacter] (length=782 residues).
MHHKTFKSNLNFSDASKDADTFIDLDRLWAAVMRRAKIIAACVIAMMILAGAYLLFATPVYTAMTQVLLDDSLSRYAEDE
SPVPAAQIVDNRIASAVEILKSKEMALTVVDKAALDANDTIVNPPKSPADLVKSSIKVVVDLLTPNSPPASEEAMRNGRR
EKAAAVIQQALTVERVGRSSVIAISIRSIDRQLATQIAKTYANSYLTEQLNANFDATERASVWLQERLTDLNQRSQAASL
AVEKYKAANNIVSSRGELMSESQLSDLNGQLIAAQADAATASARYTQYKSITDQGPDNAVNNAIVSARDTDNTVIQDLRK
RYIAISDRERGVVQQFGKDHPQAIALESEKGDLARQIYQELLQLTGGFKNEFDVTESRVQSLRENIDRVAGRNSEANMTL
VKLRELEQQAAALKTLYESYLGRFEEASQKQSFPIAKARVISEAGLPTAPSSPKKTMTMALSIVLGLMLGGGVAAILEFR
DRYFHTGNDVRDNLRMRFLGYLPFIGEKGVETTKSETGAAMPEIPDTDIEDNGQVSFQKMLRLAVDSPRSSFTETLRNVK
LTADVVIQEKQCRVIGVISCLPNEGKSVVALNLAGLIATTGKRTLVVDADIRNPGLSRMLTTRQSAGLVEVVLDEVPWTK
AVKMDSRTKMGILPVSTSNQFAHSSELLASSGMRKFMESAREACDYIIVDLAPVVPVIDAKAFASQVDGFVFVTEWGKTP
IQMVQNLMNHEPEIASKTLGIVLNKTDMTELQRYAGPGGSEHYHDQFSAYYGDAKKPVAEPV
>gnl|bykdb|A0A0D0KXK6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Variovorax paradoxus] (length=764 residues).
MNARWYPPLPAPLGAEPERPRSGLREYIDILLDHRWLIAAVTAVALVLGACYALFGPRVYESNVLIQVEDPDRSGSPADA
AVNGVSVKTPTSGEAEIMKSRLVLGQAIENTRLFITAQPHYLPLVGAFMARHSKGLSTPGFLGMGGYVSGTERISVARMD
VPSDLEGKRFLLTTGADGSYTLTHPDLAAPLQGRVGVPLEASVPGGSINLLVASFEALPGAAFELTRRSKQLVLLDLQRD
LRVIEKGKQSGVMDVSWQTGNPMQLTDLLNEVSRLYVRQNIDQKTAQAERTVNFLGTELPKFRQQLEQSEEVYNQYRNQN
GTVSLDDEARNALAQNVDLQSKLFDARLKRLDLASRFTALHPTVVTLDAQIASLRKELGTVDARIRRMPMLQQNSVRMQR
DIKVNTDLYASLLNSSLQARLAREGRIGNVRVLDPALLPEKPVRPKAAIVMALALAAGLFLGSAAAILRKMLKSTVANPD
EIEAHTGLAVYSTIALSTHQPALDRAIRLGRPGVQLLAATHPEDPALEGVRRLRTTLSFVMLGAPNNRILMTSATPGAGK
SFVSANFAAVLAASGKRVLLIDADMRRGNLAGPFGLEQEDGLAELIAGEATLLRTIQTHVLPNLDVITSGTLPQDPSAAL
SSDAFAKLLETLSARYDTVVIDAPPILLATETVAMASGMGTLLLVARAGDSQLGDMVESARRLAHVGASFHGVVLNGLDM
RQRHYGSYGYGYGLYRFRPHAYPAVGHTPASAQIQRNEPEHAAS
>gnl|bykdb|A0A0D0S9N8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Lysobacter sp. A03] (length=725 residues).
MSTRYEGAAAEDMRALDIASPARPDDDEIDLLAYWQILRERQWLVLGVIGAVVLLTLVITLLATPIYRAATTIQIERDTM
NVTSFEGLSPESTQDRDFYQTQYELLQSRSLAQRVIQDLNLVESPQFAKTIEKVNERLAEKSGADAAPAAAQQARERAIV
GTVMGGLTIEPVRNSRLVKVSFDSPDPQLAARVANAYAEGFIASNLERRFDASTYATKYLEERLAQLKARLEDSEKELVQ
FSEREQIVSVGEGTPSLSAQNLSQLNASLSKVQDERIKAESRLNNASTGNGLGLPQVVSNAMIQGLRQQRAGLAAEYQQN
LGVYKPDYPDMVRLQGQIRELDSQIATEIANIRASIKADYDAAVRQESLLRDQLDSLRGDVLDLEGRSIQYNILRREADT
NRQIYDALLQRYKEIGVAGGVGANNISVIDPALVPGGRHSPRLALNLAIGLLLGGFLGVLAAFVLHVLDRTVKTPDVLRA
LIPRPVLGVIPRLADGTTPAQAAADARSPFAEAYRSLRTALQFATPHGLPHSLLVTSASATEGKSTTAMELARNIAQLGK
RVVLVDADLRNPSIHRLMNLSNSVGLSSVLAGAAQAEAAVQPLAGSTLSVITSGPLPPSPPELLAGDGLTTLLESLRADF
DVVVLDGPPVLGLADAPLLANRVEATLLVVSAEKTRNDALQVALDRLVSVRAHVLGTLLTGFDHQRKGDGYGYSYYSYGS
GDATK
>gnl|bykdb|A0A0D0SPC7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas fluorescens] (length=738 residues).
MRNTAAVPDSAPHIQRQVEDDSIDLLKFWRIIWGRKWSIFGLVFVVSLVAALAAFTVTPIYRAVASLLIEEKAAKVLSIE
QIYGADGSSSEYLQTQFELLKSRALAERVVTELKLVDNREFDPRQQPSPLLNIAAWKQSLSGFFGVPPAPLDELEEQTKR
FDEVTRAFMERVKVEPQGKSKLVKVQVEMADPRLAMVVANALADGFIERQLEASQGVSLAAGSWMSSRLGELRGQLKDSE
ELLQRYREAENLVDVGGVGTISAAELAQTGDRMIDARRQRAEAESQYRQVQSIARNDWQRLGSVPAVLGHPLIQQFKADE
ARARAKVEELSKRYGARHPAMEAARSELSAASGSLRGQIEQVVAGIERNYQLAQANQTSLQSSFDANKSRIQEISRKEFK
LRELQREVDANRTLYETFTNRLKETAATSDLNSVTARVVDPAVLPDKPAKPHKALIVFIAAMLTFFVAAGLTLLLDALNN
TFKTAQQIEDHLNISVLGVMPLVEKSYRNQMSQVFHRNLDRRFSEAVRSIRTGIVLSGIDNPHQVLLVTSSVPAEGKSAL
SISLACALGQLERVLLIDADMRRPSLAKSFQFPAGTPGLANLLAGTATEQDCIRQVNGIDVLCAGSVPPNPLELLSSPRF
AALLNDLKGRYQRIIFDSAPTQVVSDAFHLSTYVDFVIYVSKWAATPIPLVEKGIGQLLQNKAPVKGIVLNQMDFDQAKG
DGQSYDGYYEYHDESRAT
>gnl|bykdb|A0A0D1DIR6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio parahaemolyticus VP766] (length=719 residues).
MANQTIQSSALADDEIDLGKLFGILIDAKWFIISITLFFATLGIAVALLSTPIYKADALIQIEKKSSGGISAMVGDMGEL
FSAESSATTEIEIIKSRMILGDTVDKFNLTTIATPDYLPFLGKGLARINGTQNYISLTTFEVPRTARGLSHQLIATDIEK
GQFSLMLEDQMVLSGSVGQLIEMNGYRVKVNQLNAQNEDTFTISKISKLDAINKLASQLSISERGSQTGIVSLSIEGEYP
DHNQLVLNDVVQNYFLQNVRRNSAEAEQSLNFLKGHLPEIKDKLTISEDTLNSFRQENESIDLNLEAQSTLKVMVALEAQ
LNELTFKESEISQKFTQDHPAYKSLLDKRQTLLQEKERLNKQVQKLPKTQREVLRMTRDVEVNQQIYIQLLNKVQELNII
KAGTVGNVRIIDNAQSYAVPIKPKKPLIVVLATLLGGMVAVAFVLVKTAFHRGVTSPDVIEQTGISVYASVPKSAQQLEV
ANKLKRKNNKDLLLLANANPADLSIEALRGLRTSLHFAMLEAKNNVLMISGPAPSIGKTFVSTNFAAVAAKTGQKVLLVD
ADMRKGYLQQCFGLTAEQGLSDLLSGKINRATAIKPSQVENLDVVTRGQVPPNPSELLMHPRFVEFVEQVSKEYDLVIID
TPPVLAVTDPSIVGALAGTTLMVARFDQTTLKEIEVARGRFEQSGVEVKGVILNAVEKKASNSYGYGYGYYNYAYKSES
>gnl|bykdb|A0A0D1E079 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio parahaemolyticus 49] (length=719 residues).
MANQTIQSSALADDEIDLGKLFGILIDAKWFIISITLFFATLGIAVALLSTPIYKADALIQIEKKSSGGISAMVGDMGEL
FSAESSATTEIEIIKSRMILGDTVDKFNLTTIATPDYLPFVGKGLARINGTQNYISLTTFEVPQTARGLSHKLIATDIEK
GQFSLMLEDQMVLSGSVGQLIEMNGYRVKVNQLNAQNEDTFTISKISKLDAINKLASQLSISERGSQTGIVSLSIEGEYP
DHNQLVLNDVVQNYFLQNVRRNSAEAEQSLNFLKGHLPEIKDKLTISEDTLNSFRQENESIDLNLEAQSTLKVMVALEAQ
LNELTFKESEISQKFTQDHPAYKSLLDKRQTLLQEKERLNKQVQKLPKTQREVLRMTRDVEVNQQIYIQLLNKVQELNII
KAGTVGNVRIIDNAQSYAVPIKPKKPLIVVLATLLGGMVAVAFVLVKTAFHRGVTSPDVIEQTGISVYASVPKSAQQLEV
ANKLKRKNNKDLLLLANANPADLSIEALRGLRTSLHFAMLEAKNNVLMISGPAPSIGKTFVSTNFAAVAAKTGQKVLLVD
ADMRKGYLQQCFGLTAEQGLSDLLSGKIDRATAIKPSQVENLDVVTRGQVPPNPSELLMHPRFVEFVEQVSKEYDLVIID
TPPVLAVTDPSIVGALAGTTLMVARFDQTTLKEIEVARGRFEQSGVEVKGVILNAVEKKASNSYGYGYGYYNYAYKSES
>gnl|bykdb|A0A0D1EKM5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Jannaschia aquimarina] (length=768 residues).
MNSAGVGNVRGTSDPGKPGGVRISRFLGRPIVNSNADNLTVPQFGPPMRPAPTQDTVDLRRLLIALWRRKWLIVGATVIG
MLIAYAIVSRLTPQYTARASVMLDPRTVQVVTSDEIISDLTLNNSVVDTELAVLRSNLLLEQVIASFGPGELDPIDPAND
PPGLLSRLRGAIGLGGSGGGAEGASAPITQEERRMRRLLVSMRRKVTVWREGQSYLLSIGVTTTDAVLSKEIANRIAETY
ISSQIEQRSATIRSASSFLTERVEEIRASVEAAEAAVEEFRRSQLETAGVSAETLEQQLLELSSQVSVAKADLASVKSRF
DRIQTLIDAEGIEAASELLSSPLVVALREQLLALRREDADLATRLGPEHPQRQRLQAQIDAIVEDLAAEVRKIVAGLRND
AEVAQIRSESLESSLSEIEERAGAMSRSSLELRQLEREAEAIRSIYQMMLERLNETRSVEQLQRADARMVNTAQVPGAPS
APRTTLFSVLGGTVGFMIGVIAALAGAISTRGFNRASEIERSFGITVLTSLPLGAWRSLRGMQKSIQKLPYQPFADRLRI
LRENIRPRHISGTQRTVLITSSVPGEGKTTTAVGLATVEGLAHRRCVLLDFDLRRSNLGRELEYDPQGGGDLTALLRGEC
NVEAAVHRVDPFGFDLITTRGRNPQLIDDTSVERLREVIKDLESRYEMVIVDTPPVLLVADTLTLVGLIDTVLMVVKQTT
TRRNAVQDTLRTVEDAGARSIGLVMSMVDSRDEQETYGTSGDYSYANR
>gnl|bykdb|A0A0D1GHE8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio parahaemolyticus 901128] (length=719 residues).
MANQTIQSSALADDEIDLGKLFGILIDAKWFIISITLFFATLGIAVALLSTPIYKADALIQIEKKSSGGIPAMVGDMGEL
FSAESSATTEIEIIKSRMILGDTVDKFNLTTIATPDYLPFVGKGLARINGTQNYISLTTFEVPRTARGLSHKLIATDIEK
GQFSLMLEDQMVLSGSVGQLIEMNGYRVKVNQLNAQNEDTFTISKISKLDAINKLASQLSISERGSQTGIVSLSIEGEYP
DHNQLVLNDVVQNYFLQNVRRNSAEAEQSLNFLKGHLPEIKDKLTISEDTLNSFRQENESIDLNLEAQSTLKVMVALEAQ
LNELTFKESEISQKFTQDHPAYKSLLDKRQTLLQEKERLNKQVQKLPKTQREVLRMTRDVEVNQQIYIQLLNKVQELNII
KAGTVGNVRIIDNAQSYAVPIKPKKPLIVVLATLLGGMVAVAFVLVKTAFHRGVTSPDVIEQTGISVYASVPKSAQQLEV
ANKLKRKNNKDLLLLANANPADLSIEALRGLRTSLHFAMLEAKNNVLMISGPAPSIGKTFVSTNFAAVAAKTGQKVLLVD
ADMRKGYLQQCFGLTAEQGLSDLLSGKIDRATAIKPSQVENLDVVTRGQVPPNPSELLMHPRFVEFVEQVSKEYDLVIID
TPPVLAVTDPSIVGALAGTTLMVARFDQTTLKEIEVARGRFEQSGVEVKGVILNAVEKKASNSYGYGYGYYNYAYKSES
>gnl|bykdb|A0A0D1M8A8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Bradyrhizobium elkanii] (length=758 residues).
MLQRNQIPPSLDLRNRPAELPSLAETFDAFISYLLRQYWIILGTAGLCLFAGICYLMTAAPSYTALATMIMDTRKFQVMQ
QQSPVTDAPVDSSAVESQVEILKSENVALAVIRDLKLADDPEFVGSRTGAAGAVLDFVSGLFTRRAPLSEFDRTRRAVRT
FQKQLDVRRRGMTYVIEISFRSLDPERAAQIANAVADAYIVDQLDSKYQATRRASVWLQDRIQELRSQASNAERAVLDYK
KANNIVTSSGKLLDEQQLGELNTQLVQVKSQVADAKAKLDRIEAVVKAGAPDATVADTLNNQVITKLRSQYLELANREAD
WSSRYGYNHLAAVNLRNQMREVQSSMMDELKRLAESYKSDYAIALQRQNEIERAVNESVSQSQSTNQAQVTLRELQSSAQ
TYRSLYDNFLQRYMENVQQQSFPVSEARVITRASRPLSKSHPQTLVVLAISTLGGLIAGLGLGVLRDLYDRVFRTADMVE
AILDTDCIAIVPRVPPGQIKAAVAAGRPSLPGAPRAIQRGAEPVLWAAIDAPFSRFSEAIRSIKVNADLNVTKPSKILGL
TSALPNEGKSTLAFVFAQLVSQSGARVLLVDCDLRNPSLSRKVAATAERGILDVLSNNATLHDTVWRDPETGLAFLPGAT
RSRIAHSHDVLASDQMKEFIDRARGHYDYVIVDFPPLTPVVDVRTTAHFVDSFIFVVEWGKTQVQVVERALRSARAVNEN
LLGVVLNKADIAAMSRYSGYGGKNYYYNSHYGRYGYTE
>gnl|bykdb|A0A0D2T3R6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Skermanella aerolata KACC 11604] (length=736 residues).
MRTIIQTNEKQLAHYAAVLWQRKFLIALFVVVSIGLGYWGVRQVTPLYTAEAVVALKTRPQTLIDNAAPAAIAARPDIAS
VKTEAESVRSTLLIGQVVDQMNLVADPEFNLAIAEELSLRDRARLIMNGAYALAADGLKQVGIELPAPEPDPEVDPRSAV
INTIARQLQVSSAPDAYTIRIQFVSEVPEKAALIVNELVDHYLANQVAENQREASQAMVWLEQRVNGVRAELDQATAALA
DFRTKNNLVPVGPQAQLATQRIIALNTELGTLKVARLEAEAQLAQVKQLQASGRTDSMEIVTRNPTIQILRQQEADLAAQ
VANLSQSLGARHPDLVKLTQQLNQTRRERAIEVAKVVQGLESRANEVRARERSAQAEIDSLRQEANLSGRGADELAQLQR
AADGKALQLEALEQRFKEATSRIDLDQAGARIVTSARAPLEPSHPNKPLFLAVAALGSMLLAMTLAILYDHLTPGFRSAR
EIKNELGLKMLGAVPKVRLSGQSIADQVLLKPLEPYAEAIRTIITGLTHERPAGGRAKMVLVTSSVPDEGKTSLAIAVAR
TLTLSGLRVLLLDCDLRRPSVGAAFRFGNAAGLVECIEKGVSLEEAIRVDEATGLDVMPAGRGIQNPQRFFASSSAVGGA
LQRLMMNYDFIVIDSPPVMVASDAALIAKGCDSVLYAVEWEKTPRSAVKAGIESLTALDIAVAGIVLTKVDYSKQRYAGD
MSAYAYRYKDYHNIPA
>gnl|bykdb|A0A0D2VRF0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Skermanella aerolata KACC 11604] (length=762 residues).
MSVEMLSSPISEPAPAQPRPAKGDEIDLGAIVAAIKRRRGTILGLAVLCTSIGIGASYAVKPSYWAEAVVSLNVRNAVVT
DNQSVVGDLKVDSSVIRGEIDIITSRVAAGRVVDALALKPEPAVEDGALKTGLQRLGNQIVESGLFDSVAGLIGPNDTVA
SLRQTLAATPAPVVPMVSDPREQMINTLLGNVSASNDGRSYSIRIGYSAASSDQAALIANGFAKEYLDMQRDEKVRETLN
ANDWLKRQVQTLREDVLTAESRVQKLQENAGLGDATRGGSAVNQQMTQLNVQLVAARAATTQAEAKLRSAQDLLRGGSVE
SAAGVLASPMLQLLARDQTEIKRKLADMSSQYGDRHPTIIGMRSELGSVEARIKDEIQRAVQTLNTDVAVARASEQSLQS
RMRQLESNYADGAKVEIQVRQFQREADAARELYQNFLQRMKETGAQAELARPDARIISEAVESPFPAFPNRKLFAVIGLV
FGLFLGLFIAFVAENLQRGFNDLDEVEGETGIAGFGTIPLVRGRRKNNPVDYLIEKPISSYSEALRTVQSLIHSVSHSRT
ARVILVTSSVAGEGKSTFCASLTRQLALGHQKVLLIDGDLRRSHLLEVLPANSSLNKGVAPADLIEVLEGKRDFGDAIRV
DEATGLHYLATARHEDNPQRLLMGREMQNVITQALRHYDLIVIDAPPVMAVSDALVLARYADASLLMVRWNKTSRKLVQD
AIKRLRVSGVKVSGAVMTMVDQKKKARGGYEDYSYRNPYYTD
>gnl|bykdb|A0A0D2WNA4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Skermanella aerolata KACC 11604] (length=757 residues).
MNKLLTPERQETDRHDWTTHEEGPSRTAPTLGLADLLMVLSRRKYLLLGTIGIVTLIGIVNVYMLTPLFTATTSVMVDPR
EQRVINIESLVAGGPADQSTIESEIQVVQSDELASRVIAQLGLDRLAEFNPKVAAEQEADSFQLPSLRDLPPVQWLKSLL
SDGEEETPDPAAAEARLRTAIEAKFLSRLNVSSVGRSRVLNISFTSQDPAIASSVANSIANLYITQQLEQKFDARQKANA
WLTERLTRLREEVETAERAVETARASQGVVQGRDAGLVNEQLSQLNTQLVMARAENSTSVAQLRSVESAVEARGIRAVFD
VTDSTLVNGLRAQETTLRQREAELLNNLGPRHPQVVDLKSQISSVSNEINNEANNRLRALRNQAAVTQQRVASLEQSMSR
LEQESARVNQSDVQIRALQREADANRALFENFLARSKETQSVDLEQPNAWIVSTANSPLNPSFPQKPLFIAVALILATGL
GLTLVFLAEQLERGMQTQEDVERMLHLPSLGMIPLVKRNRLSRMPPQDYALDKPASAYSQAVKSLFTSLIIAHQRKGTGN
IVLLTSAVPGEGKSALVATLARVTAIAGRRVLIVDCDLRRPNIHRSLSLPNQYGLADFLSGNATLPDVMRTDSRTGADVI
TAGSPTDNPEEIIRNPLFDQMLFNLRPQYDLILLDAPPVLPVSDTRILAEKASQCVVVVKWRRTPRKLVQLAIRQLTEAG
ANIAGVALNQVDTSKAARYGSGEVEYYMGRRGSYFKN
>gnl|bykdb|A0A0D5IRE1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia dolosa AU0158] (length=757 residues).
MNALTLPDPHDAPALRPSHPYRRYWNMLYGGRRLILCTALAGALAGAIYALCARPVYRTDILFQVEQSPTEQKPASPPGD
PSSVFDLKTDASTEIEVLKSRAVMARAVASTNLSVDARPHYVPLIGWRLVNAADGLSTPLPGGYVYGTERIDVPTFDVPK
RYLGKRFALVVGNGGTYTLQRTGLFGRTGPVWEGRVGQPLHVETPQGPIDVFVRDVAGEPGARFDLTRYGDEEATTWLQK
NALISERGKQSNMIGVTLDGPDPVHDSRVLNAVGDAYLAQNTQRKSEAADKLIRFMDAQLPQLKAQLEAAENRFNAFRAS
HGTVNTSDEALALRQQSVDIETRVQTLQQRREELLTRFMPKHPAVAAVDAQLADAQRSLGTVRKQIEQLPAVEQGVLQLQ
RDVAVDTALYTNLLNARQQMIIARASKSGTVRIVDPAKVAELPAGPHRGMAVVASLLIGLLAGAAVVVIRQRVAGTVGDA
EDIEWSVGLPVFATVPHSPASVEAGPRAKLAQRDARAPAPPVAALAMDDAALESLRHFRTTLQLSMPDAPNRIVLISGPT
TGVGKSFVAANLALLAGAAKRRVLLIDADLRKGSLHDRFRYSRAPGLSDAVAGTHADDEAIRHGAAPGIDFMPMGSVVPD
PGELLLQPALAALIERLAPRYDMVVIDAPPLLPVADALVLGRLAGTVFLVARSGVTTTAELDESARRLEHAHIRVRGVIL
NDFKGAPGRYDYGYADTNTHQAASGYAGAMAARPPAR
>gnl|bykdb|A0A0D5L6N6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia sp. 2002721687] (length=739 residues).
MVNTQAKHPYADLAVKTDEEDVVLGQMIQVILDDIWLLLGIALVVIALAGLYCYVAKPIYSADAQVRVEASDNTSQALTQ
TQTGAMINSGPPTPPTDAEIEIIKSRGVVAPVVEQFKLNSSVSPNTFPILGAIAARLATPGHPAKPWLGLSSYAWGGEEA
NVDSIDVTPALEGKKLTLTAGADGAYTLADPDGALLVRGKVGESEQGGGVTISVSKLVARPGTRFTVIRQNDLDAITAFQ
SAIQVTEQGKQTGVIQISLEGKDPEQTAQIANALAQSYLHQHVTSKQAEATKMLEFLKNEEPRLKSDLERAEAELTQYQR
TSGSINASDEAKVYLEGSVQYEQQIAAQRLQLAALAQRYTDEHPLVVAAKQQLGQLEAERAKYDGKFRGLPATEVKAVAL
QRNAKVAEDIYVLLLNRVQELSVQKAGTGGSIRLVDAALRPGVPVKPKKVLILSAATLLGLILGTSVVFLRRNLFHGIED
PDRVERVFNLPLYGLVPMSAEQTRFDAADKGNRVRPILACARPKDLSVESLRSLRTAMQFALMDARNRVIVLTGPTPGIG
KSFLAINLAALVAHSGKRVLLIDADMRRGTLDRHFGTGGRSGLSELLSDQVALEEAIRETSVPGLSFIPSGARPPNPSEL
LMSPRLSQYLDGLAKRYDMVIVDSPPILAVTDATIFGELAGSTFLVLRSGMHTEGEIGDAIKRLRTAGVQLQGGIFNGVP
ARTRGYGRGYAAVHEYLNA
>gnl|bykdb|A0A0D5LDC4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia sp. 2002721687] (length=746 residues).
MNQNPPYLSEVEPQDDEINLVRYLDVLLSNLWLIAAITAVVTALGIAYALMARPIYQADILVQVEDSPNNAKSLLSDVSN
LFDVKTEAGAEIEILRSRMVVGKAVDNLNLYLEATPRYFPLFGRWLAARNKSLSEPGFLGFGGYVWGSEAIRVASFEVPQ
ELEGQAFKLTALGADRFRIEQPSLDKPIEGRAGEALSVAQSVGTIKLDVAELKAKPGAGFVLVRHSRLKTLESLQGRLNI
AERGKQSGIISASLEGADPKLTAAVLNEIGEQYVAQNVKRKAAEAEKSLTFLDDLLPRLKYELDQAESRYNAVRNRRGTF
DLGEEAKVYLEESVATQAKLLELKQKRAELLTRFTSAHPGVAAVDQQIAALESRIAAVSGRIKNLPDLEQDTLRVMRDVK
VDNELYVNLLNNMQQLRLVKAGKVGNVRLVDSAPVPEEPVKPKRAMVVALAAFLGAVLGVVAAFVRSALFGGITDPQDIE
QHTGLSVYATVPLSRAQATLAENIRARKPGTHLLASRYPNERSIESLRSLRTALQFAMVDAGNNRVLLTGPTPGVGKSFI
SANLAALVASADKRVLLVDADMRKGHLNGYLGKGREPGLADALTGSIALDKVIQREVFPGLDLIAAGTLPPNPAELLLSE
RAGQLLDSLSERYDLMLIDTPPVLAVSDTAIIAARCGVVFLVTRFGETTIGEVAESARQLRHANVNVNGVIFNALDPNGF
RYGYGYKYGRYRYASYGYAAQVGDKG
>gnl|bykdb|A0A0D5LI61 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia sp. 2002721687] (length=746 residues).
MNPNPTGASTPADSEGDTDFIAVLDILIEGRWLIASIALGCFIVGVAYAVLSKPVYQADILIQVEDSPDTSAAKSLLGDV
SSLFDVKSSAAAETQILASRLVVSRAVDNLKLFIDAKPKRFPVIGNWLARRSDGLSNPGFAGFGGYAWGQERIDVATFDV
PRPMEGDTFELTMLDARRYRLDGGDLDRSAEGVVGRLERIPAKGGAIALRVDAIDARPGATFVLVRNSRLRTIEDLQDNL
DVQERVKQSDVVVASLRDTDPDLVSSALNEIGRQYVAQNIQRKSAEAAQSLEFLNGQLPALKQQLTDSESRLTKLRDEHG
TVDLTEEAKLVLAQSADAKTRLLELQQKRQELLSRFTPKHPGVIAIDQQIAALDGYRGTAEQQIKRLPDLQQQLVRLMLD
VKVNTDLYTALLNNTQQLQLVRAGKVGNVRLVDTAAVPEVPVRPKKALVALASLLLGVLAGCGTAVGRSMLFHGISDPNE
IERRLGLNVYATVPRSDEQRALTERAKRKERALSLLSVAHPDEPAVESLRSLRTALQFAMLDAKNNVVVIAGPAPGVGKS
FVSANLAAVLTMAGKRVLLIDGDIRKGHLNDYLGFARGKGFSELIAGSAHPDGVLHRDVIDGLDFISTGTMPKNPAELLL
NARVPELIDAFSKRYDVVVIDSPPVLAVADTGILAATAGTAFLVALAGSTKLGEISESAKRLAQNGVRLSGIVFNGINPR
LGQYGYGSKYGGYRYVAYEYGAKRDA
>gnl|bykdb|A0A0D5VB93 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Paraburkholderia fungorum] (length=744 residues).
MAINFENRYIDVSGPDELHLSDYLRTIVRGWRTILVATLVALALGCAYAFLAPPTYRADVLFHVEDKTANANANGKDSLP
PLTGMFDTKPSTAAEIELLKSRLVTEETVKKLHLDISAAPRTLPFIGGMIAGLVNGQWGFKLPSFINLSGYAWGNESIAV
SQFDTTSELYDTTFTLIAGEGGSYVLRDKNGIAILSGHVGETVQTDTADGPITLHVDKLVGAPGSRFELQRFSTLGTVDR
LQKALVIQETTLQSGVIRTSLEGGDPVLTAAIVNSMAREFVRQDVESRSTEAEHMLAFLDQQLPGLRKELDDAEQRYNKF
RNQHGTVDLGEESRLLLQQVVDNKTKLLDLQQQRAEMSQRFTANHPAVAALDAQIAALQNAAASMNRSVAVMPDTEQTAL
RLLRDVHVDTELYTNLLNSAQQLRVAKAGQVGNVRVVDFAETPDEPVRPKRVLAILISLGGGLLIGIMLTFFKRAMYGGV
ERPDELEAVLGVPVFAIVPRSQTQLRLQENVMLRRRGLHVLAQQAPEDIAVEGVRNLRTSLQLSLDHAENNVVMITGSRP
DAGKSFLSVNLAALVASANKRVLIIDGDMRRGDVHSHFGIGHQPGLSDVLSGGDLGAMIQRDVLPGLDVLAKGTLPSHPS
ELLMSKRFETMLEELKSHYDIVIVDTPPVLAVTDSTLIGKYAGTTLLVVRHGRHPLNEIAETAKRLFNGGVSLKGVLLTD
VPQEGAFLGSGYQGGYYGYDSIAG
>gnl|bykdb|A0A0D5WVT8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella michiganensis] (length=722 residues).
MTEKVRRSSAPTEGNDEIDIGRLFGTVLEARWWVIGITGLFALLAAVYALFATPVYKADALVQIEQNAGNTLVNDISSAL
SNKPPASAAEIQLIQSRMVLGKTVDDLNLDISVTKNTFWLFGAGWDRLQGHQNDTVNVTTFTLPAAMNKDTFTVEVLNNK
QYQLTSDNGFSAKGEVDKLLSKSGVTLQVDGIQAQPGDSFTVVKYSTLGMINQLLGNLTVTENGKDTGVLSLSYTGEDKD
QIRAILDSITRNYLAQNVQRKSEEAAKSLKFLAEQLPEVRRNLDTAENKLNAYRQRQDSVDLSLEAKSLLDSVVNIDAQL
NQLTFKEAEISKLYTKAHPSYRTLLEQRKTLEDQKARLTNSIAAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITE
ASTVGDVRIVDPAITQPGMVKPQRLLVILGSIILGLIVSVIGVLLRSLFNGGIESPTVLEEAGLSVYASIPLSEWQKTRD
QANLRNAKGTKRFKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQASNNVLMLTGVSPSIGKTFVCANLAAVISQTNKRV
LLMDCDMRKGYTHELLGTTNVNGLSDVLSGQGDITRCAQKTSVPNFDLIPRGQVPANPSELLMNERFSQLVKWASENYDL
VLIDTPPILAVTDAAIVGRHAGTTLMVARYAVNTLKEVETSLSRFEQNGIAVRGVILNSIFRRATGYQDYGYYEYEYKSD
AK
>gnl|bykdb|A0A0D5YNM0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter baumannii] (length=728 residues).
MNQQNTNTEDTIDLKELFFSLIAQWKLIALCVILSVVCALLYLRVTPDTYSVDALVQVEDSKGASAALLGDLSDMIEQKS
PAQAEIEILKSRLVLGSVIKDLHLNIQVSSTENTLTHRLLSDTDYKTEYTKNSVIFKDGLKSFEIRQFEIPAYYLDKTLQ
LNFNKQSLRLTDPATEQTLLTVPLNQLNQVTGPQGIWKVSIFTKDKLDTTYNITSLSLPAAVDTIGSNYSVAERGKLTGV
LGLNYQGQDKEHITKVLNAILATYSAQNIERRSAESAQTLKFLDEQLPDLKKQLDDAERQFNKFRQQYNTVDVTKESELY
LTQSITLETKKAELEQKQAEMAAKYTAEHPAMREINGQLSAINKQIGELNSTLKQLPDVQRQYLQLYREVEVKTQLYTAL
LNSYQQLRIAKAGEIGNVRIVDTAVEPVEPIKPKKLQILILSIFLGGFIGTLIALLRNMLRTGIKDSGQIENELDLPVYA
TVPRSPIQESRVKILKKKKSIPILAVKNSDDIAIESLRSIRTAIYFALANAKNNIIMIAGPSPEVGKSFISTNLATIFAQ
GDKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQADLQKVLHKTQVTNLDVITRGKSPTNPSEILSSNQFKELLEQLQ
SQYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSQIKELELTLNRFEQAGVKVNGFILNDIQRASAGYGYGYNYAY
AYKAQKED
>gnl|bykdb|A0A0D6EAL6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Halomonas sp. R57-5] (length=750 residues).
MTNFPSPPSSPSPQESDDLNLRKLVDTLSDHRWFIVSVTGFFLLAGYFNASSQPRIYQADALVQIETRGSNLAFMESLGE
PQQGNPTSAELEILQSRMVLGETADRLDLAIQVEPRRLPLVGDFLVHHGVNQEWFESLTPNFILQWLADSEDDWNNPYVW
AGESLRVARFDVPEENVGSEHVLRLIEGGEFELLLDEQTLLTGSVGETAQNDELGYRLFVSQAEAHPGAEFTLVRTSALS
AIGELKNRFEIIPRGLESGVYELTLNGSDQSQIQPTLDTLTSVFLTQNVQRHSEEAENQIAFLDEQIPQVSNQLSDAEGM
LNDYRAQRDSVDLTFETQNLLTRVVDVENQLSELAMREADLAERYRPSHPNYQTLLRQRGQLEAERDRLNTLVNELPETQ
QEVLRLTRDTQVNQQVYVQLLNQLQEMRLVKAGTVGNVRILDAAMLSPGTIAPRIALITAVSGLIGALLAMLVLVVRILL
SRAIKTPEQLEELGLPVYATLPNSGEQAGLTERIRPRRSKKAQEVFRGLLAIKKPAEIAVEALRGLRTSLYFAMLESDNN
RLMITGASPGVGKSFIAANLAAVCAQAGQKVLLIDADMRRGHLHHAFHGKGVKGLSELLARRISLEEAIRHSDLDGLDYV
ARGSVPPNPSELLMQQSFHEFLDTISKSYDLVIVDTPPILAVTDASVVGKLVGTSLMVVRFDTNPPGEIKAAKRRLESAG
VRLKGGILNGVKKPTSSRHGYYGSYLYAYR
>gnl|bykdb|A0A0D6FFV2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Salmonella typhimurium] (length=719 residues).
MTEKAKQSAAVTGSDEIDIGRLVGTVIEARWWVLGTTAIFALCAVIYTFFATPIYSADALVQIEQNAGNSLVQDINSALA
NKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVTKNTFPLFGAGWERLMGRHNEMVKVTTFTRPETMSGQIFTLKVLGDKR
YQLVSDGGFSAQGVVGQPLNKDGVTMRVEAIDARPDTEFTVSKFSTLGMINNLQNNLTVTETGKDTGVLSLTFTGEDRDQ
IREILNSITRNYLQQDIARKSEEAGKSLAFLAKQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQLN
ELTFKEAEISKLFTKAHPAYRTLLEKRKALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITEA
STVGDVRIVDPAITQPGVLKPKKALIILGSIILGLMLSIVGVLLRSLFNRGIESPQALEEHGISVYASIPLSEWQKARDS
VKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMLTGVSPSIGKTFVCANLAAVISQTHKRVLLI
DCDMRKGYTHELLGTNNVDGLSDILAGKGEIASCAKPTAIANFDLIPRGQVPPNPSELLMSERFGELIAWASSRYDLVLI
DTPPILAVTDAAIVGRHAGTTLMVARYAVNTLKEVETSLSRFDQNGIQVKGVILNSIFRRATGYQDYGYYEYEYQSDSK
>gnl|bykdb|A0A0D6I9V6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Alcaligenes xylosoxydans xylosoxydans] (length=753 residues).
MSLPIESFEPSVPARQQETPLSSHVDAIFSNRWLIIAITLIALLGAVTYVMVTPSVYSADIIVQVEEEMPQGQSRSLLGD
VSAIFDTKAETSGEMEVLRSRMVVGPAVDKFMLYIHAKPRYFPVVGEWLARRYESLPYPSGLPRGGYAWGGETIQVSQLD
VPNEWLGKPFRITTLGEGAYTLSDKITGATFKGTVGKPEHFLLPGGGALDVHIDALSGRPGTEFTVSRTSRLAAIEDVQS
RLGIFERGRTSGVIGVTLEGNDPALTTAVLNQIGQEYVQQNVNRKSAQAEKSLAFLDEQLPQLKRELDAAETKYNSLRNK
RGTIDLSEEAKLILAQSVDAQTKVMELRARRQDMITRFAPTHPSIIAIDRQIASLTGDVNRIGNNIKQLPDLEQDVVRLV
RDVRVNTELYTGLLNNAQQLRLIRAGKVGNVRILDAAVQPDKPVRPKAAIIIAVATAIGLIFGLLCAFVRNALFGGLSEP
DDVERYTGLPVLAAIPHSDLQDKLWRRSRRKNATVPALLAQSQSTAPPIESLRSFRNVLQASLQQSTNNMVMFTGPVAGV
GKSFLSANFAFIQGGVGKRVLLIDADFRKGQLNRYFGVPKEDGLFEVLSGTLPLERVRKHSVSEGVDFIATGAVSFDPSE
LLASPIFGQTLRELASQYDMVILDTAPVLSSPDAAVVGTHAAAVMVVVRSGMNTVGEIRETAKRLIQAGAPVDGVLFNGL
KLMPERFGFRSKYGGYRYSRAAYYGDFKQNGPK
>gnl|bykdb|A0A0D6MUV2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acetobacter aceti NBRC 14818] (length=732 residues).
MSVVQSNLLDRISEPPPDASHVSPLKIFEIIRERWLTILLVAGFLVVPAIALILTLPAYYDATSSLMIGTRQAEFRDLQA
TQGALDVDAVAINTEVGIFKSQSIAKAVAERLKLVDDPYFRAQMEKKSFKTRITGWISKVTGHADPEKPLTPDEKLQVVR
DLLGRNVTILNDGRSYLITVSVRTGRPDLSANIANAFSDVYLDFKRHMKIASTWRSNSLLDEQIIPLRERLRKAEQAVEQ
YREKNGLISAEITHSGSPNAPAGVTVTDQQLVETNRALVAAQADLTAKRARANQMMGNTASTTDVLSSPIIQQLQAQEAM
LNARVASLASTAGDANPELQAARAAAAHVRAQIGQVTSQITTSTDKDLRSAERRVAALTDEVTKLQEHVGRENEANVTLQ
QLESEAAAARAVYQDFLGRYAQTSSAAALQEPEAELISRADQPLGVSGPPRTQFMAIAILFSALAGVGVAIAQERMQKGV
KEGTEIDAVPGLFTLGMVPSFSHSLSELYRSSQPSIYIESIEAIRTILSFGRSRFRAKTITVTSSGPEEGKTVFALSLAA
NTGRAGKKALILDCDTRGPSALEIVQASGKGKGERHLVTSLDKRGLSRDVLPGVDVMTMNNWKSPSDQMIVPEVLQVVLA
ELSPHYDLIILDTPPLLAFPDAAVLSHETDGVVLVVKWGVTTQENLKGAMRQLEAYDARTLGAVLTQVPAGSASGLSGAA
LQVYRHYGLLAS
>gnl|bykdb|A0A0D6PW04 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Komagataeibacter europaeus NBRC 3261] (length=724 residues).
MSWTALDVGLVIRQTMRAFLRHRMLFALTALGVLVAGGAVMLTLKPRYTATTTVVVSGRAQQDPLAPNGQQQNLAPPDDE
LVSTEAAMIHSRDVAAAVLAQLPPPPVPPHVGMRDRLCHMGLGFLCHASTPVDPEVQREHEEDAFLNNLTITPEPRTQIL
DINVVDGNPQRAAALANAVVTNYQRIALARQTADINHVATWLDNRTAALRQRWLDAVEKANAFDNANGLTNTTEGSTSTP
LIERQIADTSANLSQAEGRLAAAQARADALRDAAARGDARAAVALSQEPILVATANALMQLQSTRQEEAATYGPQHPRLR
ALDQQIAATRASLEAETQAALSTIREDQISARAEVQRLNENLELLRQKAGGQSAPQAEYRTLDQEAQSARAVYETFLEHA
KEVVDRAALLQPPIAVVSHASAPDMPSFPNRKKIGLGLMAVALAAGAGAVLLRDYFAAGFTEIERLRAAVPLPLLAVVPK
VGGRSEQTVRRHVIDHPYSRATEAVRSLVMQLSMRVHEGGQPLCLAITSAGPEEGKSTLALWMATVARRGGQKVLVIDAD
HRRGMLDQYLTDGTTGRPSLGMSDLVTTGVPVADVIRTDPDTGFDYIPAGRTMQHAFSPVEIRRLRAILAELKRSYELVI
IDCPPLLGLSDALVHANMADQVIFVCRWKSTAQRAVMACLERLEACGAPLAGVVATMVEDNAMDVMGYSYGNRDIKILSR
FDDK
>gnl|bykdb|A0A0D6Q7Y9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Komagataeibacter xylinus NBRC 13693] (length=724 residues).
MSWTAHDVGLVIRQTVRAFLRHRVLFTLTALGVVVVGGAVMLTLKPRYTATTTVLVSGRAQQDPLAPNGQQQNLAPPDDE
LVSTEAAMIHSRDVAAAVMAQLPPPAAPPHVGLRDRLCHMGLGFLCHASTPVDPQVQREHEEDAFLNNLTVTPEPRTQIL
DINVVDGNPERAAALANAVVTNYQRIALARQTADINRVATWLDNRTAALRQRWLDAVQKANTFDNVHGLTNTSEGSTSTP
LIERQIADTSANLSQAEGRLAAAQARADALQDAAARGDARAAVALSQEPILVATANALMQLQSTRQEEAATYGPQHPRLR
ALDQQIATTRASLEAETQAALSTIREDQISARAEVQRLNENLDLLRQKAGGQSAPQAEYRTLDQEAQSARAVYETFLEHA
KEVVDRAALLQPPISVVSHASPPDVPSFPNRKKIGLGLIAVALAAGAGAVLLRDYFAAGFTEIERLRAAVPLPLLAVVPK
VRGRTEQAVRRHVIDHPYSRATEAVRSLVMQLSMRVHEGGQPLCLAITSAGPEEGKSTLALWMATIARRGGQKVLVIDAD
HRRGMLDQYLADGTTGRPSLGMSDLVTSGVPVADVIRTDPDTGFDYIPAGRTMQHAFSPVEIRRLRTILTELKRSYELVI
IDCPPLLGLSDALVHANMADQVIFVCRWKSTAQRAVMACLERLEACGAPLAGVVATMVEDNAMDVMGYSYGNRDIKILSR
FDDK
>gnl|bykdb|A0A0D7E0V0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas stutzeri] (length=736 residues).
MTALTRSSLEYDADNRIDLAGIMRTAYDHKALIVTITGFFAALGVLYALIATPIYQATAMIQIEPKKAAITGVPEISARP
DSVSQAVTEISLLKSRAVLGRAVEELKLYIVAKPHHFPVFGAFMARKHDPATDGALATPLFGLTGYAWGGEKLEVFQLDV
PEAYLGVELTLIAGTAGSFTLHDDEQQLILRGQVNEAVENQGFKVQIAQLEARPGTEFQLVRNRPQTTALDYQNRLKVGE
AGKDSGIIYMSLEDPDPQLASHVLDEISRLYVSQNIQRSSAEAAQRLDFLRSQLPQVRKELEKAEAALNAYQTSSKSVDI
SIETKGVLDQIVALETQISELSLKRVEYDRLYTREHPTYRTLITQMNELQTQKAQLLKKVDALPMTQQELLRLQRDMEVT
TQTYTLLMNQAQEQDILRAGTIGNVRIIDNAYSMIEKPSKPVKPLVVAIAIFVGLLVSAAVILLRQAFYRGVESPDVIEK
LGVPVYAGLPYSASQDQLNRSRKSRDGKTRLLSLTEPTDLAVESLRSLRTSLKFAMLEARNKVLMITSPTPSVGKSFVSS
NLAAVIAQTGQRVLLIDADMRRGYLHTLFGMAPRHGLSDALASGLNLAEITNRTEQKNLHFISAGFSAPNPSELLMHDNF
SRLLREAEKLYDFIIIDTPPVLAVTDAVLVAQQSGTNLLVARFGLSTSSQIDASKRRLAQNGVLLKGVILNAVKRKASTS
PYDSGAYGYYTYTQQA
>gnl|bykdb|A0A0D7EBG8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas stutzeri] (length=738 residues).
MTTMPRPIYETKEDKDIDLAHLFDTFINNRLLILGITGFFAALGIAYALLATPVYLASAMIQIEPKNGLPSLTDVVNTNP
PVSPAQTEIALLKSRSVVGGAVASLNLDIQITPHHFPIIGGFMARRFEPSEEGELGWHPAGLGAYAWGGETLKVTQLEVP
DKVHGKELTLEAAENNGFILRDKDDEVVVQGVVGEPVETEDYRVTVAELNARPGTTFTVVKNRTYNTTESYQQRLSAAER
GKQSGIVNVTLEDPNPEHAIRVLEEVASRYVDQNVARNAAEATQSLEFLNEQVPAVRKKLEAAQTALNKYQTGSGSVDIT
AETQSVLDRIVDLEKQISEQNLKRTEMERRFTRQHPNFQALMNQINQLQMQKEELEKQIGTLPSTQQELLRLTRDVEVSS
ETYSMLLNKTQELDIIRAGTVGNVRIIDHAAADLENPVKPNKPLVVIVATLLGALLATAFVYVREALKRGVENPEDIERT
GTPVYASIPFTDKQAALEKRLANFKRDKSTASYLLTINDPADLATEAMRSLRTSLHFAMIEAKNNVLMITGPSPAVGKSF
VTTNLAAVVAQSGKRVLLIDADMRKGYLHKVMRCDGDKGLSDILSGRITLFDAIQKTQLNNLHVITHGQLPPNPSELLMH
ENFSRFVKEISHMYDLVIFDTPPILAVTDAALVGSQAGTTLMVTRYALNGVKEIEAAKRRLEQNGLIVKGVIFNAVVRKA
STYGEYGYYQYEYASTSK
>gnl|bykdb|A0A0D7HAJ3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQNSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDDK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHARPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A0D7LL97 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Citrobacter freundii] (length=720 residues).
MTEKVKQSAAPVTGNDEIDIGRLVATVVEARWWVLGITAAFALCAAVYTLFATPIYSADALVQIEQNTGNSLVQDIGSAL
SNKPPASEAEIQLIQSRLVLGKTVDDLNLDIGVTKDTFPIFGAGWDRLMGRQNETVNVTTFTLPKAMNEQTFTLNVLNDK
SYQLVSDGGFSVRGQVGKVLEHDGVTMLVEAIHASPESQFTVSKFSTLGMINTLQNNLMVTETGKDTGVLSLTFTGEDRE
QIRQILDSITRNYLQQNVERKSEEAAKSLAFLARQLPEVRNHLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLFTKAHPAYRTLLEKRQALEDEKSKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITE
ASTVGDVRIVDPAIAQPGVLKPKTALIILGSIILGLMLSVVGVLLRSLFNRGIESPQALEEHGISVYASIPLSEWQKARD
NVQTIKGVKRYKQSQLLAVGNPTDLAIEAVRSLRTSLHFAMMQARNNVLMLTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGKGDISSSAKPTSIPHFDLIPRGQIPPNPSELLMSERFGELIAWASSHYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLGRFEQNGIQVKGVILNSIFRRSSGYQDYGYYEYEYTSDSK
>gnl|bykdb|A0A0D7LWA5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Citrobacter freundii] (length=720 residues).
MTEKVKQSAAPVTGNDEIDIGRLVATVVEARWWVLGITAAFALCAAVYTLFATPIYSADALVQIEQNTGNSLVQDIGSAL
SNKPPASEAEIQLIQSRLVLGKTVDDLNLDIGVTKDTFPIFGAGWDRLMGRQNETVNVTTFTLPKAMNEQTFTLNVLNDK
SYQLVSDGGFSVRGQVGKVLEHDGVTMLVEAIHASPESQFTVSKFSTLGMINTLQNNLMVAETGKDTGVLSLTFTGEDRE
QIRQILDSITRNYLQQNVERKSEEAAKSLAFLARQLPEVRNHLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLFTKAHPAYRTLLEKRQALEDEKSKLSGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITE
ASTVGDVRIVDPAIAQPGVLKPKTALIILGSIILGLMLSVVGVLLRSLFNRGIESPQALEEHGISVYASIPLSEWQKARD
NVQTIKGVKRYKQSQLLAVGNPTDLAIEAVRSLRTSLHFAMMQARNNVLMLTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGKGDISSSAKPTSIPHFDLIPRGQIPPNPSELLMSERFGELIAWASSHYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLGRFEQNGIQVKGVILNSIFRRASGYQDYGYYEYEYTSDSK
>gnl|bykdb|A0A0D7NEE8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Bradyrhizobium sp. LTSP849] (length=798 residues).
MLHSRLPSVNVEAPEPELLSISDAILALKGLVSRQLPLMIFVFLACVSLALLYVITAQRMYTSTASLIIDSRKISLMQQQ
QSAGSDAPIESAMIDSQVEIIKSDTIALSVIKDLRLVDEPEFTGDSGGLIGNVVGAVFSLISSPTPPSEYQQLRKALSRF
AKNLTVKRVGLSYVIEISYRSNSADRAAQISNAVAEAYIVDSLEAKYNASRRAAVWLQDRMKELRVQASAAERGVADYKA
KNNIVDAGGRLLSEQQLAEINSALTVARAQRAEAQARLERITTILKADDEDRNVILNDLATVADTMQNPVIVKLRQTYLD
YAAKESDWSNRYGANHLAVINLRNQMREIRRSIKDELKRTAESFKSDLEIAKSREEASQKSLSDAINQSNDTSQAQIVLR
DLESNAQSARALSDNFLQMYMVSVQQQSFPITEARVITPAAMSLSPSSPKTLLVLLGSLLVGGLFAAASGFVRDMMDRVF
RTAPQVEAMLGVSCLAVVPRVLPDELPQSGWSKARTVAKLARISGWRHLRGKNEPEQQVVASIGSEYPAGAQLPSRQMNI
TDTMSGVVTRAPFSRFAEAMRAVKMAIDLSRDEATCKVIGITSSLPNEGKSTIAGAIAQASSMSGTRTLLVDCDIRNPSL
TRRFSPDAQAGIVELVLGQAELKDLIWTDSQSALHFLPCVLASRSSNSADLLASAPMERLFKALRSHYDLIIVDMSPLAP
VIDVRGTSRIVDHYTLVVEWAQTKIDIVKRSLDEAPGVQKKLMGVVLNKVDIGALGRYDSHRGDYYRNRYYHRYGYVD
>gnl|bykdb|A0A0D7NT04 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Bradyrhizobium sp. LTSP849] (length=777 residues).
MLQTPSLQTDRTRLPLTMQMQSGQQDGADIGALIKSALVFLRRQYLMILVTAALASATSMLYLRLVPPTYTAQVQILLGN
PRAQFLQQQSLLSEPLVDVAQIETQLQIIKSRATAVAVIKQLALADHPDFKEASSSLSSLQRWIQKWRSNPPEGGQSTKP
NQLSENTIAAFLDRLSAGRVSYSHVIEVNFSSSDPQLAADIANAVANVYISDQLSAKFEATRTATGWLQERLRSLGDEAL
TAERAVNAYRSQNNMVSAGGKPIDEQQINDLNARLVAARAQASDAQVKLKRYESILQSNSTNSSAADLPEALGADVLQSQ
IINGLRQQYLDFSRREAEWSTRYGHDHLAVVNLRNRVRDTRTSILEEVRRLAESSRNEFEAAQQRLQEQEKQLAQAVSQS
RVTNSAELTIRELESRAKSLRALYETFLQHYMGSAQQETFPISETRVIFPASAAQTRSKPKTKVVLAFGLLGGLALGILL
AFVRDVMDRVFRTSSQLEAALELPCLSLVPLLLVPKTRRRTIRAQQTHEDLSQRTLSTVPEIHHAVVSMPLSRYTEAIRS
IKLAIDHSPAKASNQVIGVTSALPNEGKTTIAASLAQLIGHSGKKVIIVDCDLRNPSLSSSVAPKATAGIVEVANGSRPL
EEAIWHDPKTNLAFLPAVRRGTLLHTSEILSAESISKLFDRLRQNYDYIIVDLPPLTPLVDVRVTGSLVDCYVLVVEWGR
TKIDVIQHALHTAPMVSDALIGAILNKTDIRAMSRYDARRSDYYDDSHYIRYGFSDA
>gnl|bykdb|A0A0D7PKL6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Bradyrhizobium sp. LTSP885] (length=748 residues).
MLKVHKSTSEINQEFVEVDSSSSQSLSSYVNMVRRQFPTVLAVASACIILALLYLFTATPEYTSTASMVIDSRKIQLFQQ
QSALGDIALDSASVETQVEILKSENISLAVVRDLHLVDDPEFTGGGGGLLGAIVGSVARLFSSPTPQSEYQLTRRALARF
EGNRTIKRLGQTYVMEVGFTSRDPVKAGIVANAIADAYIVDQLEAKYQSTRRASVWLQDRIKELRTQASTAQRAVVDFKT
ANKIVDTGGRLMNEQQLAEVNSQLVLTHAGTAEAKARLDRMNDIVRQEIPDASVADALKNETIVKLRGQYVDMAAKEAIW
SARYGRDHMAAVNLRTQMTEIKKNIVDELKRIQESYKSDYDIAVTREESIKTSLNTVVSESQLTNQAQVQLREFESNAQS
YQAMYDNFLQKYMESVQQQSFPITEARVISAASTPLVKTYPKSFVVLAASLLGGILLGLGAAVARELTDNVFRTTSQVQE
KLGANCLAILPAILPEGQQRTILGARRTDKNVPLLQYVVEHPLSRFSEAIRSLKVSLDLNSIVRENRVLAVTSALPNEGK
STVSTNLAQLMAHGGARVVLVDADLRNPSLSRALAPDAEVGLLDVIAQKLQLEDVLKIDAQTGLAVLPVVATSKLLHTNE
ILASKRMHDLIATLRSKFDYVVLDLPPMAPVVDVRVTSTFVDTYILVVEWGKTKMDVVMHNLRNSPEIQDKMLGVILNKA
DTNLLSRYESHQGRYYYQKYYSRYGYLE
>gnl|bykdb|A0A0D7QNC0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Bradyrhizobium sp. LTSPM299] (length=805 residues).
MLQTRITPPREIESPKQQSASLEQTISTAITLIGRQYPVMIFVMCICIGLAGVYLLTAPKQYTGTAVLLIDSRKMQGLQT
QAPTGGDSPIDSAMVDSQVEVLKSETIATSVIKELHLLDSPEFTGKEGGMLGSISNLFSWIFPESPPSEAALTRTAIGKL
AGNLTIKRVGLSYVIEISYQSRSPDQAARVANAVADGYIVDSLESKYQASRRAAVWLQDRLKELRTQASTAERAVADFKA
KNNIVDAGGRLLTEQQLAEINSSLTQARGQRAEAQAKLERITSILNADDNDAKVILNDLATVTDTMNNPVITKLRQTYLD
YAAREADWSNRYGPTHLAVVNLRNQMREIRHSITEELRRTAEVYKSDLAIAKAREESSQKSLNDTIALSNGTSQAQIVLR
DLDSNAQSARALSDNFLQLYMVSVQQQSFPITESRVITQASNAPNKTSPKTMLILLATLIGGTILAGLVAVLLDMMDRVF
RTVSQVEQLLHTSCLASIPAIGSEQSVGVAGHSLMSRAARRFNRRPKRPQPLAAKPAPSVATAGLPLRKSELGSNHPQPH
RDRLLKANDSVGRYVINAPFSRFSEGFRSIKLATDLSSYGSSNKVIGITSGLPNEGKSTISEALAQTVAQAGSRTLLIDG
DIRNPSLTARLAPSAQVGLIDVVVGRVDWKDAVWIDPQTNLHFLPCVVTSRFSNSSDVLASPQMERLFQHLREHYDRIVL
DLSPLAPVIDVRATGALADSYVLVIEWAKAKVDIVERVLNETPIVRERLLGAVLNKVNMAVMSRYDIYSASYYRNRYYKR
YGYVD
>gnl|bykdb|A0A0D8DWD1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia sp. USM B20] (length=741 residues).
MVNTQAKHSYADLTAKTEEEDVVLGQLLQVLMDDIWLLLGIAVTVIAMAGLYCYIAKPVYQADVHVRVEGNDNTSQALTQ
TQTGAMINSGPQQAPTEAEIEIIKSRGVVAPVVEQFKLNFSVAPKTLPVLGSLAARVATPGEPARAWFGLRSYAWGGEVA
DIDTINVVPALEGKKLTLTAGPNGTYTLVDQNGNRLLSGRVGESEQAGGVTLLVQKLVARPGTQFTVVRYNDLDAITGFQ
SGIQVSEQGKQTGVVQISLEGKDPDQTAAIANALAQSYLNQHVIAKQAEATKMLDFLKGEEPRLKSDLERAEAALTQYQR
TSGSINASDEAKVYLEGSVQYEQQIAAQRLQLASLAQRFTDSHPMVIAAKQQLAELQGEKDKFSNRFRSLPATEVKAVQL
QRDAKVAEDIYVLLLNRVQELSVQKAGTGGNIHLVDSALRPGDPVKPKKVLILSAAVFLGLILGTGIVFLRRNLFQGIED
PDRVERTFNLPLYGLVPQSAEQVKLDAMAEKGGGRARPILASLRPKDLSVESMRSLRTAMQFAMMDAKNRVVVLTGPTPG
IGKSFLTVNLAVLLAHSGKRVLLVDADMRRGMLDRYFGLTAQPGLSELLSDQSSLEDAIRETPVQGLSFISAGTRPPNPS
ELLMSARLPQYLEGLGKRYDVVLIDSPPVLAVTDATIIGRMAGATFLVLRSGMHTEGEIADAIKRLRTAGVDLEGGIFNG
VPPKARGYGRGYAAVHEYLSA
>gnl|bykdb|A0A0D8DXK0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia sp. USM B20] (length=746 residues).
MKMDNISTPVQQRFTEEDGQLDLGHMLDVMYDYRWMMGGVILVIFLIGAIYAFTATPVYRADILVQVEENPNSTRSLLSD
VSTLFDIKSQASTEIEIIKSRLVVGKAVNNLRLDIDAEPLRFPFLGEWISRFNSTISKPGLFGFGGFVWGRESIKVSKFD
VPPSLYGREFQLELANGGHYSLIDKEHNLAYRGEIGHRLVATSPFGEINLLVDYVHGAPGARFTLIQRSPVGTVAALQGK
LQIAEKGKESDVIGVALEGERPAHIADILTEIAKEYINQNIERKSEEAQKSLKFLDKQLPELKSRLEAAEQRFNSFRVKN
NTVDLSGEAASTLQNSVTLQSALLQLVQQRDELVTKFTPNYPSVKAIDAQIARYKNAIAENEARTRALPPLEQQVVRLQR
DVLVNTSLYTNLLNNYQQLQLIKAGKIGNVRLVDSATTSDVPVKPRRAVIIGVSVILGLIVAVATAFLRRAIFGGLESAN
DIENRINLPVYATVPVSENQRTLVRSRQRDGQSGILADIKSTDPAIESLRSFRTALQFTLAEAKSNILQITGATPNMGKS
FISLNLAAVLADSGCRVLLIDADLRKGALHTALGQQRENGLSEIIVQGRTLEDVVRRDVRSNLDFVATGEIVPNPAEVIS
SKKFAHFLESMTGRYDIVLVDSPPILPVAETSTIAMLAGLTFLVARRGVSTIGELDEAKKRLTQVGVNPKGIIFNCVVPR
PGRYGYSDGRYRYSYYTYAGYLNEKA
>gnl|bykdb|A0A0D8E8W0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia sp. USM B20] (length=757 residues).
MTSSTLPDPHSGPALRPSYPVRRYWGMLYGGRRLILGTALAGALVGAVYALCAAPVYRTDILFQVEQSPTDSKSTSPTGD
PSSVFDLKTDASTEIEVLKSRAVLDRAIDSTNLAVDARPHYLPLIGWRFVNAADGLSSPLPGGYVYGTERIDVPTFDVPK
RLLGKRFALTVGDDGAYTLQRTGWFGRKGPAWQGRIGQPLHVETPQGPLDIFVRGVAGKPGARFDLTRYSDEEATAWLQK
NALISERGKQSNMVGVTLDGTDPVHDSRVLNAIGDAYLAQNTQRKSEAADKLIRFMDAQLPQLKAQLEKAESRFNAFRAS
HGTVNTSDEALALRQQSVDIETRVQTLQQRREELLTRFMPKHPAVVAVDAQLSDAQRSLDTTRKQIQQLPTVEQGVLQLQ
RDVAVDTALYTNLLNTRQQMILARASKTGTVRIVDTAKVAEQPIGPHRGVAVIALLMVGLLAGAAIVIVRQRIVGTIGDA
EEIEWTTGLPVFATVPHSPGVAQAELGSKAGRRGARAPVPPVAVQDAALESLRNFRAALQLSMPHASNPVVLISGPTTGV
GKSFVAANIASLVGAAKRRVLLIDADLRKGSLHERFRYSRAPGLSDVVAGTHRLDEAIKRGIVPGLDFIAMGSVVPDPGE
LLLQPALAELIEQVASRYDMVVIDGPPLLPVADALVLGRLAGTVFLVARSGVTTLAELDESARRLEHAHIDVRGVVLNDY
KGAPGRYDYGYADTNTHQAASGYAEAMAPRQRVERAS
>gnl|bykdb|A0A0D8KJ79 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhizobium nepotum 39/7] (length=753 residues).
MTAADYDKSAFTGDLIDIETALATIRRQWRIVLAAIAVAGAIGLTYTVTAVPIYSATATLLIDRNNSQIVEQLSAIGGVV
EDEASILSQVEVLQSETIGLAVVDSLNLVENQEFGAKRASLLSSIFDTVRSIVNVSQWFSPEKEAVIDDKTLKRALSDRL
LENLSVTRIGRTYALELTYNSTSPTLAAQVVNAVASAYLVDKLNSKYEATKRASDWLSDRIAELRQRALDTDFAVQKFRT
EHNLISTGNNGLLSDQQLAESNSALILAQSETARAQARVQRIEYILVTDDVDAVVTDILDSSVANDLRKKYLESSKLEAG
ITSRLGSNHVQAVRLRNEMQEYRRLMFQEVRRIAQSYKSDLEVAEAREKSLRESVAKATDVTNSASQTQVQLRELQREAE
TYKNMYQTFLQRYQEAMQQQSFPVTEARVISKAMPPETPSKPNKPLVLALFMFLGAVAGGGIAAFREFRDRFFRTGEQVR
DVLGLEFLGNTPLIQNKPATDILPKGKEGDPTATRPSSIGRYAVDHPLSSFAETLRSTRLAIDLGIPAKSGARVVGVVSA
LPGEGKSTISINLAQLLAGQGARVLLLDADIRNPGATRALARHAGEGLLEVLLEGRNMQDVLLHDEKTRLVFLPTVVKQR
VPHSSELLTSAQMHKLLAEASGAFDYIIVDLPPLGPVVDARAMAGRIDGFVFVTEWGKTARKAVRNTIENEVHIRKKCLG
VILNKVDTEKLKLYRAYGSSEYYHSRYTRYYHD
>gnl|bykdb|A0A0D8KJF3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhizobium nepotum 39/7] (length=782 residues).
MHHKTFKSNIGFPDPGKDADTFIDLDRLWAAVVRRANVIAASVIAAVVLAGLYLVLATPVYTAMTQVLLDESLSRYAEEE
SPVPAAQIVDNRIASAVEILKSKEMALTVVDKAKLDENDTIVNPSMSPVDLVKSSVRGIVDLILPGDPPVSEAAIRAGRR
EKAAAVLQQSLIVERVGRSSVIAISTRSTDRQLAALIAKTYAHAYLTEQLNANFDASERASVWLQERMTDLNQRAQAAEL
AVQKFRSDNNIVSSRGELMSESQLADLNGQLIAAQADVATAAARYGQYKSIIDRGPDAAVDNAVVSARDADNSVIQDLRK
RYITISDRLQGVVQQFGADHPQAAALEGEKKEIARQIFQELQQVTGSLRNEYDVSNSRVQSLRDNIDRVAGRNSQANITM
VQLRELEQRATALRTLYQSYLGRFEEASQKQSLPIAKARIISEAGLPTAPSSPKKTMTMALSVILGLMLGGGIAALLEFR
DRFFHTGNDVRDNLRMRFLGYLPFIGERGVEPAKPGTSAATPVSENTTLDESGQVSFQKMLRLAVDSPRSSFAETLRNVK
LTADVVIQERQCRVIGVISCLPNEGKSVVALNLAGLIASTGKRTLVVDADIRNPGLSRMLTTRQSAGLVEVVLDETPWTQ
AVKVDTRTKMGILPVSTSNQFAHSSELLASSGMRKFIESAREACDYIIVDLAPVVPVIDAKAFAPQVDGFVFVTEWGKTP
IQMVQNLMANEPQIANKTLGIVLNKTDMTELQRYAGPGGSEHYHETFAAYYGDAKPAVKENA
>gnl|bykdb|A0A0D8KTI7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Agrobacterium arsenijevicii] (length=751 residues).
MADIDKSGFTADFIDIEAALATIRRQWRIVLAAVAIAGTIGLAFAATAVPIYSASATLLIDRNNSQVVEQLSTIGGVVED
EASILSQVEVLQSETIGLAVVDSLNLTENQEFRANRASLLSSIFGTIRSLVNVSQWFSPAKETVIDDGTLKRALSDRLLD
GLSVKRIGRTYALELTYNSTSPVLAAQIVNAVASAYLVDKLNSKYEATKRASDWLSDRIAELRQRALDTDLAVQKFRAEH
GLIETGNNGLLSDQQLAESNSALILAQSETARSRARVQRIEHILATDDVDAVVTDILDSSVANDLRKKYLESSKIETEIT
RRLGSNHVQAVRLRNEMQEYRRLMFQEVSRIAQSYKSDLEVSEAREKSLAESVAKATNVSNSASETQVQLRELQREAETY
KNMYQTFLQRYQEAMQQQSFPVTEARVISRAIPPKTPSKPNKPLLLALFMIMGAAAGGGIAMFREFRDRFFRTGEQVREV
LGLEFLGNTPLVQNKPGTDILPKGQEGPPTATRPSSVARYTVDHPLSSFAETLRSTRLAIDLGIPPKSGARVVGVVSALP
SEGKSTISINLAQLLAGQGARVLLLDADIRNPGATRALGRHATEGLLEVLLEGRNIRDVLLHDEKTQLSFLPTVVKQRVP
HSSELLTSAQMYKLLAEASGLFDYIIVDLPPLGPVVDARAMAGRIDGFVFVTEWGKTARRAVRNTIENEVQIRKKCLGVI
LNKVDTEKLKLYRAYGSSEYYHARYTRYYHD
>gnl|bykdb|A0A0D8KYY8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Agrobacterium arsenijevicii] (length=782 residues).
MHHKTFKSSIGFPDPGKDADTFIDLDRLWAAVVRRANVIAASVIAAVVLAGLYLVLATPVYTAMTQVLLDESLSRYAEEE
SPVPAAQIVDNRIASAVEILKSKEMALTVVDKAKLDENDTIVNPSMSPVDLVKSSVRGIVDLILPGDPPASDAAIRAGRR
EKAAAVLQQSLIVERVGRSSVIAISTRSTDRQLAALIAKTYAQAYLTEQLNANFDASERASVWLQERMSDLNQRAQAAQL
AVEKFKTDNNIVSSRGELMSEGQLADLNGQLIAAQADVATAAARYGQYKSIIDRGPDAAVDNAVVSARDADNSVIQDLRK
RYITISDRLQGVIQQFGADHPQAAALEGEKKEIARQIYQELQQVTGSLKNEYDVSNSRVQSLRDNIDRVAGRNSQANITM
VQLRELEQRATALRTLYQSYLGRFEEASQKQSLPIAKARIISEAGLPTAPSSPKKTMTMALSVILGLMLGGGIAALLEFR
DRFFHTGNDVRDNLRMRFLGYLPFIGERGAETAKSGTAAATPGSENTTIDESGQVSFQKMLRLAVDSPRSSFAETLRNVK
LTADVVIQERQCRVIGVISCLPNEGKSVVALNLAGLIASTGKRTLVVDADIRNPGLSRMLTTRQSAGLVEVVLDEIPWTQ
AVKVDTRTKMGILPVSTSNQFAHSSELLASSGMRKFIESAREACDYIIVDLAPVVPVIDAKAFAPQVDGFVFVTEWGKTP
IQMVQNLMANEPQIANKTLGIVLNKTDMTELQRYAGPGGSEHYHETFAAYYGDAKPPVKENA
>gnl|bykdb|A0A0D8W585 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQNSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDDK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHARPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGVKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A0D8WK50 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQSSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDDK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHASPGSEFTVTKYSTLGMINQLQNSLAVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEEEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A0D8ZZM4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas sp. ES3-33] (length=745 residues).
MPSQNSLPIQDHSDDDDDIDLLALFGTLIDSKWIIIGITAFFCAVGVAYALLSTPIYQANALVQVEEKKGGMAALGGMGE
MSEMFGGTSPAVTEIELLKSRAVLGKAVENLKLDILVEPNYFPLIGHFLSRHFKPESKSELASPLFGLNSYTWGGEKLDI
FQLEVPDSYLGKGLTLRAEGNNALTLLNDDDEVLLNGQAGEKLEQNGFKLQVSTIEANAGAVFGVTKQRRLNSILQYQED
VAAGERGKESGIISLSLENEDPAMANRVLDEISRLYVLQNVQRNSAEAAQSLEFLRTQLPDVRKQLEKAEGHLNAYQTSA
RSVDITIETKAVLDQIVALETLISELKLKQAEMEHRFTREHPAYQALMTQMGQLDQQKRGLEKKVKNLPETQQELLRLAR
DMQVTTEIYTQLLNKTQELDIIRAGTVGNVRIIDSADANIEKPVKPKKALIVLIATLLGGLLAVAYVLIRKAMNRGVEDP
EIIEQLGIPVYASIPLSKGQSLIEASLKAGARQSTGSLLLAVNNPADLAVESLRSLRTSLHFATLEAKNNILMISGPSPA
VGKSFVSCNLAAIVAQTGQKVLLVDADMRKGYLNKLFRMDVCNGLSDLLAGKIDLNTATHPTEVDNLYIITRGQIPPNPS
ELLMHSNFTQFLEKVSSEYDLVIIDTPPILAVTDAALVGRQAGTSLIVTRFGVNAAKEIQVTKRRFEQNGIVVKGAIFNA
VERKASAYGYGNYSYYQYEYASDKK
>gnl|bykdb|A0A0D9AKD0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas stutzeri] (length=736 residues).
MTTMPRPIYETKEDKDIDLAHLFDTLINNRALILTITGFFAALGVAYALLATPVYLASAMIQIEPKNGLPSLTDVVGNAP
AVSPAQTEIALLKSRSVVGGAVEALNLDINIEPHYFPLIGGFVYRRFEPTEEGELGWYPDGFESYAWGGESLRVTQLIVP
DKMHGEELTLEAAENNGFILRDPDDEVVAQGVVGEPVETPDYGITVAELNARPGTTFTVIKNRTYATTEDYQNRLSAGEL
GKQSGIVNVTLEGTDPDKAIQVLEEVAQRYVDQNVARNAAEATQSLEFLSEQVPEVRKKLDAAQTALNKYQTGNRSVDIS
AETQSVLDRIVDLEKQISEQNLKRTEMERRFTRQHPNFQALMNQINQLQMQKAELEKQIGTLPSTQQELLRLTRDVEVSS
ETYSMLLNKTQELDIIRAGTVGNVHIIDHAAADIDQPVKPNKPLIVIAAILLGGLLAVAFVYVREALKRGVENPEEIERV
GIPVYAAIPFSEKQGALEKRLANFKRDKSSASYLLTINDPADLATEAMRSLRTSLHFAMIEAKNNILMITGPSPAVGKSF
VTSNLAAVIAQSGKKVLLVDADMRKGYLHKVMRCQGEKGLSDILSGRITLFDAIQKTQLNNLHVIAHGQLPPNPSELLMH
ENFSRFVKEISTMYDMVIFDTPPILAVTDAALVGSQAGTTLMVTRYGLNGVKEIEVAKRRLEQNGLLVKGVIFNAVIRKA
SNYSEYGYYQYDYQSK
>gnl|bykdb|A0A0D9ALR4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas stutzeri] (length=736 residues).
MTVMARSSLEYEGDNRIDLARILRVAFDHKALIFTITALFALLGVAYAIVATPVYRASAMIQIEPKKAGITGIPEAIPRP
NSVSQAVTEIELIKSRSVLGRTVNALKLYITARPKYFPILGSYMARLHDPEKDGELATPLLGMDSYAWGGEKLVVFQLDV
PEAYLGEKLTLRAGSAGAFSLYDEDDQLLLNGKINQAVRHEGFRVQIAELKARPGTEFFVVRSRPQTTALDYQKRLKVGE
AGKDSGIIYLTLEDPDADKANHVLDQISRLYVRQNIERSSAEAAQRLEFLRSQVPLVRKELEKAEAALNAYQTSAQSVDI
SIETKSVLDQIVALESQISEHNLKRTEYNQLFTPEHPTYQTLMTKIAQLQAQKNALMSKIDTLPMTQQELLRLNRDMQVT
TRTYTLLLDKAQEQDILRAGTIGNVRIIDSAYAVVEKPAKPIKPLVVLIAIFVGLLVSALVILIRQVFYRGIESPETIEH
LGIPVYAALPFSAKQEHLYRLRKIRDGRSKLLGGADPADLAIESLRSLRTSLKFAMLEARNRTLVITSPTPSVGKSFVSS
NLASVIAQAGQRVLLIDADMRRGYLAGVFGQEPRHGLSDALASGLRLAAVTNKTDQANLHFVASGFSAPNPSELLMHDNF
AKLLKEAEREYDFVIIDTPPVLAVTDAVLVAQLAGTCLLVARYGLSTASQVETSKRRLAQNGVLLKGAILNGVKRRASST
AYETGAYGYYSYSQKA
>gnl|bykdb|A0A0D9AQH4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas stutzeri] (length=732 residues).
MNSPVRPDRPWQRPVGPAADSDFIDLKKIWHAIWSRKWGIVLLVAIVALLTFFLLSRVTPIYKAVTSVLIETKGTPVLSF
QPAADTPVELSEYLQTQLSLMQSRGVAERVVRDLNLTEHPEFDLRQQPGPLVDFSGIVDALTGEEPEPLTEAQIIDYATQ
TFMDRTTVWVEGKSQLVYLSIAMADRLTAAQATNQLAQAYIEAQLEAKVDMSMTAASWMNERLVSLRQKLQDSEDRLQAY
LDAEGLVDLDGVGTISANELSLTGDRMIDARRQRAEAESQYRQVESMRSQGWERLASVPAVLGHPLIQQFKADQAHARSR
VEDLSRRYGDRHPAMASARSDLNAATASLKQQVEQVVASIERNYQLAVANENSLRASFDENKGRIQDISRKEFKVRDLQR
QVESDRALYDTFMTRLQETTATSDLSSTNARIVDAAIPPTEPSAPNKKLIMVVALFLALVVGIAQAIIREILDNTFKSSE
EVETKLGLPVMGIVPQVPRKMRKEVSHLFERSSDKRFCEAVRTIRTNLLLSEANQPRQVLVVTSTAPDEGKSSVSANLAF
AMGQLHRVLLIDADLRRATLDKAFDFKPGTPGLVNLIGGNAKLEECIHSVGNVDMIAAGSVPSNPLELLSSPRFAKLLEV
VKGRYDRIIIDSPPSQAVSDAAVLSTLADAVIYVVKSDSTLIPHVQKGVSQLQNSNAPITGVVLNHVDIEKAKKNGQFRG
YYDHYGYSEQTV
>gnl|bykdb|A0A0D9LQ12 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Neisseria sp. HMSC06F02] (length=730 residues).
MYKQYPSSAPAGNDEIDFGQQMQSLWQNKNKIAAAILAGGLAGAVIGLASTPLYRADAMLEIETKQNQILTEINNMLSNE
PAPSEAEVELVQSRLVLGKTVEDLQLDQEIKATYFPIFGNMVHNLSSSDDPMLKIGAFTVSEDWINKPFKLTVKDSKTYL
LTLPDGTTKEGHVGAPLKINNETVLKVDRILAEADQDFELTKFSKLSAIENLKNKLSVISKGKTSPIINLSYTDTDPKKT
STILNSIADNYVSQNRERDVQVASSGLAFISEELPRLKETLQDAENKLNAYRERSGSLDIPLESKGALESLTSIETQITL
LKTEEAGLAELYTPEHPSYKAVLDKLAVLERAKSKINQQIAGLPNTQQEVIRLTRDVETNQATYVQLLAKQQELNIMKAS
AQGNVRVVDHAYTPEKPIAPRKAVITALGALAAGALASMWFLLQGRMRRGITSSEEIEALDLEVSALIPHSKTQQKRDLI
KRKFKSLKGRSTYLLANEDSTDIAVEAIRALRTNIYFSMLDARNNILMITGAAPEAGKSFISANLATVMAQSGKRVLLID
TDMRKGYLDQLLNVTPEFGLSDILSGEVSPAQAVIQTNIPNLHLISAGSYPKNPSELLMDNRFKELLSNAQKRYDYVIID
TPPVLAVTDAVVVGQHAGTVLLVSRYGNTTAKELAISAECLRQNKITIKGVILNGMKREANSTYDYYYSYITPTEGKKTA
KKTTSEKPKA
>gnl|bykdb|A0A0E0TW12 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli UMNK88] (length=726 residues).
MTTKNMNTPPGSTQENEIDLLRLVGELWDHRKFIISVTALFTLIAVAYSLLSTPIYQADTLVQVEQKQGNAILSGLSDMI
PNSSPESAPEIQLLQSRMILGKTIAELNLRDMVEQKYFPIVGRGWARLTKEKPGELAISWMHIPQLNGQDQQLTLTVGEN
GHYTLEGEEFTVNGMVGQRLEKDGVALTIADIKAKPGTQFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDDPQ
LITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDNQL
NELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISK
SSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEHGISVYATIPMSEWLDKRT
RLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDGGKTFVSSTLAAVIAQSD
QKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDH
YDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGY
SYSEKE
>gnl|bykdb|A0A0E0U032 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli UMNK88] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLIGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQSSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDNK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHARPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEEEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGVKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A0E0V6Y3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli O7:K1 str. CE10] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQNSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDDK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHSSPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGVKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A0E0XYS6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli O104:H4] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQNSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDDK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHARPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGVKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQSQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A0E0Y1I7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli O104:H4] (length=726 residues).
MTTKNMNTPPGSTQENEIDLLRLVGELWDHRKFIISVTALFTLIAVAYSLLSTPIYQADTLVQVEQKQGNAILSGLSDMI
PNSSPESAPEIQLLQSRMILGKTIAELNLRDIVEQKYFPIVGRGWARLTKEKPGELAISWMHIPQLNGQDQQLTLTVGEN
GHYTLEGEEFTVNGMVGQRLEKDGVALTIADIKAKPGTQFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDDPQ
LITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDNQL
NELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISK
SSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEHGISVYATIPMSEWLDKRT
RLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSD
QKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDH
YDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGY
SYSEKE
>gnl|bykdb|A0A0E1CBN9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella pneumoniae 30660/NJST258_1] (length=718 residues).
MSSLINKTSSRDSEGIDLGRLLGEFIDHRKLIISVTSLCTLIALIYAIFATPIYQADALIQVEQKQGNAILSNLSQMLPD
SQPQSAPEIALIQSRMILGKTVDDLNLQANITQKYFPLFGRGFARISDAKPAEITISRLFVSGSDNETPELLLSVTGEKD
FLINFDGHSFKGKLGELIERNGISLKIDDINAPPGTEFIIKYVSRLKAISELQDKLTVNDQGKDTGILNISLTGDNPVLI
EKIVNSIADNYLAQNIARQAAQDAKSLDFLNKQLPEVRSELDIAESKLNEYRRQSDSVDLSLEAKSVLDQIVNVDNQLNE
LTFRESEISQLYTKEHPTYKALLEKRKTLQDEKAKLNKKVSSMPETQQEILRLSRDVEPGRAVYMQLLNRQQELSIAKSS
AIGNVRIIDNAVTQPKPVKPKKILVLLIGVVIGLIISIGLVLLRVFLRRGIESPEQLEELGINVYASIPVSETFAKKTTQ
KNSWKGKDDIQGFLAIENPADLAIEAIRGLRTSLHFAMLESRNNILMISGGSPNAGKTFVSSNLAAIIAQTGKKVLFIDT
DMRKGYTHKLFNIPNDNGLSDVLSGKKDFSSSVKHIPMLGFDVIPRGMVPPNPAELLMHKRFGELMSWADQNYDMVILDT
PPILAVTDAAIIGNYAGTTLLVSRFELNTAKEIDISIKRFEQSGVPVKGCILNGVVKKASSYYGYGYNYYGYSYKDNK
>gnl|bykdb|A0A0E1FKZ1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter baumannii] (length=728 residues).
MNQQNTNTEDTIDLKELFFSLIAQWKLIALCVILSVVCALLYLRVTPDTYSVDALVQVEDSKGASAALLGDLSQMIEQKS
PAQAEIEILKSRLVLGTVIKDLHLNIQVSSTENTLTHRLLSDTDYKTEYTKKSVLFKDDLKSFEVREFEVPAYYLDRNLL
LNFDKQSLRLTDPDTEEVILTVPLNQTNHVAGPHGLWKVAIFTKDQFDATYNIKSQSIPAAVNALSANYSVAERGKLTGV
LGLNYQGQDKEHITKVLNAILATYSAQNIERRSAESAQTLKFLDEQLPDLKKQLDDAERQFNKFRQQYNTVDVTKESELY
LTQSITLETKKAELEQKQAEMAAKYTAEHPAMREINGQLAAINKQISELNSTLKQLPDVQRQYLQLYREVEVKTQLYTAL
LNSYQQLRIAKAGEIGNVRIVDTAVEPVEPIKPRKLLVLILSVFVGGFIGALLALLRNMLRTGIKDSGQIENELDLPVYA
TVPRSPIQESRIKILKKKKSIPILAVKNSDDIAIESLRSIRTAIHFALANAKNNIIMIAGPSPEVGKSFISTNLATIFAQ
SDKRVLLIDADMRRGYMHKYFDVDVKPGLSEFLSGQADLQKVLHKTQVANLDVITRGKSPTNPSEILSSNQFKELLEQLQ
SQYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSQMKELELTVNRFEQAGVKVNGFILNDIQRASAGYGYGYNYAY
AYKAQKED
>gnl|bykdb|A0A0E1L7L2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=726 residues).
MTTKNMNTPPGSTQENEIDLLRLVGELWDHRKFIISVTALFTLIAVAYSLLSTPIYQADTLVQVEQKQGNAILSGLSDMI
PNSSPESAPEIQLLQSRMILGKTIAELNLRDMVEQKYFPIVGRGWARLTKEKPGELAISWMHIPQLNGQDQQLTLTVGEN
GHYTLEGEEFTVNGMVGQRLEKDGVALTIADIKAKPGTQFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDDPQ
LITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDNQL
NELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISK
SSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEHGINVYATIPMSEWLDKRT
RLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSD
QKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDH
YDLVIVDTPPMLAVSDAAVVGRSVGTSLLVACFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGY
SYSEKE
>gnl|bykdb|A0A0E1LDF2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQNSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDDK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHASPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEEEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGVKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A0E1LZ26 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli 1303] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQNSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDNK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHARPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A0E1M036 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli 1303] (length=726 residues).
MTTKNMNTPPGSTQENEIDLLRLVGELWDHRKFIISVTALFTLIAVAYSLLSTPIYQADTLVQVEQKQGNAILSGLSDMI
PNSSPESAPEIQLLQSRMILGKTIAELNLRDIVEQKYFPIVGRGWARLTKEKPGELAISWMHIPQLNGQDQQLTLTVGEN
GHYTLEGEEFTVNGMVGQRLEKDGVALTIADIKAKPGTQFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDDPQ
LITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDNQL
NELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISK
SSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEHGISVYATIPMSEWLDKRT
RLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSD
QKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDH
YDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGY
SYSEKE
>gnl|bykdb|A0A0E1PWJ2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter baumannii NCGM 237] (length=731 residues).
MNQNSKTNEDSIDLKELFFSLIAQWKIIACCVILSLICALLYLRITPDIYAVDAMVQVEDSKGAASAALLGDLSKVSGGL
SQKSPADPEIEILKSRMVLGQVIQNLNLDINIKDNQSGLIDKLISQDKSKIEYHHESVLYSNQNNNLIIREFKVPEYYFD
KPLKLEFKGTNQFTLMYKDQVVFNGLLNKKNILNTDRGLWQIQINAQGNLKEQSYTLTKLALPTAVKNFNNIYSVAEKGK
LTGVIGLNYLGQDPEHITQVLNNVLNVYHQQNIERKSLESKQTLTFLEKQLPELRKQLEDSEIKFNQFREKYKTVDVNAE
SELLLKQNIDLEKLKIELQQKQAELSAKYTNDHPLILQIDAQIAEINKKIADLNNRLTQLPETQRLYLQLYRDVKVNTEL
YTSLLNSYQQLKIANAGEIGNVRIIDTAVEPVKPVKPKKLIILILSIFIGGFIGVLIALLRDMMRSGVNDSAQIENELDL
PVYATVPRSPIQETRMSILKKKKSIPILAVKNSDDIAIESLRSIRTTIHFALANAKNNIIMIAGPAPEVGKSFISTNLAT
IFAQGNKRVLLIDADMRRGYMHKYFDIDVKPGLSELLSGQADLSQVLHKTQVTNLDVITRGKSPTNPSEMLSSMQFKDLL
EKFQTQYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSHMKELELTVNRFEQAGVKVNGFILNDIQRFSGGGYGYN
YAYAYKAQKED
>gnl|bykdb|A0A0E1RHL7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Glaesserella parasuis 29755] (length=695 residues).
MNENNHDEIDLVKLLGALLDYKWWIALFTLLVTLFGVAYVLLAPPVYTANASIQVESKSSRGLLNDFPGILEGESSSSTE
IAILKSRMVLSNTVEQLNLTTVVEPQFSIPFLSKGLHRLMGYEPQLSLSLFEPKNPQMKEMILEVGENAGEFSLFFADEK
VLEGSIGKKYQTEDFSFAISELEAKPGQLFKIKKNDVLLAINSLQKQISVTENGKQTGIIEISINGENKAQIKKIVKSVS
ENYLLQNIVRDSAEASKSLEFLSKQLPELKARLAESENNLNEFRLKNESVDLSLEAKSALDTIVQLEADLNELTLKESEI
SQKFTRNHPAYVALIDKRKVLNEEKIRLNKQVERLPNTQKEVIRLTRDLEVNQQIYIQLLNKMQELEIVKASTVGNVRIL
DEAQVLPNAVSPRKMIVVALAFMLGLIFASVTAIAKTLLHRGIEGTSELDVLGLPTYATIPYSNEQPIFSKHKVQHFKLL
SESTPTDPAVEALRSLRTSLHFAMLEAKNNILMISGASPSVGKSFISTNLANVLAKAGHKVLLIDADLRRSYLRRLLGLA
KEVGLSDVIAQQIPFEQVIQHYDNFDIIVKGETPPNPSELLSNARFQALLEWAAKEYDLVIVDTAPILAVTDAAIIGRYA
GTSLLVGRFGETTLKEVGLAKERFERAGVFIKGFILNGIKRKASNRYDYYQYDYK
>gnl|bykdb|A0A0E1SAZ9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia pseudomallei 305] (length=746 residues).
MNPNPTGTSTPADSEGDTDFIAVLDILIEGRWLIAAIALGVFIVGVAYAVFSKPVYQADILIQVEDSPDTSAAKSLLGDV
SSLFDVKSSAAAETQILASRLVVSRAVDNLKLFIDAKPKRFPVIGHWLARRSEGLSDPGLAGFGGYAWGQERIDVATFDV
PRAMEGDTFELTMLDARRYRLDGGDLERGAVGVVGRLERIAAKGGPIALRVDALAAKPGATFVLVRHSRLRTIEALQDNL
DVQERVKQSDVVVASLRDTDPDLVSRALNEIGRQYIAQNIQRKSAEAAQSLEFLNGQLPTLKQQLTDSEARLTKLRDEHG
SVDLTEEAKLVLAQSADAKTRLLELQQKRRELLSRFMPKHPSVVAIDQQIAALDGYRGTAEQQIKRLPALQQQFVRLMLD
VKVNTDLYTALLNNMQQLQLVRAGKVGNVRLVDTAAVPEVPVKPKKALVALASLLLGVLAGCGTAVGRSMLFHGISDPNE
IERRLGLSVYATVPRSDQQRALTERAKRKARALSLLCVAHPDEPAVESLRSLRTALQFAMLDAKNNVVVIAGPAPGVGKS
FVSANLAAVLTMAGKRVLLIDGDIRKGHLNDYLGLARGKGFSELIAGSAQPDDVLHRDVIAGLDFISTGAMPKNPAELLL
NARVSTLIDTFSQRYDAVVIDSPPVLAVADTGILAATAGTAFLVTLAGSTKLGEIAESAKRLAQNGVRLSGVVFNGINPR
LGQYGYGSKYGGYRYVAYEYGAKRDA
>gnl|bykdb|A0A0E1SGM1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia pseudomallei 305] (length=742 residues).
MVNTQAKHPYADLAVKTDEEDVVLGQMIQVILDDIWLLLGIALVVVALAGLYCYVAKPLYSADAQVRVEASDNTSQALTQ
TQTGAMINSGPPTPPTDAEIEIIKSRGVVAPVVEQFKLNASVTPNTLPILGAIAARLATPGHPGHPGKPWLGLSSYAWGG
EEASIDSIDVTPALEGKKLTLTAGADGGYALADPDGAVLVRGKVGEREQGGGVTINVSKLVARPGTRFTVVRQNDLDAIT
AFQSAIQVAEQGKQTGVIQISLEGKDPEQTAQIANALAQSYLHQHVTSKQAEATKMLEFLKNEEPRLKSDLERAEAELTQ
YQRTSGSINASDEAKVYLEGSVQYEQQVAAQRLQLAALAQRYTDEHPLVVAAKQQLGQLEAERAKYDGKFRGLPATEVKA
VALQRNAKVAEDIYVLLLNRVQELSVQKAGTGGNIRLVDAALRPGVPVKPKKVLILSAATLLGLILGTSVVFLRRNLFHG
IEDPDRVERAFNLPLYGLVPMSAEQARFDAADKGNRVRPILACARPKDLSVESLRSLRTAMQFALMDAKNRVIVLTGPTP
GIGKSFLAVNLAALVAYSGKRVLLIDADMRRGSLDRHFGTGGRRGLSELLSDQVALEEAIRETSVPGLSFIPSGARPPNP
SELLMSPRLSQYLDGLAKRYDMVIVDSPPILAVTDATIFGELAGSTFLVLRSGMHTEGEIGDAIKRLRTAGVQLQGGIFN
GVPARTRGYGRGYAAVHEYLSA
>gnl|bykdb|A0A0E1SY33 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli 53638] (length=726 residues).
MTTKNMNTPPGSTQENEIDLLRLVGELWDHRKFIISVTALFTLIAVAYSLLSTPIYQADTLVQVEQKQGNAILSGLSDMI
PNSSPESAPEIQLLQSRMILGKTIAELNLRDIVEQKYFPIVGRGWARLTKEKPGELAISWMHIPQLNGQDQQLTLTVGEN
GHYTLEGEEFTVNGMVGQRLEKDGVALTIADIKAKPGTQFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDDPQ
LITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDNQL
NELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISK
SSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEHGISVYATIPMSEWLDKRT
RLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSD
QKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDH
YDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGY
SYSEKE
>gnl|bykdb|A0A0E1T0M1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli 53638] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQNSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDDK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHARPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A0E1TV18 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia pseudomallei 576] (length=739 residues).
MVNTQAKHPYADLAVKTDEEDVVLGQMIQVILDDIWLLLGIALVVVALAGLYCYVAKPLYSADAQVRVEASDNTSQALTQ
TQTGAMINSGPPTPPTDAEIEIIKSRGVVAPVVEQFKLNASVTPNTLPILGAIAARLATPGHPGKPWLGLSSYAWGGEEA
SIDSIDVTPVLEGKQLTLTAGADGGYALADPDGAVLVRGKVGEREQGGGVTINVSKLVARPGTRFTVVRQNDLDAITAFQ
SAIQVAEQGKQTGVIQISLEGKDPEQTAQIANALAQSYLHQHVTSKQAEATKMLEFLKNEEPRLKSDLERAEAELTQYQR
TSGSINASDEAKVYLEGSVQYEQQVAAQRLQLAALAQRYTDEHPLVVAAKQQLGQLEAERAKYDGKFRGLPATEVKAVAL
QRNAKVAEDIYVLLLNRVQELSVQKAGTGGNIRLVDAALRPGVPVKPKKVLILSAATLLGLILGTSVVFLRRNLFHGIED
PDRVERAFNLPLYGLVPMSAEQARFDAADKGNRVRPILACARPKDLSVESLRSLRTAMQFALMDAKNRVIVLTGPTPGIG
KSFLAVNLAALVAHSGKRVLLIDADMRRGSLDRHFGTGGRRGLSELLSDQVALEEAIRETSVPGLSFIPSGARPPNPSEL
LMSPRLSQYLDGLAKRYDMVIVDSPPILAVTDATIFGELAGSTFLVLRSGMHTEGEIGDAIKRLRTAGVQLQGGIFNGVP
ARTRGYGRGYAAVHEYLSA
>gnl|bykdb|A0A0E1U7N9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia pseudomallei 576] (length=746 residues).
MNPNPTGTSTPADSEGDTDFIAVLDILIEGRWLIAAIALGVFIVGVAYAVFSKPVYQADILIQVEDSPDTSAAKSLLGDV
SSLFDVKSSAAAETQILASRLVVSRAVDNLKLFIDAKPKRFPVIGHWLARRSEGLSDPGLAGFGGYAWGQERIDVATFDV
PRAMEGDTFELTMLDARRYRLDGGDLERGAVGVVGRLERIAAKGGPIALRVDAFAAKPGATFVLVRHSRLRTIEALQDNL
DVQERVKQSDVVVASLRDTDPDLVSRALNEIGRQYIAQNIQRKSAEAAQSLEFLNGQLPTLKQQLTDSEARLTKLRDEHG
SVDLTEEAKLVLAQSADAKTRLLELQQKRQELLSRFMPKHPSVVAIDQQIAALDGYRGTAEQQIKRLPALQQQFVRLMLD
VKVNTDLYTALLNNMQQLQLVRAGKVGNVRLVDTAAVPEVPVKPKKALVALASLLLGVLAGCGTAVGRSMLFHGISDPNE
IERRLGLSVYATVPRSDRQRALTERAKHKARALSLLCVAHPDEPAVESLRSLRTALQFAMLDAKNNVVVIAGPAPGVGKS
FVSANLAAVLTMAGKRVLLIDGDIRKGHLNDYLGLARGKGFSELIAGSAQPDDVLHRDVIAGLDFISTGAMPKNPAELLL
NARVSTLIDTFSQRYDAVVIDSPPVLAVADTGILAATAGTAFLVTLAGSTKLGEIAESAKRLAQNGVRLSGVVFNGINPR
LGQYGYGSKYGGYRYVAYEYGAKRDA
>gnl|bykdb|A0A0E1UTD7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia pseudomallei Pakistan 9] (length=746 residues).
MNPNPTGTSTPADSEGDTDFIAVLDILIEGRWLIAAIALGVFIVGVAYAVFSKPVYQADILIQVEDSPDTSAAKSLLGDV
SSLFDVKSSAAAETQILASRLVVSRAVDNLKLFIDAKPKRFPVIGHWLARRSEGLSDPGLAGFGGYAWGQERIDVATFDV
PRAMEGDTFELTMLDARRYRLDGGDLERGAVGVVGRLERIAAKGGPIALRVDAFAAKPGATFVLVRHSRLRTIEALQDNL
DVQERVKQSDVVVASLRDTDPDLVSRALNEIGRQYIAQNIQRKSAEAAQSLEFLNGQLPTLKQQLTDSEARLTKLRDEHG
SVDLTEEAKLVLAQSADAKTRLLELQQKRQELLSRFMPKHPSVVAIDQQIAALDGYRGTAEQQIKRLPALQQQFVRLMLD
VKVNTDLYTALLNNMQQLQLVRAGKVGNVRLVDTAAVPEVPVKPKKALVALASLLLGVLAGCGTAVGRSMLFHGISDPNE
IERRLGLSVYATVPRSDRQRALTERAKHKARALSLLCVAHPDEPAVESLRSLRTALQFAMLDAKNNVVVIAGPAPGVGKS
FVSANLAAVLTMAGKRVLLIDGDIRKGHLNDYLGLARGKGFSELIAGSAQPDDVLHRDVIAGLDFISTGAMPKNPAELLL
NARVSTLIDTFSQRYDAVVIDSPPVLAVADTGILAATAGTAFLVTLAGSTKLGEIAESAKRLAQNGVRLSGVVFNGINPR
LGQYGYGSKYGGYRYVAYEYGAKRDA
>gnl|bykdb|A0A0E1UVN6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia pseudomallei Pakistan 9] (length=739 residues).
MVNTQAKHPYADLAVKTDEEDVVLGQMIQVILDDIWLLLGIALVVVALAGLYCYVAKPLYSADAQVRVEASDNTSQALTQ
TQTGAMINSGPPTPPTDAEIEIIKSRGVVAPVVEQFKLNASVTPNTLPILGAIAARLATPGHPGKPWLGLSSYAWGGEEA
SIDSIDVTPVLEGKQLTLTAGADGGYALADPDGAVLVRGKVGEREQGGGVTINVSKLVARPGTRFTVVRQNDLDAITAFQ
SAIQVAEQGKQTGVIQISLEGKDPEQTAQIANALAQSYLHQHVTSKQAEATKMLEFLKNEEPRLKSDLERAEAELTQYQR
TSGSINASDEAKVYLEGSVQYEQQVAAQRLQLAALAQRYTDEHPLVVAAKQQLGQLEAERAKYDGKFRGLPATEVKAVAL
QRNAKVAEDIYVLLLNRVQELSVQKAGTGGNIRLVDAALRPGVPVKPKKVLILSAATLLGLILGTSVVFLRRNLFHGIED
PDRVERAFNLPLYGLVPMSAEQARFDAADKGNRVRPILACARPKDLSVESLRSLRTAMQFALMDAKNRVIVLTGPTPGIG
KSFLAVNLAALVAHSGKRVLLIDADMRRGSLDRHFGTGGRRGLSELLSDQVALEEAIRETSVPGLSFIPSGARPPNPSEL
LMSPRLSQYLDGLAKRYDMVIVDSPPILAVTDATIFGELAGSTFLVLRSGMHTEGEIGDAIKRLRTAGVQLQGGIFNGVP
ARTRGYGRGYAAVHEYLSA
>gnl|bykdb|A0A0E1VRB8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia pseudomallei 1710a] (length=739 residues).
MVNTQAKHPYADLAVKTDEEDVVLGQMIQVILDDIWLLLGIALVVVALAGLYCYVAKPLYSADAQVRVEASDNTSQALTQ
TQTGAMINSGPPTPPTDAEIEIIKSRGVVAPVVEQFKLNASVTPNTLPILGAIAARLATPGHPGKPWLGLSSYAWGGEEA
SIDSIDVTPVLEGKQLTLTAGADGGYALADPDGAVLVRGKVGEREQGGGVTINVSKLVARPGTRFTVVRQNDLDAITAFQ
SAIQVAEQGKQTGVIQISLEGKDPEQTAQIANALAQSYLHQHVTSKQAEATKMLEFLKNEEPRLKSDLERAEAELTQYQR
TSGSINASDEAKVYLEGSVQYEQQVAAQRLQLAALAQRYTDEHPLVVAAKQQLGQLEAERAKYDGKFRGLPATEVKAVAL
QRNAKVAEDIYVLLLNRVQELSVQKAGTGGNIRLVDAALRPGVPVKPKKVLILSAATLLGLILGTSVVFLRRNLFHGIED
PDRVERAFNLPLYGLVPMSAEQARFDAADKGNRVRPILACARPKDLSVESLRSLRTAMQFALMDAKNRVIVLTGPTPGIG
KSFLAVNLAALVAHSGKRVLLIDADMRRGSLDRHFGTGGRRGLSELLSDQVALEEAIRETSVPGLSFIPSGARPPNPSEL
LMSPRLSQYLDGLAKRYDMVIVDSPPILAVTDATIFGELAGSTFLVLRSGMHTEGEIGDAIKRLRTAGVQLQGGIFNGVP
ARTRGYGRGYAAVHEYLSA
>gnl|bykdb|A0A0E1VZ13 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia pseudomallei 1710a] (length=746 residues).
MNPNPTGTSTPADSEGDTDFIAVLDILIEGRWLIAAIALGVFIVGVAYAVFSKPVYQADILIQVEDSPDTSAAKSLLGDV
SSLFDVKSSAAAETQILASRLVVSRAVDNLKLFIDAKPKRFPVIGHWLARRSEGLSDPGLAGFGGYAWGQERIDVATFDV
PRAMEGDTFELTMLDARRYRLDGGDLERGAVGVVGRLERIAAKGGPIALRVDALAAKPGATFVLVRHSRLRTIEALQDNL
DVQERVKQSDVVVASLRDTDPDLVSRALNEIGRQYIAQNIQRKSAEAAQSLEFLNGQLPTLKQQLTDSEARLTKLRDEHG
SVDLTEEAKLVLAQSADAKTRLLELQQKRQELLSRFMPKHPSVVAIDQQIAALDGYRGTAEQQIKRLPELQQQFVRLMLD
VKVNTDLYTALLNNMQQLQLVRAGKVGNVRLVDTAAVPEVPVKPKKALVALASLLLGVLAGCGTAVGRSMLFHGISDPNE
IERRLGLSVYATVPRSDRQRALTERAKHKARALSLLCVAHPDEPAVESLRSLRTALQFAMLDAKNNVVVIAGPAPGVGKS
FVSANLAAVLTMAGKRVLLIDGDIRKGHLNDYLGLARGKGFSELIAGSAQPDDVLHRDVIAGLDFISTGAMPKNPAELLL
NARVSTLIDTFSQRYDAVVIDSPPVLAVADTGILAATAGTAFLVTLAGSTKLGEIAESAKRLAQNGVRLSGVVFNGINPR
LGQYGYGSKYGGYRYVAYEYGAKRDA
>gnl|bykdb|A0A0E2GFI7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter nosocomialis NIPH 386] (length=731 residues).
MNQNSKTSEDSIDLKELFFSLIAQWKIIACCVVLSLICALLYLRITPDTYSVDAMVQVEDSKGAASAALLGDLSKVSGGL
SQKSPADPEIEILRSRMVLGQVIQNLNLDINVKDNQSGLIDKLISQDKSRLEYRHESVLYSNQNNNLIIRELKVPEYYLD
KPLKLEFKGANQFTLTYKDQVVFNGQLNKKNILNTNRGLWQVQLNAQGNLKEQSYTLTKLALPTAVKNFNDIYSVAEKGK
VTGVIGLNYLGQDPEHITQVLNNVLTVYHQQNIERKSLESKQTLAFLEKQLPELRKQLEDSEIKFNQFREKYKTVDVNAE
SELLLKQNIDLEKLKIELQQKQAELSAKYTNDHPLIRQIDAQITEINKKIADLNNRLTQLPETQRLYLQLYRDVKVNTEL
YTSLLNSYQQLKIANAGEIGNVRIIDTAVEPVKPIKPKKLIVLILSIFVGGFIGVLIALLRNMMRRGVNDSTQIENELDL
PVYATVPRSPIQETRMNILKKKKSIPILAVKSSDDIAIESLRSIRTAIHFALTSAKNNIIMIAGPSPEVGKSFISTNLAT
IFAQGNKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQADLTQVLHKTQVANLDVITRGKSPTNPSEILSSTQFKDLL
EKFQTQYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSHMKELELTVNRFEQAGVKVNGFILNDIQRSSGGGYGYN
YAYAYKAQKED
>gnl|bykdb|A0A0E2GNC4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter radioresistens DSM 6976 = NBRC 102413 = CIP 103788] (length=727 residues).
MSQNTTTEDTIDLKELFFSLIAQWKLIALCTILSLVCALLYLRTTPNIYQVDAMVQVEDKKGASAALLGDLSEMVEQKSP
AQAEIEILKSRLILGNVIHSLNLDVQISSTEDSFIQRLLHKPEFQTKYSNQSVVFKDGNKTFSLRQFDVPSYYLDRNLQL
IFENNNFILTDTITHEPIFKGLLNRNNQFNSQYGLWKVAIYSKDQLADTYNIKKLSLPAAVNTISAPFSVAEKGKQSGIL
GLNYEGTDKQHITQVLNAILAAYSQQNIERRTAETAQTLKFLDEQLPQLKQQLDKSEREFNNFRERFNTVDVTKESELYL
TQSITLETQKIELQQKQAEMAAKYTAEHPQMREINAQLGAVNNKINELNGTLKRLPELQRQYLQLFREVEVNQQLYTTLL
NSYQQLRVAKAGEIGSVRIIDTAVEPLGPIKPRKPLILGISLFIGAFIGILLALLRNMMRSGVKDSSQIENELDLPVYAT
VPRSPVQESRIKLLKKKKHIPVLAVKNSDDIAIESLRSLRTAINFALANAKNNIIMIAGPAPEVGKSFISTNLSAIFAQS
DKRVLLIDADMRRGYLHKYFNVNTQPGLSEYLNGQNNLSDVIHETEIKNLYMMSRGKSPANPSELLSSTAFSTMLEQLSS
QYDHIIIDTPPVLAVTDGIIISQYSGVNLIIARHAKTQVKELEITVNRFEQAGVKVNGFILNDIQHTAAGYGYGYNYAYA
YQAKKDD
>gnl|bykdb|A0A0E2L586 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQNSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDDK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHARPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGVKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A0E2ND25 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium sp. LSHC414A00] (length=792 residues).
MNYASFPLDKRMPLPNPDQEKGEDFIDVERLLGMAARQVKVVAVCAIIGLFLGLLYLQTTPKQYMSVASVLIDEGLNKVI
DDISAASVTMQTDAALLSQIEIITSARLASVVVDKLKLDQNAEFMNPPQSALVKGIGFVRGVIGYFRSSSAEQIPGMENV
DEATRQAMMQTARHDYAVLKLQSEVLAQRNGRSYVLAIGYQSTNPALATAITKAYADAYLADQLNASFDATERAAVWLQG
RLTELRQNSQAAAMAVEKFRAEHGLAANSDGQLISDKQIADLTAQLIVAQADTARASARYQQYKTIVESGSDNAFNDSAI
SSDQPASSVIATLKTRYLAVAKRLQDVTANFGADHPQAVALAKEKADLSTQIFGELKQLTESYRNEYEVALSRETSLRQK
IADAAGKSSIDNQSQVKLRELDQQAQALTTLYQTFLSRYEEASQQQSFPVGKVRIISDASTPLSASSPRTSRVLALSLVL
GVLLGAGFGGLNEFNERFFRTGEDIRDRVGLKFLGYLPMIGGRLGKDADGGAADAKGANTLSAAEKRARMRVSVDAPASM
FSETLRNAKIAFDVVMEGQGSRVIGVVSVLPGEGKSTVAANLAGLLAANGSKTLLIDADLRNPGLSRNLGMEAEQGLMEA
VVNGQTWQSVGKVDRQTKLAIIPAVLRGQFSHTSELLSSAGMRRFIDNAKETFEYIIVDLPPLGPVVDAKAFAPLVDGFV
LVAEWGRTPRAMVRSLLEQEPYVASKVVGAVLNKVDLKKLPKYGSLGGSEKFFDRYSTYYLEKSDVRAKTAA
>gnl|bykdb|A0A0E2P2E8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium sp. LNJC391B00] (length=792 residues).
MNYASFPLDKRMPLPNPDQEKGEDFIDVERLLGMAARQVKVVAVCAIIGLFLGLLYLQTTPKQYMSVASVLIDEGLNKVI
DDISAASVTMQTDAALLSQIEIITSARLASVVVDKLKLDQNAEFMNPPQSALVKGIGFVRGVIGYFRSSSAEQIPGMENV
DEATRQAMMQTARHDYAVLKLQSEVLAQRNGRSYVLAIGYQSTNPALATAITKAYADAYLADQLNASFDATERAAVWLQG
RLTELRQNSQAAAMAVEKFRAEHGLAANSDGQLISDKQIADLTAQLIVAQADTARASARYQQYKTIVESGSDNAFNDSAI
SSDQPASSVIATLKTRYLAVAKRLQDVTANFGADHPQAVALAKEKADLSTQIFGELKQLTESYRNEYEVALSRETSLRQK
IADAAGKSSIDNQSQVKLRELDQQAQALTTLYQTFLSRYEEASQQQSFPVGKVRIISDASTPLSASSPRTSRVLALSLVL
GVLLGAGFGGLNEFNERFFRTGEDIRDRVGLKFLGYLPMIGGRLGKDADDGAADAKGANTLSAVEKRARMRVSVDAPASM
FSETLRNAKIAFDVVMEGQGSRVIGVVSVLPGEGKSTVAANLAGLLAANGSKTLLIDADLRNPGLSRNLGMEAEQGLMEA
VVNGQTWQSVGKVDRQTKLAIIPAVLRGQFSHTSELLSSAGMRRFIDNAKETFEYIIVDLPPLGPVVDAKAFAPLVDGFV
LVAEWGRTPRAMVRSLLEQEPYVASKVVGAVLNKVDLKKLPKYGSLGGSEKFFDRYSTYYLEKSDVRAKTAA
>gnl|bykdb|A0A0E2TR63 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli O121:H19 str. 2010C-3609] (length=726 residues).
MTTKNMNTPPGSTQENEIDLLRLVGELWDHRKFIISVTALFTLIAVAYSLLSTPIYQADTLVQVEQKQGNAILSGLSDMI
PNSSPESAPEIQLLQSRMILGKTIAELNLRDIVEQKYFPIVGRGWARLTKEKPGELAISWMHIPQLNGQDQQLTLTVGEN
GHYTLEGEEFTVNGMVGQRLEKDGVALTIADIKAKPGTQFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDDPQ
LITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDNQL
NELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISK
SSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEHGISVYATIPMSEWLDKRT
RLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSD
QKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDH
YDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGY
SYSEKE
>gnl|bykdb|A0A0E2TX44 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli O121:H19 str. 2010C-3609] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAAFALCAVVYTFFATPIYSADALVQIEQNSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDNK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHARPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEEEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGVKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A0E3TIJ2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter baumannii] (length=731 residues).
MNQNSKTSEDSIDLKELFFSLIAQWKIIACCVVLSLICALLYLRITPDTYSVDAMVQVEDSKGAASAALLGDLSKVSGGL
SQKSPADPEIEILRSRMVLGQVIQNLNLDINVKDNQSGLIDKLISQDKSRLEYRHESVLYSNQNNNLIIRELKVPEYYLD
KPLKLEFKGANQFTLTYKDQVVFNGQLNKKNILNTNRGLWQVQLNAQGNLKEQSYTLTKLALPTAVKNFNDIYSVAEKGK
VTGVIGLNYLGQDPEHITQVLNNVLTVYHQQNIERKSLESKQTLAFLEKQLPELRKQLEDSEIKFNQFREKYKTVDVNAE
SELLLKQNIDLEKLKIELQQKQAELSAKYTNDHPLIRQIDAQITEINKKIADLNNRLTQLPETQRLYLQLYRDVKVNTEL
YTSLLNSYQQLKIANAGEIGNVRIIDTAVEPVKPIKPKKLIVLILSIFIGGFIGVLIALLRNMMRSGVNDSTQIENELDL
PVYATVPRSPIQETRMSILKKKKSIPILAVKSNDDIAIESLRSIRTAIHFALTSAKNNIIMIAGPSPEVGKSFISTNLAT
IFAQSNKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQADLTQVLHKTQVANLDVITRGKSPTNPSEMLSSTQFKDLL
EKFQTQYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSHMKELELTVNRFEQAGVKVNGFILNDIQRSGGGGYGYN
YAYAYKAQKED
>gnl|bykdb|A0A0E3Z3N7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudoxanthomonas suwonensis] (length=742 residues).
MTKQMGAGAARDEDEIDLRELLGLLVDRKWWIVGVTALFFVVGVAYALLAPPVYQAQAMVQVESKMPSIPGLSDLTSLAG
SGSTASTTEVALLTSRSVVGTAVDQLHLDTMVEPARFPLLGAFLARRFHPAEEGEVASPWLGMARYGWGGESLRIERLDV
PPVLVDAPLRLVAGDDGRYVLLDDDGNELLSGQVGQTAEGRGLVLEVAALDANPGTRFEVTKRRRLDVITGLQQDIKASE
QGKESGILRLTYEDTDPLRAEAVVQKVAEAYVRQNVDRSSAEAASQLQFVKDQLPTVRRQVEEAQALMSAYQSRANSVDI
TLQTKGLLEQEVAVESSIQQLRLKQAEMDRSFTREHPAYRALLKQIGDLESRKAGFRREVSQLPDTQQELLRLTRDLQVS
NELYTALLNQAQQLDVARAGSVGNVRIVDPAVADTAKPVKPRRSLVVLVATLLGGFLAVGAVFLQRMLNPGIEDPAQIEE
LGLPVYAAIPLSSSKALPTVRRARGGEHRIVADGRQHLLAVGEPADLAVEALRSLRTSLHFAMLEAKNNILAISGPRPGV
GKTFVSANLAAVIAQGGQKVLLIDADMRKGTLHKVLGMQPAPGLSDVLAGKLEVDAAIHPVGGLENMHFLLRGDIPPNPS
ELLMHPRFGRLLESLAPRYDLVIIDTPPILAVTDAALVGSHAGSNLLVTRFGINQPREILLTMKRFEQNGVQVKGAIFNA
VEKRATGYYSYGYYEYASARES
>gnl|bykdb|A0A0E4GQB1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio cholerae] (length=737 residues).
MTGKQFTQEEVIDIRQYFNVLLNYKWRILLFSVMVTAITLLFVLSMRSEYTARATILIESTQAKAVSIEEVYGLDTKSQE
YYLTQIEILKSDTIAQEVIERLDLASDPEFDLSPESDASPSLKERLVEWMPFLQGFKQEETIADPDLEAYRQNRLILYKF
KRGMEISPIRKTQLVNIYYTAGDPKLAAKIANEIARVYMDSHLEAKLEVELKANTWLNTRMEELRTQLRESEAKLQAFLQ
AEGLVDVQGVEGLATQELEELTSQMNKARDRRVAAETLYQVANSYSKNDSDLTALSSIPEISNHPTIRDLKVAEVDAERK
VSEFSKRYGPKHPKLKSASAQLEAVRKNLRAELRQLLNGINNELQAAKQSERSLQTEFNQRKSEFQTLTVKNAKYSELKR
EVQTNRELFDLFLARQKETSASGDFNTTIARFTDQASAPLAPSKPNKKLIVLLAFVVSFGFACVVAFIADAMTDTFADIK
QVEKQLALSLLGVVPVVRKQRGKLDAKAYFDEKLRELTEAVRTIRTSYLLAHVNQDQHVVMLTSCLPGEGKTTSSLNLAL
SLAQMEKTLLIDCDLRKPAIAHRFGISGSQPGVTNLLNGTQSLEDCVYHDEQSGLDILTAGVYASNPLELLSSSKFSELL
ADLRTRYQRIVIDTPPCLAVSDSFMLAQYVDSVILVIDANHTRTPVVREVVGKLTQQGSRIDGVILNRLNAKKASRYSGY
YHYQAYYGEETKSGAAK
>gnl|bykdb|A0A0E8PCY4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter baumannii] (length=728 residues).
MNQQNTNTEDTIDLKELFFSLIAQWKLIALCVILSVVCALLYLRVTPDTYSVDALVQVEDSKGASAALLGDLSNMIEQKS
PAQAEIEILKSRLVLGSVIKDLHLNIQVSSTENTLTHRLLSDTDYKTEYTKNSVIFKDSLKSFEIRQFEIPAYYLDRTLH
LNFDKQSLRLTDPTTEEVILTLPLNQLNQVTGPQGTWKVGIFTKDQLEATYNIKSLSIPAAVNAISANYSVAERGKLTGV
LGLNYQGQDKEHITKVLNAILVTYSAQNIERRSAESAQTLKFLDEQLPDLKKQLDDAERQFNKFRQQYNTVDVTKESELY
LTQSITLETKKAELEQKQAEMAAKYTAEHPAMREINGQLAAINKQIGELNSTLKQLPDVQRQYLQLYREVEVKTQLYTAL
LNSYQQLRIAKAGEIGNVRIVDTAVEPIEPIKPKKLQILLLSIFLGGFIGALIALLRNMLRSGIKDSGQIENELDLPVYA
TVPRSPIQESRIKILKKKKSIPILAVKNSDDIAIESLRSIRTAIHFALANAKNNIIMIAGPSPEVGKSFISTNLATIFAQ
GNKRVLLIDADMRRGYIHKYFDVEVKPGLSEFLSGQADLQKVLHKTQVTNLDVITRGKSPTNPSEILSSNQFKELLEQLQ
GQYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYVKSQMKELELTVNRFEQAGVKVNGFILNDIQRASAGYGYGYNYAY
AYKAQKED
>gnl|bykdb|A0A0E9MNH8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas changbaiensis NBRC 104936] (length=743 residues).
MNDLSIGRDVGSAARIAAVQPFRPDAPAKDAGGDRIPLLTRYLRIILRWRWVILGIIAATLVVGLVATLLMTPYYRATVR
VEIARESNKVVNIQGVSPESSPVDLEFFQTQYGLLKSRSLAEKVARQLNLADNRQFFTMFGEERAYEQANNSRDSRVVRP
TRLRKAGEILLEHVDIAPIRGSSLVDVDFTSPDPVLSQQIANAWAENFIRVNLERRFDASSYARRFLEQRLEQLRTKLEE
SERNLVAYAGRQRIINLPAQGGATGSASAERSLVADDLASLNLELAKATADRVRAQSQLTRTQNGGATDQGLENLAISGI
RQKRAELAGEYSRMLSQFKPDYPPAVAIASQIRDLDRSIAREESRVGQTLRTNYEASVARESALQDQVAKLEGKLLDLKR
RSIQYNIYQRDVDTNRQLYDGLLQRYKEIGVAAGVGTNNIAIVDRAEVPERPASPRLVLNLAVALLAGLAMAGGTAFALE
HIDETITNPGDVADELDLPLLGTIPRLAGGEDPMQTLQDRKSALVDAYLAVQTYLELSTEHGVPASLSVASTRPAEGKST
TAYAVALLLARGHKRVLLIDGDMRSPSVHSIIGIRNTAGLSNYLAGSDDYRPNIHATANDGLFAMSAGPTPPNAAELLGG
GRLQSLLDVLSKEFDHVVIDSPPVMGLADALLIASRVDGTVFAVESHGIRAGLVRVAIDRLRGAHARLLGVVLTKFEANR
AHFGYGYDYGYGYGRERPEALAE
>gnl|bykdb|A0A0F0DJJ4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas sp. 21] (length=737 residues).
MSVMPRSSLETLQDTRIDVAGLLRLLFDHKKMILAVTGLFAVLGLFYAVIATPIYVSGAMIQIEQKKNGLNGTPEVINRP
DSVSIAATEIELLKSRAVLGKAVELLKLDIVAKPKHLPLIGDYLARRYKPEAGDALSAPWLGMGSYGWGGEQIKVFSLDV
PEEYLGEPLTLVADGGDAYHLLNADDQLILRGELKKPVLEKGFSIEVDELVARPGTEFIVAKNRLLTTTLNYQKLLKVVE
AGKDSGIIYMTLEDPSPLRADLILDKISHLYVLQNVERSSAEASQRLQFLRSQLPVVRLDLERAENAYNAYQTTAKSADI
SVETRGVLDQVVGIDNQLSELKLKRAEYDRLYTPTHPLYQALNKQMGSLEDRKAQLQKRIQNLPATQQELLRLSRDMQVT
RQTYTSLLNKAQEQDIIRAGTIGNVRVIDTAQANVEQPAKPMRKVIVLLATLLGFCVALGILFLRQAFYRGVENPEAIEQ
LGLSVLAAVPYSRQQERLEKERKGDILGHTPKLLAASTPGDLANEAIRSLRTNLHFALLEARNNVVMLTSPAPGAGKSFV
SSNLAAIVAQSGLRTLLIDADMRKGYLHRVFGLTPRHGLSDALSSHRPLSEVILPTEVPELDFISCGFAAPNPSELLMHD
NFAQLLRDASSMYDLVIVDTPPVLAVTDAALVGRLCGICLLVTRFGQSPASEIDTARRRLAQSGIHLQGAILNGVKRKAS
TAAYDYGAYAYRYDAKD
>gnl|bykdb|A0A0F0FLI3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderiaceae bacterium 16] (length=747 residues).
MNQNPPPVAVAGPPDDEIDLVRYLDVLLASRVLIATIAAVVLALGVAYAFLARPVYQADILVQVEDNPNSAKSLLGDVSS
LFDVKAEATAEIEILRSRMVVGKAVDNLHLYIYAKPKYLPFVGAWIASRAKGLSEPGLLGFGGYAWAKESISVDRFDVPE
SLEGEKFNLVALGEGRYRLEQDSLDQPLEGRVGELLQAEQNAGRFSLLVTDLKAKPGIIFNLVRASRLQTLEKLQDQLKI
AEKGKQSGIIGASLDGTDPKLTASILNDIGDEYVAQNIKRKAAEAEKSLVFLGDLLPQLKTELERAEVRYNEMRNKRNTF
NLSEEGKAFLQESVTAETSLLELKQKRTELLTRFTATHPSIQALDQQIATLSAIVGGMAARMKTFPNVEQDTLRLMRDVQ
VNNDLYVGLLNNMQQLKLVKAGKVGNVRLLDNAPVPEEPIKPKKSLTIALAGIVGLLLGVVAAFVRNALYGGITDSQDIE
QHSGLNVYATVPLAQQQAILSEEIRLRKRGKFLLADRYPNDPSIESLRSLRTALQFAMLDADNNRVLLTGPTPGVGKSFI
SANLALVMASGGKRVLLVDADMRKGYLNQYFGQERQRGLSEVLVGKVGFDEAVHRNVFENLDFLSTGVLPPNPAELLLNE
RMVTLLQEMSKGYDLVLIDTPPVLAVSDTAILAARCGTVFLVTRFEKTTIGEVTESTKQLRQSNADVNGVVFNGLDASAY
RYGYGSKYGRYRYAYYGYASEQGKVQG
>gnl|bykdb|A0A0F0FXM5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderiaceae bacterium 16] (length=753 residues).
MNIVNSRNQAPETWDDGGKPIDFTSYVDVLVRYRRTFLVVTGGVICAGLVYAMLAKPVYRADIVVQVEDSNAGAGASGKQ
TANVTPVFDVKPAASAEIELLRSRMVVGKAIDSLHLDIKASPRYFPIVGRAIASFNKELSTPGLFGWGGFAWGPESISVE
SLEVPPNLVDRTIQLTALGGKQYRVSFSSNDVKWTGTVGVPQTIDTPQGKVSMLVSELDGRPGSVFYVQQVPRAAAIEEL
QESLMILERGKQSGVIGMTLEGNSAEKTAAVLNEIGAEYVEQNVRRKAAEAEKSLAFLDRQLPQLKQQVETAESRYNAMR
NQRGTIDLSEESKLILGQSVQIQTRLQELRQKRQELIARFTSNHPTIEIMDSQIASLNAQLNGVTGKIQKLPDVEQNVLR
LMRDVKVSTELYQSLLNDTQQLRLVKASKVGTARLVDPAEVPLKPVRPNRSMIAGVALVLGLLLGLLAVVVRRMLDGGVS
DADEVEKSTGLTVYSTIPLSAQQARPEGTRKAKGKDSGRCDVLAHLEPADPAIESLRSLRTALQFALAGSRSRVVVVTGP
APGVGKSFVCANFAAVLASGGKRVVLVDADLRRGSLNHRFGVARSPGLSEVLTGMPLDRAMRRQVLPGLDVIPTGTEPPH
PADLLLSEQLDTLLDTLKAQYDVVLIDTPPVLAASDAGILAARAGAVFLVARADQTTVGEITAADRAIQQAGGEIKGVLF
NGLRIDGRWYRAHYHFGKYRYLNQYGNSRIKRA
>gnl|bykdb|A0A0F0TJG9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Enterobacter cloacae subsp. cloacae] (length=732 residues).
MSSYTTDSYGAAAPENHEIDLISLLGEVIDHRAVILSITFLFTLLAGLYAFLATPVYRADALIQVEGKQDNSLLKNLRQF
GSEMSPDVEPEILLLKSRMILGATVDELGLTQHVTQRTFPVVGRLWARLQGRKPATVALGWLQLPPVEGKPRTLVLTVLE
KGAYRLEGDNFYAEGREGKPLEKAGVSLLVVKMNAPTGTQFTVQNSTRLEAINTLSTQFSVVESAKQSGVLTLTLTGNDP
ERIAHVLNRIANNYLQQNIARQEAQDARSLAFLQKQLPKIRSELDLAEERLNQYRKQRDSVDLSLEAKSVLEQIVNIENQ
LNELTFREAEISQLFKKEHPNYRALREKRQTLEQEKVRLNQRVAAMPSTQQDILRLSRDVESGRTIYLQLLTRQQELNIS
RSSAIGNVRIIDSAVTQPDPIKPRKLVVIVLGILLGLICSMGLVLVRMALRRGINTSEQLEGLGVQVMATLPRSLWLWKK
TNLRKKRVFGSRWRHKIVDVPFLPVDRPADVFVEAVRGLRTSLHFTLQDAANRIVMISGPTQDCGKTLVSTSLAAIEAQA
GLRVLFIDADMREGYVHNIFDLKNHTGLSDVLDGKCHFQAAIQRYEKGNIDVLTCGPVPLRPSELLMSERFRALMTWADE
HYDLVILDTPPVLAVTDASVAAPVAATSLLVARYGKTSLKEMENSIKRLQQTGAHINGTVLNDVVKSAALYYRAGYGHYE
YGQRPTRQPRKD
>gnl|bykdb|A0A0F0TJI5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Enterobacter cloacae subsp. cloacae] (length=720 residues).
MTEKTKPSAAPISGSDEIDIGRLVGTVIEAKWWVLGITAVFAAAAIVYTLFATPIYSADALVQIEQNTGNSLVQDIGSAL
ANKPPASEAEIQLIQSRLVLGKTVHDLGLDISVTKNTFPIFGAGWDRLTGHSNDTVKVTDFVLPKGSADQTFTLTVLGPK
QYQLTSDAGFSARGEVGQMLTKDGVSMKVSAIQAQEGSEFTVTKFSTLGMINNLQNNLTVTENGKDTGVLSMTFTGEDKD
QIREILNSITRNYLEQNVERKSAEAAKSLAFLARQLPEVRARLDDAENKLNAFRQDKDSVDLPLEAKSVLDSMVNIDAQL
NELTFKEAEISKLYTKRHPAYRTLLEKRRTLEEEKAKLNDRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITE
ASTVGDVRIVDPAITQPGVLKPKKALIILGSIILGLMLSIVGVLLRSLFNRGIESPQVLEENGINVYASIPLSEWQKSHD
RVKSVKGVKRYKQSQLLAVGNPTDLAIEAVRSLRTSLHFAMMQAKNNVLMLTGVSPSIGKTFVCANLAAVVSQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILLGKGEISQSAKPTSIPKFDLIPRGQVPPNPSELLMSDRFAELVEWASKNYDLVL
IDTPPILAVTDAAVVGRLAGTTLMVARYAVNTLKEVETSLSRFEQNGIEVKGVILNSIFRRATGYQDYGYYEYEYKSDSK
>gnl|bykdb|A0A0F1B156 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Enterobacter sichuanensis] (length=720 residues).
MTEKTRSSAAPTSGSDEIDIGRLVGTVVEAKWWVLGITAVFAAAAVVYTLFATPIYSADALVQIEQNTGNSLVQDIGSAL
ANKPPASEAEIQLIQSRLVLGKTVHDLGLDISVTKNTFPIFGAGWDRLMGRNNDTVKVTDFVLPKGAADQTFTLTVLGPK
QYQLTSDAGFSARGEVGQMLTKDGVSMMVSAINAQEGGEFTVTKFSTLGMINNLQNNLTVTENGKDTGVLSMTFTGEDKD
QIRDILNSITRNYLEQNVERKSAEAAKSLAFLSKQLPEVRARLDEAENKLNAYRQDKDSVDLPLEAKSVLDSMVNIDAQL
NELTFKEAEISKLYTKRHPAYRTLLEKRRTLEEEKAKLNDRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITE
ASTVGDVRIVDPAITQPGVLKPKKALIILGSIILGLMLSIVGVLLRSLFNRGIESTQVLEESGINVYASIPLSEWQKSRD
SVKTIKGVKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAKNNVLMLTGVSPSIGKTFVCANLAAVVSQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILLGKGDISQSAKPTTIPKFDLIPRGQVPPNPSELLMSERFTELVEWASKNYDLVL
IDTPPILAVTDAAVVGRLAGTTLMVARYAVNTLKEVETSLSRFEQNGIEVKGVILNSIFRRASGYQDYGYYEYEYKSDSK
>gnl|bykdb|A0A0F1B3R0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Enterobacter sichuanensis] (length=727 residues).
MSSYTTDSYGAAAPENQEIDLLRLLSEMLDHRVLILSVTFMFTVLAGLYAFLATPLYRADALIQVEGKQDNSLLKNLRQF
SNELSPDVEPEILLLKSRMILGATVDELGLTQNVAQRGRLWARLQGHKPATLTLGWLQLSPVEGKPRTLLLTVLEKGAYR
LEGDNFSAEGREGKALEKAGVSLLVVNLDAPPGTQFTLQSSTRLEAINVLSTQFSVVESAKQSGVLTLTLTGSDPERIAH
VLDRIANNYLQQNINRQEAQDSRSLAFLQQQLPKIRSELDQAEERLNLYRKQRDSVDLSLEAKSVLEQIVNIENQLNELT
FREAEISQLFKKEHPNYRALREKRHILEQEKIHLNQRVAAMPSTQQDILRLSRDVESGRTIYLQLLTRQQELNISRSSAI
GNVRIIDSAVTQPDPIKPKKTLIMVSGTLLGLMCSVGLVLLRIAFRRGINTSEQLEGFGVPVMATLPRSMWLWKKTNLRR
KRVLGSRWRHKINDVPFLPVDRPADIFVEAVRGLRTSLHFTLQDAANRIVMISGPTQDCGKTLVSTSLAAIEAQAGLRVL
FIDADMREGYVHNVFGLKNHTGLSCVLEEQCACQEAIQHYEQGNIDVLTCGPVPSHPSELLMSERFRAVMTWANEQYDLV
ILDTPPVLAVTDAAVAVRVAGTSLLVARFGKTRLKEMENSIKRLQQTGARIGGTVLNDVIKSAVQYYRAGYDHYEYGQSP
TRRQRKD
>gnl|bykdb|A0A0F1WV71 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Enterobacter roggenkampii] (length=720 residues).
MTEKTKPSAAPTSGSDEIDIGRLVGTVIEAKWWVLGITAVFAAAAVVYTLFATPIYSADALVQIEQNTGNSLVQDIGSAL
ANKPPASDAEIQLIQSRLVLGKTVHDLGLDISVTKNTFPIFGAGWDRLMGRSNDTVKVTDFVLPKGAADQTFTLTVLGPK
QYQLTSDAGFSARGEVGQMLSKDGVSMMVSAINAQEGGEFTVTKFSTLGMINNLQNNLTVTENGKDTGVLSMTFTGEDKD
QIRDILNSITRNYLEQNVERKSAEAAKSLAFLSKQLPEVRARLDDAENKLNAYRQDKDSVDLPLEAKSVLDSMVNIDAQL
NELTFKEAEISKLYTKRHPAYRTLLEKRRTLEEEKAKLNDRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITE
ASTVGDVRIVDPAITQPGVLKPKKALIILGSIILGLMLSIVGVLLRSLFNRGIESPQVLEENGINVYASIPLSEWQKSRD
SVKTIKGVKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAKNNVLMLTGVSPSIGKTFVCANLAAVVSQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILLGKGDISQSAKPTTVPKFDLIPRGQVPPNPSELLMSERFTELVEWASKNYDLVL
IDTPPILAVTDAAVVGRHAGTTLMVARYAVNTLKEVETSLSRFEQNGIEVKGVILNSIFRRATGYQDYGYYEYEYKSDSK
>gnl|bykdb|A0A0F2GXJ1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio sp. S234-5] (length=727 residues).
MYETMTTPQTRPSVDNASDEIDLGKLLGILLDAKWFIFAITFIFAVGGVAVALLSTPIYKADALLQIEQKSSGGISSLVG
DMGELFSQESSATTEIEIIKSRMILGDTVDKFNLTTVTEAKYFPLVGKGLARMAGKVNQIEVSRYQVPDYAQGMSHTILV
TDEAQQSYQLVREDDTVVLQGKAGELAKNDGYELFVTELRSHTGQEFAIGQRNRLEAIEWLKQNLSISERGKQTGILQLS
FEGENRKQISEILNHISQTYFLQNVERNSAEAEKSLTFLKGHLPDIKDSLTAAEDSLNRFRQENDSIDLGLEAKSTLDVM
VKLEAQLNELTFKESEISQRFTKDHPAYISLLDKRETLLKERERLNQQVQKLPKTQREVLRMTRDVEVNQQIYIQLLNKV
QELSIIKAGTVGNVRILDEAQTFAKPIKPKKPLIAVLATLLGGMLSVAIVLVKAALHRGVETPDQIEQIGLSVYASVPKS
TLQLALAEKLKRKGKHNKELALLSESNPADLSIEALRGLRTSLHFAMLEAKNNVLMISGPAPGIGKSFVSTNFAAVAAKT
GQKVLLVDADMRKGYLQQCFGLKWENGLSDYLAGKIDTATAVQHAKVDNLDIIARGQVPPNPSELLMHPRFKQLVEWASE
NYDLVIIDTPPVLAVTDPSIVGSLAGTTLMVARFGQNTVKEIEVARNRFEQAGIEVKGVILNATEKRASSYYGYGYYNYS
YGESKKA
>gnl|bykdb|A0A0F2KPF3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Azospirillum thiophilum] (length=742 residues).
MGPDFRFILRVLAAHKTLIATIVLALTAMSAFGVSLMKDKYTSEALLLVDNRQVRVVRAEDQALNSITPEDGAILSEIEI
LKSTAVLSQAVADLKLATNLEFNPPPQADETKPFVERATAWTRVQAHAVFGPELPGVVQAVLAHGDDMTKDTQLRETRAA
DSIDGVLDRVRRNLEVGVVGRSRVIQVRYTAREPEIAQKVVDTVVRRYMETRQQMDRDLSTSAVAWLEDRIGTLRKEVAA
ADTKVDAVRFKAGLVKNGTNGLMATTELEQARLRLAEAAATRARAVAQAQTLERSGGNGGSLASPVVAQLRATVAAISTE
LAQLSRQYGPKHPRIQELQARLNEANSSLQQEVRHEIGGVREAANVAIEQENALKGMIAKLEAGYQTMTEEAVPLRTLEA
EAQAKRQLLDSLLGRLEEVQAQQDNRAFPTAVKLVSAPQVPHEPSGPFRLLLLLAGFVASLATAIFIVFGIELFQRRIRT
PDAVRRILGVGTVHIVPHHSTRGSRSRLDQIFQNHPFSLFSESMRALFRNHLADLGPVGSIAVTSARPQDGKTSMSLAVA
QVAAQAGRRVVVVDTDFRRSRIDGLFNLSAKKGLSDWISGTATLDEIVHSSEDAPFAMIPAGRLMPETLDRFNVDGLIHL
MAGLSPHFDLVVFDTAPALAVSDARIVCGAASKVLFVSRWGHTTASDLQAVADLGPIDHSKFVAVMTDVNLKKAASRGYQ
GPYNSYMATKKYYGDTTLRTAP
>gnl|bykdb|A0A0F2KSX9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Azospirillum thiophilum] (length=753 residues).
MATQELQEQPRRHTPETRRGAGSVSYDLSASAASAVRRTTGLLRRHKLLIGMAIVFGTGLAALVAFRMTPLYTAETLIMV
EHRKNTVLNFEGVVSDMTPDISALQSEVAILKSPAFAEKVVTKLGLTKDPEFNAALRPPPPGWLVAMNPRNWIPDSWKQS
GEVPLSPDEIERNQMTSVVNAVLDNTSVRPQGRSYVIAVSFDSEDPRKASQIANTMADLYLVDQLDEKFKASKRATQWLE
ERLGDLRKEAQTTGDAVEKYRTQHGLTVSSTNESTVVGQQLSQLNADYILTRTKRQEAESKLRDVTAMANSPRGASAVGE
VLGSPLIQALREREVDLQRQIADATNRYGNRHPMLQALQSQLRDLQGQIRADVGKIVANLGNEVEMAKGREQALKASLDQ
AEARQNEQQQATVGLRTLERDASTAQAMYESLLTRSQQIAAQTDMRQPDARIVSEASIPLDPSQPNRKLILLLALVASGT
IGVLLAMLRERSDGGFRSPHQFELATGVRSLGIVPRIPRFGGAPASYIVDKPVSAFAESMQNLRTSLLLANPDGRHRVIL
FSSSVPGEGKSSVAAAFARTCANAGQRTILVDCDLRRKCLHEMLGLSNDRGLSEVLAGTVALEEAIQVDPRTGLHVISAG
HGRALPQDSLGSSGMHQLLSRLSVNYDRVVLDSPPVLAVSEGKLLAALADQTVFIVRWGLTKRGTAMAGLKEVVEAGGEV
VGVLFSQVDARRHAQYEFPDSGRYHGYRRYYAN
>gnl|bykdb|A0A0F2N9I0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfobulbaceae bacterium BRH_c16a] (length=744 residues).
MQNYQVQDRFRDDDVEQEVNLRDYFLIVWKRKFIVLTILAVVFLFTAISTFKKIPVYTSAAEVLIERNRGSSGLESQYYS
YDPDFLETQSAIIKSAKVARRVVESQKLATTYRTYFFEDNTSSSSFLASIKSEISGFIRKLLVREDNTEKGEGDGGSIEA
GLRGEPLTDEDIIAMMIQGGLAVQPVNNSKIVSITYTHKSPAIAKLVADAVSQAYIDELLDMKLTTSRYALQWMTAKADE
ERKKLEASEKAMQQYMRDNDLVTVENRLAISPQRLTEFSSQLSKAQADRKALEDISRQIDLAGNNVFQLENIPVFAENAV
LKSLRETIFKARQNITELSKKFGAKHPLMIKANDELGQLLTQQQAEINRVVATTKNSFELAKSNESNLQELLDTTKSELL
NLNERFIQFSIMKRDVDANRVVYEALTSSIKKEGVTEQSQSVNVWILKNAFLPGAPSHPNKKRSLALGLILGLMGGIGCA
FLIEYLDNTVKSEKDLETRYGLTVLGSVEQLKEKGSNIESHIVRKPLSPLAESYRLIRSGLLLSAAERPPKTILITSMNA
QEGKTTTTINIARVLSQGGKKVLIIDCDLRRPRVHSVFAMQNDKGLSNFLTGNLQENIIHKIPGEEIHVISSGPIPPNPS
ELVSSRKLQSLVAKMAENFDFVLLDSPPVQSVADSLALTRIVDGTLVVVRAGVTTYDMLQGGLKKLKDVQCHLLGCVLNG
QSKRNASGSSYYGYTTYYAKDSEA
>gnl|bykdb|A0A0F2Q970 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas sp. BRH_c35] (length=738 residues).
MTTMPRPIYETKEDKDIDLAHLFDTFINNRLLILGITGFFAALGIAYALLATPVYLASAMIQIEPKNGLPSLTDVVNTNP
PVSPAQTEIALLKSRSVVGGAVASLNLDIQITPHHFPIIGGFMARRFEPSEEGELGWHPAGLGAYAWGGETLKVTQLEVP
DKVHGKELTLEAAENNGFILRDKDDEVVVQGVVGEPVETEDYRVTVAELNARPGTTFTVVKNRTYNTTESYQQRLSAAER
GKQSGIVNVTLEDPNPEHAIRVLEEVASRYVDQNVARNAAEATQSLEFLNEQVPAVRKKLEAAQTALNKYQTGSGSVDIT
AETQSVLDRIVDLEKQISEQNLKRTEMERRFTRQHPNFQALMNQINQLQMQKEELEKQIGTLPSTQQELLRLTRDVEVSS
ETYSMLLNKTQELDIIRAGTVGNVRIIDHAAADLENPVKPNKPLVVIVATLLGALLATAFVYVREALKRGVENPEDIERT
GTPVYASIPFTDKQAALEKRLANFKRDKSTASYLLTINDPADLATEAMRSLRTSLHFAMIEAKNNVLMITGPSPAVGKSF
VTTNLAAVVAQSGKRVLLIDADMRKGYLHKVMRCDGDKGLSDILSGRITLFDAIQKTQLNNLHVITHGQLPPNPSELLMH
ENFSRFVKEISHMYDLVIFDTPPILAVTDAALVGSQAGTTLMVTRYALNGVKEIEAAKRRLEQNGLIVKGVIFNAVVRKA
STYGEYGYYQYEYASTSK
>gnl|bykdb|A0A0F2S023 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhodospirillaceae bacterium BRH_c57] (length=792 residues).
MNAIIGETRNQGPAEQRFAQTSTNALDDVDMMDVGRRLWRRKWLILAVALVGTVGTAFLLNRMTPQYQAHSLVMISGQNS
NILNLEAVVAGLPNDVQTIETQTEVLRSRQLVEKVVLDLNLDQQPEFNPALREPSTFARNLATARSYVLSLLPSFTDEAQ
AQDMAPNAAQPNVAQNVTGATPPVTEPPVDDLRPGNAVLEEARARRGEMNRVVDIFLDRLSIKQRGESQVIALSFQSASP
VTAAAAANKLADLYIVEQLEAKFEATQRATSWLNERIENLRRRVENSERAVAEYRQVNGLLVSNTGTPLVSQELSDLNSE
LTIANIRRAEAESRLRQVQEIVRRGGQESYSEVLSSALITSLRQQQSGLQRQLADLSGELGAQHPRMRSLRAEIADLNRG
IRGEVAKVIQGLENEVNVARARQETLQRNLNELKGEVAQANEASVVLRSLEREAQSNRMLLETMLARFQETNQLDEPDMQ
QPDARVISYAEAPEEPSSPKYNLLLAMAFVGFTSIGGLSALALEQMDRTYRSGEQLEKDTGLPVLGLVPLVRGFIRLGRK
PENQVLEKPNSLFTEALRGVYTSLLLQPGQSLPKTLMITSARPMEGKTSLSITLTRLLAMSGRRVLIVDCDLRKPKVGER
FGLEPDAPGVIDVIDGKVPLTDAMHKDEASGAYVLPAGRIRPSAPDLFGGELIANLLKSISGSFDQIIIDSAPILAVSDP
RLLSRQVDGAIMVVRWGDTPRNLAKLAIKQFINAGGTFSGVVLSMVDVKKNRTYGYEDSGQYADKTMSYYRS
>gnl|bykdb|A0A0F3KMI2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Luteibacter yeojuensis] (length=719 residues).
MMTTTDQSRDTDTLDLNALFGTLLDHKWVIVAVTGAFFILGVLYTVIATPIYQATSVVQVEQKTPALPGLSDLTQSLGTT
ASQATTEIALITSRLVIGTAVDELRFNVQVDPQRMPLLGDYLSRGHKPGDLGKVRFGLSRYGWGGEVVDIFKLELPDNLL
NHKLELRAGENHQFTLLDDNDKVIAQGAVGQLVKAGDVTVQIRQLIANPGARFDVVEQPPLTTINKLQTDVTALEQGNDS
GIIGLTYNNADPVLAQALLDHITRAYVRQNVERNSAEAASQLKFVKDQLPKVRTELDRAQGALNAFQTQAHTVDISMQTK
GLLDQIVSVENNIQQLQMQQADIDRRFTHDHPAYQALQQQMGTLQAQKAAMEKQVGGLPDTQQELLKLNRDVQVSTNTYT
SLLNQAQQLDIARAGTVGNVRVVDQSVVDINQPVQPRKLLVVVIATVLGGFLALAYIFLKQILNRGIENPSVIEDLGLPV
YASVPLSKTQTGGRKGLLAINEPADLAVEAFRSLRTSLHFARLEAKNNILMITGASPFAGKTFVSANLAAVIAQAGQRVL
LVDGDMRRGTLHQQLGIRAGDGLSDVLVGKQPLDAVMKKDVVPNVDFVSRGQVPPNPAELLMHENFTQFIESVVAKYDLV
IIDTPPILAVTDAAVIGHHAGTSLLVARFGLNKAAELALAQQRFEYNGVELKGAIFNAVEHRAAGYSTYAYYKYKTEPT
>gnl|bykdb|A0A0F3LCB0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Brevundimonas sp. KM4] (length=730 residues).
MTYHDTAIGSPGQPADDAIDLHALIAAFRRRLGLFIAVAAAVCLIVLALMLGQPPVYTATASLQINTRKEQVVAGQAVLS
ALDAEAAIVDTEVEVLKSPQLAAQVVQTLGLIRDPEFNARLRSSPLTQHLSRATPAPTNAEIERQQVIDAVRRRLTVRRV
GLTYSMAISFTSEDPTKAARIANAFAGAYLQSQLTAKFDANAQANTFLGARLEDLRRQVEAADAAVSAYRIENGLLSAQG
ATLTEQEISAYNQQLALARAQQAEQDARLRTARAQMAAGSNGDDVGEALSSPVVQNLRGQRAAISTRVADFSVRYGPLHP
DMIRARQELSDIDAQIQAEIRRVVSNLDAQAQVARQRAASVQSSLDAARAALADNNVASVRLRELEGEAEAARAIYRAFL
DRYRETSAQTGVEQADARIVSRATPPTAQSAPNLMISLALALLLGTAAGTGAVIIANAMQTGLSGPDDIERRLGVGAVGA
VPLASSVAAAEDQTLHPIDLVVQRPLSVFAEAFRALRTSITPIVSVVGEPSARLVAVTSALPGEGKTTTAVCLARVAARS
GGRVLLIDGDPRRRGVTRMLGLNPDHGLAEVLHGAAAWRNVAVLDPVSGAQVLPLSGSGLSADDLFGAPPMTALLDELRQ
AFDLIVIDTAPVLVLADARILAAKADSVVLLARWRKTPARAVAAALRILHQAGASPLGVTLSQVDVRAQAGLGYGQADYD
YRAYRKYYAA
>gnl|bykdb|A0A0F3LM14 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Brevundimonas sp. KM4] (length=742 residues).
MLPAAGTSSSAAESRPLFGQDGDGLIDLRRLWHILLKRWWILAGVLAVALVLGVVITLLSTPIYRASATLQIDREAAQVV
DVEGVLPAEGMYSAQEFYQTQYGLLKSRSLAQRVVTGLRLAQDAQFIEANRRSPANAQPRSDEDGGSPAERNRQAVSQLL
ANLRVTPTMNSRLVTISYDSADPALAQAVVNSITETFIATNLERRFEASSYARRFLEERIEQLRARLEESERELVAYASN
QQIINIPSASATSDGNANRGRSLIASSLEALNASLAEARTTRIEAEERSRAAQASTGLGLSEVLSSPTIQALREQRAELT
ARRQELLERFQPEYPSVQQIQAQITELDRQLAAEAGDVRRSLQGQYASAAAAERSIQGEIDALKAQALDLDQRSIRYNIL
QRELDTNRTLYDGLLQRYREIGIAGGVGTNNVSIVDRADLPVNPVAPRPLINLALAGLLGLLLGAAIIFVLEFLDESLRV
PADVEAKLNLPLLGSVPWLPSAAALAQAERDPRSGFSEAYHSVRSALQFARPGGMVRTLLVTSAQPAEGKSTSSVAIARA
FARMGKSVLLIDGDLRNPSLHKMLGGNNRAGFSSALAGSDLNDLLQPTEQEHLTLLPSGPRPPSPADLLSSQALPDVLGR
LAEHFDLVIIDGPPVMGLADATLLGNASEGVLFISGAGIVRRGTALRALDRLRGAGADILGGVLERFDSKRANLGGYGYE
YTYAYDYGMEETPGAKARRRKR
>gnl|bykdb|A0A0F3M0G5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pantoea sp. BL1] (length=723 residues).
MNIKNKVMTAPKEDSSGWDLAHLVGQLIDHRWIIVAVTAFFMLAGTLYTLFATPIYSADAMVQVEQKNTASVLNELQDVI
PTTPASDTEIQILESRMVLGKTVNDLGLDTVVEQNYFPVIGKGLSRLMGNKPSEIAISRLEIPRTIDKRTVQLEVTGPQT
YTVTSEGDELFKGRVGQLEQHGDVTMLVSGIQADEGTSFNVTKLTDLQAIRAVLNALTVADKGKTTGVLGLEYQDEDPVR
ASKVLNQIVNNYLLQNVDRKSEQAEKSLEFLRNQLPQVRSSLDDAENKLNAYRRQNESVDMSLEAKSALDSSVSVQSQLN
ELTFREAEVSQLYTKDHPTYRALLEKRKTLEDEQAKLNKKIAGMPQTQQEILRLTRDVQSGQEIYMQLLNRQQELGISKA
STVGDVRIIDGAETAGSPVAPKKMLIIAASFILGLIISVGLVLLKALFHHGIENPEQLEELGMNVYASVPLSEWQRKKDT
EALARRGHKEKSDPHNTLLALGNPTDLSIEAIRSLRTSLHFAMMEAKNNILMITGASPGIGKTFICANLATLVSKAGQRV
LFIDGDMRRGYTHELLGSENKMGLSNVLSGKSEFSPAMIQKGVYGFDFLPRGQVPPNPSELLMHRRMSELLDWASKNYDL
VLIDTPPILAVTDASIIGKLAGTSLMVARFETNTTKELDVSYKRFAQNGIEIKGVILNAVVRKAANSYGYGYDYYNYEYK
QKV
>gnl|bykdb|A0A0F3SVD9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=726 residues).
MTTKNMNTPPGSTQENEIDLLRLVGELWDHRKFIISVTALFTLIAVAYSLLSTPIYQADTLVQVEQKQGNAILSGLSDMI
PNSSPESAPEIQLLQSRMILGKTIAELNLRDMVEQKYFPIVGRGWARLTKEKPGELAISWMHIPQLNGQDQQLTLTVGEN
GHYTLEGEEFTVNGMVGQRLEKDGVALTIADIKAKPGTQFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDDPQ
LITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDNQL
NELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISK
SSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEHGISVYATIPMSEWLDKRT
RLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSD
QKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLDWANDH
YDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGY
SYSEKE
>gnl|bykdb|A0A0F3ULZ3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQSSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDDK
NYTLSSDGGFSARGQAGQMLTKEGVTLMVEAIHARPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDQDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGVKRYKQSQLLALGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A0F4BG42 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Enterobacter chengduensis] (length=720 residues).
MTEKTRPSAAPTSGSDEIDIGRLVGTVIEAKWWVLGITAVFAAAAVVYTLFATPIYSADALVQIEQNTGNSLVQDIGSAL
ANKPPASDAEIQLIQSRLVLGKTVHDLGLDISVTKNTFPVFGAGWDRLMGRNNDTVKVTDFVLPKGAADRTFTLTVLGPK
QYQLTSDAGFSARGEVGQMLSKDGVSMMVSAINAQEGGEFTVTKFSTLGMINNLQNNLTVTENGKDTGVLSMTFTGEDKD
QIRDILNSITRNYLEQNVERKSAEAAKSLAFLAKQLPEVRAHLDDAENKLNAYRQDKDSVDLPLEAKSVLDSMVNIDAQL
NELTFKEAEISKLYTKRHPAYRTLLEKRRTLEEEKAKLNDRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITE
ASTVGDVRIVDPAITQPGVLKPKKALIILGSIILGLMLSIVGVLLRSLFNRGIESPQVLEESGINVYASIPLSEWQKSRD
SVKTIKGVKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAKNNVLMLTGVSPSIGKTFVCANLAAVVSQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILLGKGDISQSAKPTTVPKFDLIPRGQVPPNPSELLMSERFTQLIEWASKNYDLVL
IDTPPILAVTDAAVVGRHAGTTLMVARYAVNTLKEVETSLSRFEQNGIEVKGVILNSIFRRATGYQDYGYYEYEYKSDSK
>gnl|bykdb|A0A0F4BGS6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Enterobacter chengduensis] (length=726 residues).
MSSSKSENYSAAMPQHNEIDLLQLLAEIFDHRVTIACVTLLLTVCAGIYAFSATPVYQADALVQVEAKQNNSLLKNLTSF
ESDLSPDVAPELLLLKSRMILGETVDQLGLTYSVKRRVFPVIGPLWEKVLGRQPDKITIGALTIPLLEGKPQTLLLTVQE
QGRYRLEGETLEADGVVGKTLVKDGVSLLVTSLSAKAGARFTLKTVSRLDAINAIQDRLTVVESAKQSGMIALTLTGEDP
GRIAAVLNTIAENYLSQNIARQEAKDSRSLTFLQGQLPKISRELDEAEARLNAYREQRDSVDLSLEAKSILDQVVNVENQ
LNELTFREAEVSQLFKKDHPTYRALREKKQTLERERARLNNRVSSMPSTQQEILRLSRDVESGRTIYLQLLTRQQELSIS
RSSAIGNVRIIDPAVTQPAPIKPRKAAIIILGMMMGFILSAGTVLVRSAFKRGITSSEPLEAHGIPLLATLPRSVWLWKK
THLRRRNLFASYWKHRTSNIPFLPVDRPADMFVEAVRGLRTSLHFTMMDAPNRIVVVSGPTQDCGKTLVSTSLASIAAQA
GQRVLFIDADMRKGYVHNVFKLSNHHGLSSVLGGAVAWQEAIQRVEKGGFDVLTCGPQPSHPVELLMSERFQAMMAGIDK
RYDIVIVDTPPVLAVTDALLVARAAATTLLVARYGKTSVKEVENCLKRLAQMGVQVNGTIFNDIVKSAALYYSSGYSHYD
YGYTQE
>gnl|bykdb|A0A0F4FLQ7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhizobium radiobacter] (length=797 residues).
MLGFPRTIFNSQGRSMHHKTFKSNIGFPESGKDSDTFIDLDRLWAAVVRRANVIAASVIAAVVLAGLYLVLATPVYTAMT
QVLLDESLSRYAEEESPVPAAQIVDNRIASAVEILKSKEMALTVVDKAKLDENDTIVNPPMSPVELVKSSVRGILDLVLP
GDPPVSEAAIRAGRREKAAAMLQQSLAVERVGRSSVIAISTRSTDRQLAAQIAKTYAQAYLTEQLNANFDASERASVWLQ
ERMTDLNQRAQAAELAVQKFRSDNNIVSSRGELMSESQLADLNGQLIAAQADAATASARYSQYKSIIDRGPETAVDNAVV
SARDTDNSVIQDLRKRYITISDRQRGIVQQFGADHPQATALDAEKKELSQQIFQELQQLTGSFKNEFDVANSRVQSLRDN
IDKVAGRNSEANITMVQLRELEQRATALRTLYQSYLGRFEEASQKQSLPIAKARIISEAGLPTSPSSPKKTMTMALSVIL
GLMLGGGIAALLEFRDRFFHTGNDVRDNLRMRFLGYLPFIGERGVENAKAGTSAATPGGENATLDESGQVSFQKMLRLAV
DSPRSSFAETLRNVKLTADVVIQERQCRVIGVISCLPNEGKSVVALNLAGLIASTGKRTLVVDADIRNPGLSRMLTTRQS
AGLVEVVLDEVPWTQAVKVDTRTKMGILPVSTSNQFAHSSELLSSSGMRKFIDSAREACDYIIVDLAPVVPVIDAKAFAP
QVDGFVFVTEWGKTPIQMVQNLMANEPQIANKTLGIVLNKTDMTELQRYAGPGGSEHYHEKFSAYYGDAKPPVKEDA
>gnl|bykdb|A0A0F4P3F5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio neptunius] (length=734 residues).
MENTQNPPVSKEELIDIRQYFKVLLNYKWRIAIFALLVTAITVLVVLSLPSKYTARATLLIESQQANIISIEDFYGLDTK
SQEYYLTQIEILKSDRVSEEVIRRLDLANHPEFDPRSKEKTEASLKDRLIEWFPVLQAFRKSLPEQDIGKSEYARNKLVL
YKFKRGLAINPIRKTQLVQISYTSKDPELSAQIANEIGRVFMDSNIEAKIEVTRQASSWLNERIGDLREKLRQSEAQLQA
FLQAEGLVDIQGVESLASQELAELTSQLNKARDRRVASETLYQVARNYKSDSSQLSALASVPEISNHPTIRDVKVAEVQA
ERKVSELSKRYGPKHPKLKAAMAELESVKKNLSSELNQLLNGINNELKAAKQAEKTIRSELENRKVEFQDLTVKNAKYSE
LKREVQTNRELFDLFLSRQKETSASSDFNANIARFTDYASPPLAPSKPNRKMIVILAFLASLSFGCVMAFVADAVNDTFT
DIKQVSKQLSLEILGIVPSLKTKRPLDGKAYFDERNRQLTEAIRTVRTGYLLANSNKSSSVLMVTSSQPDEGKTTSALNL
ALSLAQMEKTLLIDCDLRKPAVARRFGLPSAQPGVTNILTKTHVIEDCIYRDEESELDVLAAGTYTNNPLELISSSGFTD
FIEQLKTKYDRIIIDTPPCLAVSDAFMLSRYVDSAVIVINASHTRTKTVRDVVGKLAQQGTRIDGVILNKLNVKKASAYS
GYKQYQSYYGVENV
>gnl|bykdb|A0A0F4P5T2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudoalteromonas piscicida] (length=744 residues).
MNAQPNLISNQNSSKEETQEIDLMALVGALLDAKFFIAGITALFMLLGIAYAIFSTPIYQATAMVQVEEKGGSVPGFDDM
SGMFESTSAAVTEIELLKSRSVIGEAVDTLNLDTVVEPKLFPLFGSRSFRKFVAQSEGEVAEPSLGASSYAWGGEKVEIH
RFKVPSSAIGTSFILQARTDESFALLTSDGDEVLAGKVGEEVKQGQFELTIKTLIARPETEFSIVKRNRLQTILDLQSAI
SASEKGRDSGIINLALQNKEPEYAERVLDRVAGIYVRRNVERNSAEAQQSLEFLEIQLPEVKRNLERAEKAFNDYQIRQE
SIDISLETQGVLEQIVKLETKLQELELKRLELGRKFKREHPSYRGVVEQIDTVKRQRNELAGEVQGLPETQRELLRLKRD
VEVNNEIYTLLLGKTQELDIVRAGTVGNVRIVDYAEVNTTQPVKPKKALIVVMATMLGGMLAIAIVLVQKALHKGIEDPA
EIEALGLPVYASVPFSEYQVKLTGFAKARKGKTAKAKSILAVDNPADLSVEALRSLRTSLHFAMLEAKNNVIAISGPSPG
VGKSFITVNLATVLAQSGKKVLVIDGDMRKGYLQTQFGMKWDEGLSDYLSGRLNLAQVIKPSQVEGLQVMTRGQIPPNPS
ELLMHENFSKLIGEVSKMYDLVIVDTPPILAVTDPAIVSAHAGTTLLVTRFGQNHVKELEITRNRFEQNGIDVKGVVFNG
VVRKSTNAYGYYGYYNYEYKSDKA
>gnl|bykdb|A0A0F4Q6N7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudoalteromonas ruthenica] (length=737 residues).
MKTATRNTGAAEVVTLGYYLKVINKFKWRIALLAILVTTLAMVWALQLTPSYRASATLLIEAQQRKAVSFEEVYGLDASK
KEYYQTQYEILRSRAIARDVIEQLNLLEHRDFQPKPSMLSWVMNDIKQWVKQYIPQKPQTLPSTADAQQAYEKRMQKIIT
AFSRRLSIHPIRKTQLVVIAYESSDPALAADVANAVGEAYITHAMQAKMGIAKQASGWLNDRLSILRERLDKSEQKLQSY
REREDLVDIEGVVGLVRRELEQTAQQLVEAKRNQSELNAIMRVVDEYGRDDIARLESINEITTHKVIQDVKREVVTAQRK
VSELRQVYGPKHPKMIAARAELATVQENLSAQIRSLVMGLEKEMRTANSTVSALQQDVEQLRQRFQMLTRKETEYHQLKR
EVETNRNIYDTFLSRSKETEVTSDFNSPIARFTDYAYQPTNPAKPNRKLIVVLAFVATLGFGIVLAFLTDALNDTLNNAE
EVENKLGQRLLGVLPSLPSSKRKPLPTHTFFDKGKLAFAEAVRTFRTSLVLSQMDRDNQVIEVTSSVPGEGKSTTSINLA
FSLGQMEKVLLIDADMRRPSLAGRFSLPAYQPGLANVLANTQQLEECIHVDEQSNIHVLCAGQIPSNPLELLSSENFKAL
LAHLRQQYDYIVLDTAPLEAVSDALVVSQHSDSVIYVVKSGSTRQGLVKAGLHRLIDAKANICGVLLNQVNGKQKQGHNA
HYGYYDSHGYTQANAPT
>gnl|bykdb|A0A0F4QGL3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudoalteromonas rubra] (length=745 residues).
MNAQSNLLSGVQSKQATQQAQEIDLMALLGALLDRKLFIIGVTALFIIMGGAVAIFSTPVYQATAMIQVEEKGGSVPGFD
ELGGMFESTSAAVTEIELLKSRSIIGEAVDSLKLDIVAKPMLYPIIGGRAFRNFTPMQVGELAEPSFGASSYAWGGEVID
VFKFEVPNYAIGQEFTVVTLANNQFELLHNGDERILQGKVGEEVSNGTFSLTLKTLIARPGTEFILVKRDRLNTILDLQA
AIGASEKGKDSGIIDLTLQNASPNYAETVLNTVANIYVRRNVERNSAEAQKSLDFLEYQLPQVKKQLEAAEQRFNDYQVK
QQSVDISLETEGVLKQLVKLETQLQELELKKLELGRKFKQGHPSYQAALEQIEAVESQKRRLAAEVQVLPETQQELLRLT
RDVEVNNEIYTLLLAKTQELDIVRAGTVGNVRVIDLAEVNVSKPVQPKKALIVIMATILGGMLAIAIVLIQKAIHKGIED
PSEIEALGLPVYASVPYSEYQVKLTGFAKARKGKTAKAKSILAVDNPADLSIEALRSLRTSLHFAMMEAKNNVIAISGPS
PGVGKSFISVNLATVLAQSDKKVLIIDADMRKGYLQTQFGMQWDNGLSDYLSGRINLEQATKQSQVEGLDVMTRGQIPPN
PSELLMHENFSKLVDKVSAKYDLVIIDTPPILAVTDPAIVSAHAGSTLLVTRFGQNHVKELELTRNRFEQNGIDVKGVVF
NGVVKKASNAYGYYGYYNYEYKSDK
>gnl|bykdb|A0A0F4QLY7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Halomonas sp. S2151] (length=754 residues).
MTQMSRLPSAPGREDIDLGRILGLLLRHKWWILAVTLLFGAAGYVSALLKPPIYEGDALVHVERRASVSPLGDLATVMGE
EENTSAEVQILRSRMVLGRVVDRLALDTQVSPRRLPLVGDYLVREGVTREDLAELGWMTAPLGWLERLMPEAWDLSHLVW
AGESLQLARLEVADSYRGAAFRLVAGRDAGYQLFGPDGDLLGVGRVGDTARFDGGDVVLSVREMTAAPGAEYSLSKRPQV
SAIDSLLARLTVTEQGSGSSASTGMLRLTLTGTDIDRVRESLDVLAETFLMQNVERQSAQADQSLAFLDEQAVALKASLS
SAEDRLNAYRVEVDSIDLDSEAASVVEQLISVEEQLNTLDFQEAELVQRFTRNHPTYQALMRQRGILNQEKARLEERVSE
MPESQQEIVRLTRDVEVTQAIYVNVLNRAQEVAVAKAGTIGNVRVIDDAYVDDDPVAPNAGLMMALATVIGAFLAVAVVL
VRGMLNRGIESPDQLEDLGLPVYATVPLSEFQQRLVKRVKYRSDRRSQPVIKGLLALTQPTDMAIEALRGLRTSLHFAMM
EAPNNCLMITGPSPEIGKSFISLNLGVICAQAGQRVLVIDADMRKGHLHSAFGAKAESGLSDLLSDKSEVAEVIRQTEVE
GLDYLSRGACPPNPSELLMRERFTTLMEQFSRDYDLVIVDTPPVLAVTDAAIVGNRVGTSLLVTRFKLNPVKEVRVALRR
LETSNVRVKGCILNAMDPSARHGYGYGHYVYAYQ
>gnl|bykdb|A0A0F4R191 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Marinomonas sp. S3726] (length=728 residues).
MSNLPLLDSAKSSNEEFDVSKLFSILMNNIWLIVFVITLFGGLGVANAILPTPIYKADALLQVESKNSGMSALVGEMGDM
FSNESTSTTEIEIIKSRMILGKTVDKYNLTIVATPIYFPYFGKGLSRLTDDKKDISVSLFKLGNNKNTAYKITLIDNLTG
EYQFEDIESGELIFKGKVGEIVNAKGFSILVSSLQGVEGDEYTVGHRSRFDTIQWLKGSLSVSERGAQSGILSLSFIGED
KELIQKILNDVSQNYFLQNVQRNSAEAQKSLDFLHGHLPNIKSELMSSEDILNKFMQENESIDLSMEAQSTLNLIVDLEG
KLNELVLQESEISNRFTKDHPTYQALLDKRKVLESEQKKINNQVKKLPRAQRDVLRMKRDVEVNQQIYIQLLNKSQELNI
LKAGTVGNVRILDDAKVYSSPIKPRKTLIVFLTTMVGVAVALMIVFLKEIMHKGIESPDEIEEIGLSVYASIPMSNFQTG
MDIKSKRKNGKNHKRCSNLSLSETLLAVANPADLSIEALRGLRTSMHFAMMEAKNNIVMISGPAPGIGKSFVSVNFAAVM
AKTGQKVLIVDADLRKGYLHQKFGLHWTNGLSDFLSGKEDLSSIIKKTEIDSLDVITRGQVPPNPSELLMNDRFSNFIDQ
VSNQYDLILIDTPPVLAVTDPSIVGAFAGTTLMVGRFGVNTSKEVEVARHRFLMAGVEVKGFILNAVEKKASISSGYGYY
NYNYESDT
>gnl|bykdb|A0A0F4TYX7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas fluorescens] (length=742 residues).
MQLPSVIGTRDNDQDSIDLLGIFGSLIDQKWLIGALTGAFMATGVAYAVLATPVYLANALVQVEPKKNDMLGFSDLNSML
GGQSPSVTEIGIIKSRAVIGKTVDDLRLDIDVTPNTFPVIGGFLARRYRGETEFSVAAPRLGLNSYAWGGERLEIARLNL
PKELLGKKLTLIAGEQHRFQLFDENDSLLVEGVAGEAFKQDEVEGQIAQLSANPGTRFEVVRNPRIVTIQSYQDALDISE
QGKESGIIRLALASSDAAEAVKILNKIASLYVQQNVQRTSAEAAQSLEFLQGQLPQVKRDLAKASDALNGYQTRGKTVNI
SLETQSVLEQVVSLDTRISELKMQQAEMDRKFTKQHPAYRALMTQIGELTQQQKVLEGKAQDLPATQQELLNLTRDVEVA
SQIYTQLLNKSQELDIVRAGAVGNVRLVDTADVDLTSPVKPKKALIVLIATFLGAFFGVALVLLRKSLSRGLEGPEAIEQ
LGLPVYASIPYSALQQEEDGKKVRAKDGTDKPAYLLALRNPTDLSIESIRSLRTCLHFAGLDSTNNRIMISGPSPQVGKT
FVSSNLAAVMAQSGQRVVLIDADMRKGHLHKTLNTPITNGLSDLLVKRCSIEQAINRVEVDNLHFISRGQVPPNPSELLM
HANFRELLAQLSELYDVVIIDTPPLLAVTDAAIVGREAGISLIVTRFGVNPAKEIELTIRRFAQNGIELKGAVFNGVEKR
AASYYGNGSYGYYNYEYASDKS
>gnl|bykdb|A0A0F5AMX4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Salinivibrio sp. KP-1] (length=716 residues).
MNQNIKNTSSSDDEIDLSKLLGHLIDGKWIIVACTFLFAVAGVAFAILATPVYKADALIQVEQKEGGMSSLLGEGASELF
ASESSASTEIELIRSRMVLGQTVDKYNLTTVASPDYFPVVGKGLARLTGNQNQIAISRFDIPQDYERQPFRLTVDAREQY
SLYNSEDDLVLQGKVGEAAINEAFHLFISELKADEGESFTISKISRLRAIKAIQDELSVSERGKQTGILSLSYQGEDKVL
IENVLSDIAQNYFMQNVKRDAAEAEKSLEFLKGHLPGVKAELTAAENKLNKFRQENDSVDLSMEAKASLDTMLSVEKQLN
ELTFKESELAQKFTKEHPAYLALLDKRQTLLGEKKRVEQQTQKLPKTQREVLRLRRDVEVNQAIYVQLLNKVQELNIMKA
STVGNVRIIDDAQTFELPVKPKKPLIAVIATLLGGMIGVGVVLLKAAFHRGVENPDDIEAIGLPVYASVPLSETQQEIEK
KRQKKALHSASDSLLASANPADLSIEALRGLRTSLHFAMMEASNNVLMFSGPSPGIGKSFVSANMAGVLSKSGQRVLVID
ADMRKGFLHQQFSMKADNGLSDYLAGKRDTDAVVQKNVLENLDVMTRGQVPPNPSELLMHPRFNQLLDWASAHYDIVIID
TPPVLAVTDAAIVGAHAGTTLLVGRFSVNPIKEIEVTKQRFEQAGVNVKGFVLNGVVRKAASTYGGNYGYYNYSYQ
>gnl|bykdb|A0A0F5F616 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pantoea anthophila] (length=725 residues).
MNIKNKVRTAPGEESNGWDLAHLVGQLIDHRWIIVAVTAFFMLAGTLYTLFATPIYSADALVQVEQKNASTVLNEIDSIL
PPTPASDTEIEILESRMVIGKTVDDLGLDTVVEQNYFPVIGKGLSRLMGNKPASIAISRLEIPRTIDKRNVELEVTGPQS
YTVSKDGDELFKGKVGQLESHGDVTMLVSEIHADEGTSFTVTKLNDLQAIRSVLSNLTVADKGKDTGVLGLEYLGEDPEQ
ISKVLNQIVNNYLLQNVERKSEQAEKSLEFLRTQLPAVRSKLDDAENKLNAFRRQNESVDLSLEAKSALDSSVSVQSQLN
ELTFREAEVSQLFTKDHPTYRALLEKRKTLENEQAQLNKKISGMPQTQQEILRLTRDVQSGQEIYMQLLNRQQELGISKA
STVGDVRIIDSAQTANAPVAPKKMLIIAASLILGLFVSVGLVLLKALLHHGIENPDQLEELGMNVYASVPLSDWQRKKDT
EALARRGSKVKTDPHETLLALGNPTDLSIEAIRSLRTSLHFAMMEAKNNILMITGASPGIGKTFICANLATLVAKAGQRV
LFIDGDMRRGYTHELLGADNKSGLSNVLSGKTEFSPALIQQGVYGFDFLPRGQVPPNPSELLMHRRMGELLDWASKNYDL
VLIDTPPILAVTDASIIGKLAGTSLMVARFEANTTKEVDVSFKRFAQNGIEIKGVILNAVVRKAANAYGYGYDYYAYDYG
KTNKS
>gnl|bykdb|A0A0F5FT46 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Devosia geojensis] (length=612 residues).
MDDSEIDIRGILGFLRRRLRLIALTFLVVVGAAGIVAFTLTPIYSAAALILVDPSHKNLLQPEAQLNATSADNARIDSEV
EILRSDSILLKVIASQNLLLNEEFGASAGLRTRLMNLLRLGEPPRPSEEDILNATLGKLRDAFSVQRRGMTYLIAVQARS
QDPEMAARLANAIAGAYIEDQLSAKIASTQASRDILQSRIIEARDAIAASKGALDAFVETHIQPVPEARREAIEPQLPGL
EETSPTALDLRRDVLGSALPAGTLAELYALQQNAEIARSQYQQLLSRSRNLEAQINLQIADSRIVSPALAPQLPSFPNKT
LILALAALGALGFGVALAFLYENLIGGFTTEAQMESVLRFRVASAVPRAKPQPEGGPSDLMVNAPLSAFAEAIRRIRTVV
DQQARAGAAPAGEGGRVIMVSSTAPGEGKSTLSLALARSYALSGRRTLLIDCDLRKPSIHRQLGIEPSHGLHDYLSPSGS
GPMDLISVVSRDQLTDATVIVGARKSDVPTDQLLAGASFGKLIEAARSSFEIIILDTPPIDPIVDGLYVAPFADSIVFVT
KWASTAQNDTRKAIESLTQAKRPETPIVTALNQQDEPKTAYYRKYGGYYQEA
>gnl|bykdb|A0A0F5FVN5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Devosia geojensis] (length=761 residues).
MNAPRLADLKFIDVDRILSVLRRQWRVLALGLAFGIGLGVFYLALAPRTYVSAAQILIDKNLREVVSEVAQPTSAMDLES
EVLNQIEVLKSSRIATAVAQAENLMTDPEFLNPPPSFTRRIKGVVTGLLSPLFGSDDEPPATQATVEEAAGALRANVDVE
RVGRSAVIRVAYETTSPELAHRIANAYALAFVQDQLNADLDATRQATDWLQGRLTELGASQRQATLDVEQFRRESGLTIG
EDQTLSNQRLEALTSQLVLAQAETSRVRALSNQLQTVIDAGPETAGDNVAMLNGPGIDGTEIATIRTRYASIVRRIDEVT
AAYGADHPQIAVLQAERNALNDQIFVQLRNLNEQYRNQLTVAERQENGLREQINAEGRAAAETNQAQVELTELQQRSSAL
GLLYNTYLSRYEESIQRQSFPIPGVRIITDPELPRDPSGPRTLFVLAGAMIFGAFLGVGAGAVNELRERSFRIGSQIANE
LGLRFIGYLPRLNGAGTRRSKKATALQNHRYIRDQVIGRRSNAPTTAFLETLKSAKLMVRKRHRAGRAVTIGTVSVLPGE
GKTTFAVSFAEMLAVNGDKVLLIDADLRQPAASQLVTPDAGLGLMDLAVGVPWRQIARTDAETGLVILPATSSATAATSN
DFLSSPVIQTLLEEVRREFDYVVIDLPPLGPMVDALSIQPWTDGFILVTEWGRTPRRLVRALVENEPQFADEIIGVVLNK
VNFARLGRYSDPGAAEQFVGSYDRYYQVAPAPAPRQKTPAQ
>gnl|bykdb|A0A0F5K4F1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Robbsia andropogonis] (length=744 residues).
MNTPANNVGPTAQGGEQEGLVLGDLIRLFIEQIWWIVGITVVVVVAALVYVEIATPIYSVDALVQVEQPDNTSSPLAQQA
NALSSLSGTTLPTAAEIQVIESRDVLGPVVHQFKMQFGVEPKTFPVLGSLAHLLGGKGHLSRPWFGLKGYAWGGESVDID
DITVPQQLENVPLLLTVGENDTYELRDPNGNLLLKGAVGQTAHGNGVTMLIKQLVANPGCRFTVTRQNELETIEGFGAGV
AVAEQGKQTGVIQISMTGASPDRITALTNAVADSYLKQHIQRKQEDASLMLNFLNEELPGRKAELQAAEQRLSAFQQKSG
TFKPSEEANVYLQGAIDYERQIDTLKLQEADLLQRYTREHPVVKSIEEQIAQITAARDKFQERFKSMPIDEANALSLQRD
AKVSEDIYVLLLNRVQELQIQRAGTTGNVRILDRAMPPATPIKPKKGMIVAASVFLGIILGALLVFGRKQMSSGIEDPDV
IERSMGLPVMGAVPLNAVQVRWDESYKRARDGRRAILAKSLPKDPSVESLRSFRTSLQFALADAPNNLLAMSGPVPGTGK
SFVSVNIATLLAEAGKRVLLVDADMRRGHLNEYFNQPRFPGLSEALTGTLPVEQVVNQTDIAGLSTIWTGAIPDNPAELL
MSPETRNVFETLSNAYDIVIIDTPPVLAVTDATIIGSFAGSSFLVFRHGMHAEREVSGSIKKLTQSGGRVVGAIFNAIPS
RVAKYGKYGGGNYHYVYQYDSESH
>gnl|bykdb|A0A0F5L4Y2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Devosia limi DSM 17137] (length=607 residues).
MDDTDIDLRRVFALLQRQSRLIITTVIAVVTLAGIVAFALPPSFSSTALVLVDPSRKNLLDPDQHASASSSDSARIDSEV
EILRSNTVLLKVIEAVGLTGEGGPAAAPSLRQQVAAFFGLANTSAPDTDPDAALNQTLESLRSAISIKRRGLTYVISIQA
RSSDPVQSAGLANALAQAYIDDQIAAKITRTLASRDILQARVAQARQAVVSAEGALAAFVRANAATGTADAAQANFTLNT
PLAQQQLQQTFTSNLPADILTQTYGLQQSAEVARQQYETLLSRVHDLETQADLQVADSRLVSAALTPQSPSFPNRLLIVG
MAALLGLGLGVVLAVLYENYIGGFTSKAQMASVLRARVATAIPRQREQSDKQSLANLMIAEPLSVFAESVRRLRATLEQS
LRRQADTGTGGKVVMISSAAPDEGKSTLALALARSYALSGRRVLLIDCDLRKPSLHRHLHIEPSHGLMDYLDGDSNDLAS
IISRDSLTSATIIIGAHVSDLPTDQLLTSAAFSRLMEAVRDTFEVVVIDTPPVGPVVDSLYVAPFVDAIVFVTKWASTSQ
IEARQALTSLLDVKLPHAEVVAVINQQDQPRSVYRRKYKGYYAEEAT
>gnl|bykdb|A0A0F5P7H2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. SRS2] (length=738 residues).
MQNEQAAARSLGDRTPAAYDSDSYALPPVIKQYWHTSLRWKWLIAGIIGVALAAGLLSTLLTAPRYTAKAQIEISREQKK
VTNVEGLESDAADRDIEFYETQYALLRSQSLTDRVVKGLNLARREEFFAAHGITLDPEIFGSGGRVPPTASQQAEREKLA
AKLLLANIQIAPVRRSRLVNVSYTSRSAVLSAQIANSWTQQFIGASMDRQLSSTADARTFLEGRLAVLRTRLEQSERDLV
GFASRNNIITLGTTRDAEGKTQVQRTMAATDLEALNAALNIATADRIAAESRAGTSRGGEDSVEALANTTIAQLRQKRAE
AAAEYAKMLVRFEPDYPAVKALRGQITALDDSIARETSRVASSRMMTYREAVGREADLKRQVGGLKARLDDEQRSSIQYN
IFQREADTNRELYDALLQRYKEIGVAGMVGVNNIVIVDRASIPDRPSAPSLARNMALALVVGLGLAVIAILALEQIDEGV
SHPGQIQQLFQLPTLGHVPLTDLEVVASMDDPKSYFSEAYFTIRSNLAFTTDHGLPRSFIVTSTRPAEGKSTTSYALARI
IGRTGKNVLLMDGDMRSPDVHHLIEMPNTAGLSNLLAGDDNVGALIRPTKYKGVSVLTSGPTPPSAAELLSSDRIKALVA
ELQTMFDHVVIDAPPILGLSDAPLLGRAVEGAVLVIQAEGAAVRGIRAALARLRMGNTPVFGTVLTKLKASELAYGYGYG
YGYGYGYGYGERADGQAA
>gnl|bykdb|A0A0F5PHF2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. SRS2] (length=692 residues).
MKGLLPDPGHLWMVFRRHLWLFLGVVGVILALVALRTLTMVPIYTSTTSVVIEPRKNDVIKVQSVVPDLPAGSDIVDTEV
RMITSPTLAMRVATDLSRQGYDIGPIATETQLERSAAALLRRVAVVRAGLTYVIDITASSDNPDMAAAIANTFARQYVAS
QKDAKVGATRSANVWLNRRLTELRAAAGAADAALQNYKIRNGLMSAQGATMAEQEVSALNQQISLARAELAEKQGRLSAA
RAQLSRGGGGADVGASLSSGTVGGLRAREAEASQNLAQLESRYGPLYPEVKTAKSQLADIRAQIQQEIDRILSSLEAEVR
VASSRLGSLQGSQSSARGSLASNSSAQVGYMELERRAEATKLIYEAFLNRSKETAAQEGLQQPDARIASFGAVPALPDSP
NYQIAALFGIFAALFSGFVAVALAEYLQRGVRTKADVERRLRVRYAGAVPTLSSTLNGLRETEAPHDYIVSHPFSSFAES
FRSLRAFVALRSRARALAISSPLPQEGKTTTSVCLARTAALAGTSTVLVDCDLRRRGTSTMLLREPGPGLVEVLTGEARL
DDALVLDEPTGLYVLGTSESPSSAFDPLTPGNLDKLIKQLKERFEFIVLDTAPVLGVADARAVAAAVDSVLVITRWRKTS
INAAETAIELLLDANANVAGLALTQVDIRRYASTGQSDVYGYHKKFSGYYQN
>gnl|bykdb|A0A0F5VIY4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Photobacterium halotolerans] (length=719 residues).
MTVSQQVSVKQTDSDEIDLGKLFGILLDRRWSIIAITFAFAVAGIAYALLATPIYKADALLQVEEKSNGLSALGEMGELF
SNESSSNTEIEIIRSRMILGKTVDKLNLTTLAEPATFPVIGKGLHRLSGSQDSISISRFTIPQAIEEQVYTLVVDDPESG
AYILFDSQEQKILSGKVGELAESGEYQLFVSGLTTEQAGTEFSISKRSRLDTIQWLQQNLTVSERGKQTGILQLSFTGPD
KAQNAAILNDISQNYFLQNVARNSAEAEKSLEFLRGHLPDVKEHLTKAEDELNQFRQANDSIDLGLEAKSTLDVMVTLES
QLNELTFKESEISQRFTKEHPAYIALLDKRKTLLGEREKLNRQVQKLPKTQREVLRLTRDVEVNQQIYVQLLNKVQELNI
LKASTVGNVRILDVAQSYTLAIKPKKALIVVLATLLGGMLAVALVLIRAAFHRGVENPDEIEAIGLPVYASIPMSDWQSD
MEKKQKSKRQLTVEESLLAVANPADLSIEALRSLRTSLHFAMMEAKNNILMISGPSPGIGKSFVSSNMAAVIAKTGQRVL
LIDADMRKGRLEKNMAVTHTPGLSSYLVDQAGIEEIIKQPGVDNLDFIGRGEVPPNPSELLMHPRFKKLLEWASENYDIV
VVDTPPILAVTDPAIVGAHAGTTLLVGRFGQNAVKEIEVTKQRFEQNGIEVKGFILNAVLRTASSHYSGGYYNYSYESK
>gnl|bykdb|A0A0F5Y3L1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pantoea sp. 3.5.1] (length=725 residues).
MNIKNKVRTAPGEDSNGWDLAHLVGQLIDHRWIIVAVTAFFMLAGTLYTLFATPIYSADALVQVEQKNASTVLNELDSIL
PPTPASDTEIEILESRMVIGKTVDDLGLDTVVEQNYFPVIGKGLSRLMGNKPSNIAISRLEIPRTIDKRNVELEVTGPDS
YTVSKDGDELFKGKVGQLESHGDITMLVSEIHADEGTSFTVTKLNNLQAIRSVLSNLTVADKGKDTGVLGLEYLGEDPEQ
ISKVLNQIVNNYLLQNVERKSEQAEKSLEFLRTQLPQVRAKLDEAEDKLNTFRRQNESVDLSLEAKSALDSSVSVQSQLN
ELTFREAEVSQLFTKDHPTYRALLEKRKTLEGEQAQLNKKISGMPQTQQEILRLTRDVQSGQEIYMQLLNRQQELGISKA
STVGDVRIIDGAETANSPVAPKKLLIIAASLLLGLFVSVGLVLLKALLHHGIENPDQLEELGMNVYASVPLSEWQRKKDT
EALARRGNKVKTDPHETLLALGNPTDLSIEAIRSLRTSLHFAMMEAKNNILMITGASPGIGKTFICANLATLVSKAGQRV
LFIDGDMRRGYTHELLGAENKSGLSNVLSGKTEFSPALIQQGVYGFDFLPRGQVPPNPSELLMHRRMGELLDWASKNYDL
VLIDTPPILAVTDASIIGKLAGTSLMVARFETNTTKEVDVSFKRFAQNGIEIKGVILNAVVRKAANAYGYGYDYYDYEYG
KPTKS
>gnl|bykdb|A0A0F5ZTH0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Grimontia sp. AD028] (length=739 residues).
MKLIEPNPASEPARLDLKRYAGVILRYWLPIAVFVASVTLIATILILAITPVYRATATLLIESEANKAVSIEEVYTLDTS
QKEYYQTQFEILRSNHIAEKVIDELGIANIREFNNEVGELSGREKLLGFLYQIGPLQQFLPTPPSPSEMADDAAAREAVL
NKFKSHLTIEPIRNTQLVHVHFGSIDPELAAKVANALGQAYIESNLEARLVATQTASFWITERLTELKDNLDAAELALTN
FLKEEGLIELDDIDQLAGSELTNLSIRVNEARERRVAAQSLFDQLKNNASGSLMTVPEISNHPQVRDVKNAETDAERRVS
ELAKRYGPKHDKMIQAQAQLDSVRERMYSVINNLAQGIEKELNSARQQERALAAELESKKSDYQNISAKRAQYESLKRDV
DSNRQLYDLFLNRQKETTVAGDFDAVNARFTDRATIPQHPSSPQTGKLIVISAAFALLLGIVGAFLADAYRNTIEKPDDV
EEKLGLQHLGYLPRVKAKRFKNAPLDHTIYLDPDEALFSESVRTIRTSILLSLTNSQRNVLAVTSSLPSEGKTTVAMSLA
QSLAKMERTLLIDCDLRMPAIGQRYGMPRNQAGLSNVLVMGMPVTDCIYHDEDTQLDILPAGLLPSNPQELLGSTKFTTL
INQLKQSYDRIILDTPPVQIVSDGLILGRLAGGMILVVKAEATTEKQVNRSISQLVRHDIAIDGVVLNQLSARYAEEKYK
LHYGYYNNNKQDDETLEAS
>gnl|bykdb|A0A0F5ZWP0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Grimontia sp. AD028] (length=742 residues).
MSAHPNETSVHQEQLIDIGYYIHLLKKRWLSISFFTLLCTAIAALVALSITPTYRATATLLIESQQVKAISIEEVVGIDS
RANEYYLTQFEILKSNQVAQRVIDKLQLNQIEEFNPSIGANNEPGYKEQIKDWLRSHPVIDSFFSSKEEMAIDPELEKEA
TNLKILKAFKSRLTISPIRKTQLVRISFDSKDPKLAAEIANAVGYAFIENNLESKLLATDKANGWLNERLTELKQNLNSS
EQALVQFLQRQELIDNSGIAALTSNELQNLTDRIAEATDRRTKTQALYNALKSSPNADIATLSANALISNHPQVRDIRLA
ESEAEKEVSQLSKRYGPKHDRMIQANARLKSVQRRAESLIYKLINGVEKELASAKEQEALLKQELLSKKEEFQSLSVVKS
EYDALKREVESNAKLYDLFLTRQKETSATSDFSAANARFSDHALVPQSPFKPNRKLIVVIALVASMGFACVLVICLDAFN
NTISSARDFENKLGLLPTGTLPLVKAKEYKRNHIDASVFSNSKFAAFQESIDSIRTSLYLSMPKAERKFLALSSSVPGEG
KTTTALNLAQSFASIEKVLLIDCDLRKPSVGIRFGLPNSHPGLTNILVMNASPNDCITTIEGTNLDVLPAGLIVANPQEL
LSGSSFHKLIEELGERYDRIIFDTPPILPVKDAFIVGKLTKGIVLILKANSTSKSVYKHTMSLFTKHQISIDGVVINQVP
QPKKGTHTYSEYSRYAYGNMES
>gnl|bykdb|A0A0F6ACV3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudoalteromonas luteoviolacea S4054] (length=746 residues).
MNAQSNLTTGAQSKQAVSQSSDIDLMALLGTLLDRKFFILANTVLFMMIGVCIAVFSTPIYQATSMIQVEEKGASVPGFD
ELGGMFESTSAAVTEIELLKSRTIIGEAVDALNLDVIAEPKLFPIFGGRSFRNFTPVQTDELADARFGASSYAWGGEEID
VFRFDVPKSAIDVEYTLISHGNGKFGLLDAGGEEFLRGRVGEEVTNGLFTITLRALNARAGTEFTITKQERLKTILALQA
SIGAGEKGKDSGIINLSFQHKNPTYAEDVLNKVAGIYVRRNVERNSAEAQKSLEFLEHQLPQVKKQLEAAEQRFNDYQVK
QQSVDITLETEGVLRQIVKLETQLQELELKRLELGRKFKLSHPSYQAAIEQIDAVESQKKRLGREVKGLPETQQELLRLK
RDVEVNNEIYTLLLAKTQELDIVRAGTVGNVRIIDEAQVNVSSPVKPKKALIVLMATLLGSLLAIVITIIQKAIHKGIED
PSEIEGLGLPVYSSVPYSEYQVKLTGFAKARKGKTAKAKSILAVDNPADLSIEALRSLRTSLHFAMMEAKNNIIAISGPS
PGVGKSFISVNLATVLAQSDKKVLIIDADMRKGYLQTQFGMQWDNGLSDYLSGAITLEQATKKTQVEGLDLITRGQIPPN
PSELLMHENFSKLVEEITAKYDLILIDTPPILAVTDPAIVSAHAGTTLLVTRFGQNHVKELELTRNRFEQNGVDVKGVVF
NGVVKKASNAYGYYGYYNYEYKSDKK
>gnl|bykdb|A0A0F6B3G6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Salmonella typhimurium] (length=719 residues).
MTEKAKQSAAVTGSDEIDIGRLVGTVIEARWWVLGTTAIFALCAVIYTFFATPIYSADALVQIEQNAGNSLVQDINSALA
NKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVTKNTFPLFGAGWERLMGRHNEMVKVTTFTRPETMSGQIFTLKVLGDKR
YQLVSDGGFSAQGVVGQPLNKDGVTMRVEAIDARPDTEFTVSKFSTLGMINNLQNNLTVTETGKDTGVLSLTFTGEDRDQ
IREILNSITRNYLQQDIARKSEEAGKSLAFLAKQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQLN
ELTFKEAEISKLFTKAHPAYRTLLEKRKALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITEA
STVGDVRIVDPAITQPGVLKPKKALIILGSIILGLMLSIVGVLLRSLFNRGIESPQALEEHGISVYASIPLSEWQKARDS
VKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMLTGVSPSIGKTFVCANLAAVISQTHKRVLLI
DCDMRKGYTHELLGTNNVDGLSDILAGKGEIASCAKPTAIANFDLIPRGQVPPNPSELLMSERFGELIAWASSRYDLVLI
DTPPILAVTDAAIVGRHAGTTLMVARYAVNTLKEVETSLSRFDQNGIQVKGVILNSIFRRATGYQDYGYYEYEYQSDSK
>gnl|bykdb|A0A0F6C1P2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli Xuzhou21] (length=726 residues).
MTTKNMNTPPGSTQENEIDLLRLVGELWDHRKFIISVTALFTLIAVAYSLLSTPIYQADTLVQVEQKQGNAILSGLSDMI
PNSSPESAPEIQLLQSRMILGKTIAELNLRDMVEQKYFPIVGRGWARLTKEKPGELAISWMHIPQLNGQDQQLTLTVGEN
GHYTLEGEEFTVNGMVGQRLEKDGVALTIADIKAKPGTQFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDDPQ
LITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDNQL
NELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISK
SSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEHGISVYATIPMSEWLDKRT
RLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSD
QKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDH
YDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGY
SYSEKE
>gnl|bykdb|A0A0F6C647 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli Xuzhou21] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQSSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMEDQVFTLNVLDNK
NYTLSSDGGFSARGQAGQILKKEGVTLMVEAIHARPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A0F6G7S1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia pseudomallei MSHR2543] (length=739 residues).
MVNTQAKHPYADLAVKTDEEDVVLGQMIQVILDDIWLLLGIALVVVALAGLYCYVAKPLYSADAQVRVEASDNTSQALTQ
TQTGAMINSGPPTPPTDAEIEIIKSRGVVAPVVEQFKLNASVTPNTLPILGAIAARLATPGHPGKPWLGLSSYAWGGEEA
SIDSIDVTPALEGKQLTLTAGADGGYALADPDGEVLVRGKVGEREQGGGVTINVSKLVARPGTRFTVVRQNDLDAITAFQ
SAIQVAEQGKQTGVIQISLEGKDPEQTAQIANALAQSYLHQHVTSKQAEATKMLEFLKNEEPRLKSDLERAEAELTQYQR
TSGSINASDEAKVYLEGSVQYEQQVAAQRLQLAALAQRYTDEHPLVVAAKQQLGQLEAERAKYDGKFRGLPATEVKAVAL
QRNAKVAEDIYVLLLNRVQELSVQKAGTGGNIRLVDAALRPGVPVKPKKVLILSAATLLGLILGTSVVFLRRNLFHGIED
PDRVERAFNLPLYGLVPMSAEQARFDAADKGNRVRPILACARPKDLSVESLRSLRTAMQFALMDAKNRVIVLTGPTPGIG
KSFLAVNLAALVAHSGKRVLLIDADMRRGSLDRHFGTGGRRGLSELLSDQVALEEAIRETSVPGLSFIPSGARPPNPSEL
LMSPRLSQYLDGLAKRYDMVIVDSPPILAVTDATIFGELAGSTFLVLRSGMHTEGEIGDAIKRLRTAGVQLQGGIFNGVP
ARTRGYGRGYAAVHEYLSA
>gnl|bykdb|A0A0F6GCJ3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia pseudomallei MSHR2543] (length=746 residues).
MNPNPTGTSTPADSEGDTDFIAVLDILIEGRWLIAAIALGVFIVGVAYAVFSKPVYQADILIQVEDSPDTSAAKSLLGDV
SSLFDVKSSAAAETQILASRLVVSRAVDNLKLFIDAKPKRFPVIGHWLARRSEGLSDPGLAGFGGYAWGQERIDVATFDV
PRAMEGDTFELTMLDARRYRLDGGDLERGAVGVVGRLERIAAKGGPIALRVDAFAAKPGATFVLVRHSRLRTIEALQDNL
DVQERVKQSDVVVASLRDTDPDLVSRALNEIGRQYIAQNIQRKSAEAAQSLEFLNGQLPTLKQQLTDSEARLTKLRDEHG
SVDLTEEAKLVLAQSADAKTRLLELQQKRRELLSRFMPKHPSVVAIDQQIAALDGYRGTAEQQIKRLPALQQQFVRLMLD
VKVNTDLYTALLNNMQQLQLVRAGKVGNVRLVDTAAVPEVPVKPKKALVALASLLLGVLAGCGTAVGRSMLFHGISDPNE
IERRLGLSVYATVPRSDRQRALTERAKRKARALSLLCVAHPDEPAVESLRSLRTALQFAMLDAKNNVVVIAGPAPGVGKS
FVSANLAAVLTMAGKRVLLIDGDIRKGHLNDYLGLARGKGFSELIAGSAQPDDVLHRDVIAGLDFISTGAMPKNPAELLL
NARVSTLIDTFSQRYDAVVIDSPPVLAVADTGILAATAGTAFLVTLAGSTKLGEIAESAKRLAQNGVRLSGVVFNGINPR
LGQYGYGSKYGGYRYVAYEYGAKRDA
>gnl|bykdb|A0A0F6L4Y0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia pseudomallei MSHR4000] (length=739 residues).
MVNTQAKHPYADLAVKTDEEDVVLGQMIQVILDDIWLLLGIALVVVALAGLYCYVAKPLYSADAQVRVEASDNTSQALTQ
TQTGAMINSGPPTPPTDAEIEIIKSRGVVAPVVEQFKLNASVTPNTLPILGAIAARLATPGHPGKPWLGLSSYAWGGEEA
SIDSIDVTPALEGKQLTLTAGADGGYALADPDGAVLVRGKVGEREQGGGVTINVSKLVARPGTRFTVVRQNDLDAITAFQ
SAIQVAEQGKQTGVIQISLEGKDPEQTAQIANALAQSYLHQHVTSKQAEATKMLEFLKNEEPRLKSDLERAEAELTQYQR
TSGSINASDEAKVYLEGSVQYEQQVAAQRLQLAALAQRYTDEHPLVVAAKQQLGQLEAERAKYDGKFRGLPATEVKAVAL
QRNAKVAEDIYVLLLNRVQELSVQKAGTGGNIRLVDAALRPGVPVKPKKVLILSAATLLGLILGTSVVFLRRNLFHGIED
PDRVERAFNLPLYGLVPMSAEQARFDAADKGNRVRPILACARPKDLSVESLRSLRTAMQFALMDAKNRVIVLTGPTPGIG
KSFLAVNLAALVAHSGKRVLLIDADMRRGSLDRHFGTGGRRGLSELLSDQVALEEAIRETSVPGLSFIPSGARPPNPSEL
LMSPRLSQYLDGLAKRYDMVIVDSPPILAVTDATIFGELAGSTFLVLRSGMHTEGEIGDAIKRLRTAGVQLQGGIFNGVP
ARTRGYGRGYAAVHEYLSA
>gnl|bykdb|A0A0F6LBV9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia pseudomallei MSHR4000] (length=746 residues).
MNPNPTGTSTPADSEGDTDFIAVLDILIEGRWLIAAIALGVFIVGVAYAVFSKPVYQADILIQVEDSPDTSAAKSLLGDV
SSLFDVKSSAAAETQILASRLVVSRAVDNLKLFIDAKPKRFPVIGHWLARRSEGLSDPGLAGFGGYAWGQERIDVATFDV
PRAMEGDTFELTMLDARRYRLDGGDLERGAVGVVGRLERIAAKGGPIALRVDAFAAKPGATFVLVRHSRLRTIEALQDNL
DVQERVKQSDVVVASLRDTDPDLVSRALNEIGRQYIAQNIQRKSAEAAQSLEFLNGQLPTLKQQLTDSEARLTKLRDEHG
SVDLTEEAKLVLAQSADAKTRLLELQQKRRELLSRFMPKHPSVVAIDQQIAALDGYRGTAEQQIKRLPALQQQFVRLMLD
VKVNTDLYTALLNNMQQLQLVRAGKVGNVRLVDTAAVPEVPVKPKKALVALASLLLGVLAGCGTAVGRSMLFHGISDPNE
IERRLGLSVYATVPRSDRQRALTERAKHKARALSLLCVAHPDEPAVESLRSLRTALQFAMLDAKNNVVVIAGPAPGVGKS
FVSANLAAVLTMAGKRVLLIDGDIRKGHLNDYLGLARGKGFSELIAGSAQPDDVLHRDVIAGLDFISTGAMPKNPAELLL
NARVSTLIDTFSQRYDAVVIDSPPVLAVADTGILAATAGTAFLVTLAGSTKLGEIAESAKRLAQNGVRLSGVVFNGINPR
LGQYGYGSKYGGYRYVAYEYGAKRDA
>gnl|bykdb|A0A0F6RF34 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Citrobacter amalonaticus Y19] (length=720 residues).
MTEKVKQSAAPVTGNDEIDIGRLVGTVIEARWWVLGITAVFALCAVIYTLFATPIYSADALVQIEQNTGNSLVQDIGSAL
SNKPPASEAEIQLIQSRLVLGKTVDDLDLDISVTKNTFPLFGTGWERLMGRQNESVKVTTFTLPKGMNEQTFTLKVLDDK
RYELYSDGGFSAHGQSGQTLSKDGVTMMVSEIHARPDTEFAVTKFSTLGMINNLQNNLTVAENGKDTGVLSLSFTGEDRE
QIRDILNSITRNYLEQNVERKSAEAAKSLAFLAKQLPEVRNHLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLFTKAHPAYRTLLEKRQALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITE
ASTVGDVRIVDPAIAQPGVLKPKKALIILGSIILGLMLSIVGVLLRSLLNRGIESPQVLEENGISVYASIPLSEWQKARD
NVKTVKGVKRYKQSQLLAVGNPTDLAIEAVRSLRTSLHFAMMQAQNNVLMLTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGKGDIASCAKPTSIANFDLVPRGQVPPNPSELLMSDRLGELLRWASSHYDLVL
IDTPPILAVTDAAIVGRHAGTTLMVARYAVNTLKEVETSLGRFEQNGIQVKGVILNSIFRRATGYQDYGYYEYEYKSDTK
>gnl|bykdb|A0A0F6ZQ76 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter baumannii] (length=727 residues).
MNQNTNTEDTIDLKELFFSLIAQWKLIALCIILSLVCALLYLRVTPDTYSVDALVQVEDSKGASAALLGDLSDMIEQKSP
AQAEIEILKSRLVLGSVIKELHLDIHVSSTENTLTHRLLSDTEYKTEYTKNSVLFKDGTKNFDIRRFEVPAYYLDKQLVL
SFDQKSFKLVDPETDEVVLTAPINQNNQITGAYGVWKVAIFTKDQLDSKYNIKKLSIPAAVDNISSNYSVAERGKLTGIL
GLNYQGYDKEHITQVLNAILVTYGAQNVERRSAESAQTLKFLDEQLPDLKKQLDDAERQFNKFRQQYNTVDVTKESELYL
TQSITLETKKAELEQKQAEMAAKYTAEHPAMREINGQITAINKQIGELNSTLKQLPDVQRQYLQLYREVEVKTQLYTALL
NSYQQLRIAKAGEIGNVRIVDTAVEPVEPIKPKKLQVLILSLFLGGFIGTLIALLCNMLRTGIKDSGQIENELDLPVYAT
VPRSPIQESRIKILKKKKSIPILAVKNSDDIAIESLRSIRTAIHFALANAKNNIIMIAGPSPEVGKSFISTNLATIFAQG
DKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQADLQKVLHKTQVTNLDVITRGKSPTNPSEILSSNQFKELLEQLQS
QYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSQIKELELTLNRFEQAGVKVNGFILNDIQRASAGYGYGYNYAYA
YKAQKED
>gnl|bykdb|A0A0F7BJW9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Myxococcus fulvus 124B02] (length=730 residues).
MDGTVFDPAGGTGGPTSAGLMLRARALWRRKWVVLGVAVVVAALSAVYTLRQPKVFSASTSLIIDVTAPRFLDGEVKEVM
GEERSNYWFNKEYYATQSEIITSRAVASRVVDKLGLSTDASYLGVAHISDEKTRVQAMQGADAVGLLQSRIRVLPAKDSR
VMNIAVDDLDAARAALLANEVANAYMAENLALKLRMTDDARSWLESRLEDLENTSKASELAVYDFKKDADMLSTSLESRM
SIVSDRINSYNLNLTQVSTRIAALQARVEAIQKLRKASPDDETWAEALPGAKDGPIQDLRKSYTDARVACAELSERYLAE
HPKLLECQGKLAVIQADFLKSLRNVVRLAETELSEAEAQRKNLVKLLDEAKAEAFQVNKKSIEYDRLKRESDNNQRLYEL
VLKRLKDIELSGLLRTSNVRVLDPARPQFVPVKPHVKRNLMVGMVLGLLAGLGAALLLDLLANTVASQEDVEGRLGLAFL
GVMPRIEGNRPPKDRDLFVHREPKSSVAECCRAIRTNLLFMSPDTPFKTLVVTSSGPQEGKSTTTISLGVAMAQSGNRVL
LLDTDMRRPRLHRAFGVPNDLGISSLVVGEGTLEAAVKSTEVPGLFLLPCGPLPPNPAELLHTRAFADLLKQVAGKFDRV
LLDSPPLNAVADAAVLATQADGVVLVLKAGKTNRDSAQRALRSLADVQARMYGAVLNDVDLKAPGYGGTYIAYQGYGQYA
EDPKDRVAQS
>gnl|bykdb|A0A0F7DIY0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Salmonella enterica I] (length=719 residues).
MTEKAKQSAAVTGSDEIDIGRLVGTVIEARWWVLGTTAIFALCAVIYTFFATPIYSADALVQIEQNAGNSLVQDINSALA
NKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVTKNTFPLFGAGWERLMGRHNEMVKVTTFTRPETMSGQIFTLKVLGDKR
YQLVSDGGFSAQGVVGQPLNKDGVTMRVEAIDARPDTEFTVSKFSTLGMINNLQNNLTVTETGKDTGVLSLTFTGEDRDQ
IREILNSITRNYLQQDIARKSEEAGKSLAFLAKQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQLN
ELTFKEAEISKLFTKAHPAYRTLLEKRKALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITEA
STVGDVRIVDPAITQPGVLKPKKALIILGSIILGLMLSIVGVLLRSLFNRGIESPQALEEHGISVYASIPLSEWQKARDS
VKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMLTGVSPSIGKTFVCANLAAVISQTHKRVLLI
DCDMRKGYTHELLGTNNVDGLSDILAGKGEIASCAKPTAIANFDLIPRGQVPPNPSELLMSERFGELIAWASSRYDLVLI
DTPPILAVTDAAIVGRHAGTTLMVARYAVNTLKEVETSLSRFDQNGIQVKGVILNSIFRRATGYQDYGYYEYEYQSDSK
>gnl|bykdb|A0A0F7HCS6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Serratia fonticola] (length=714 residues).
MSDKKRESTFQQENEGIDIGRIWGSLVDHRWMILGMTALFTVIGTLYVLFSTPIYRADALIQVEQNSGNSILSNLSEILP
SNQPPSAAEIELIKSRMVLGKTVDDLNLDVVVEQKFFPIFGKGFARIVGKPKSELALSRFEVSENDINQYFEIKLLDDSQ
FSITKDGEDIAKGNVGQLLKNEHVTVLISDAKFDDGEVFEIKKISKLEAINEILNDLTVTDKGKDTGVLSLSLTGSDPSE
IKKILNSISQNYLLQNVERKSEEAARSLTFLKEQLPEVRGALDDAETKLNKYRQQNDSVDLSLEAKAALESGVALDTQLN
ELTFKEAEISKLYTKEHPSYKALMEKRKTLEDEKGKLNKKISGLPKTQQEILRLTRDVNAGQEVYMQMLNKQQELSITKA
STVGNVRIVDSAITQPKPVKPNKPVSILLFAMLGIILSAGYAILKTVLHKGVESAEQLEEIGINVYANIPLSEWQMKEDK
KLVTRSKTTKSNMLLAIGNPADLAIEAIRSLRTSLHFAMMEAKNNVLMISGASPGIGKSFVSTNLAAIIAMSDKKVLVID
ADMRKGYLHSILNSEHNNGLSETLSGVISHSTAIKKTQLANLDFIPRGMIPPNPSELLMNKSFSDLLDWASKNYDFVVVD
TPPILAVTDAAVIGRHVGTTLLVARFGVNTIKEIEVGIRRFEQNGIDVRGVIINAIVKKASTSYAYGNYVYSYK
>gnl|bykdb|A0A0F7KQC8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Altererythrobacter atlanticus] (length=715 residues).
MIERGDDDRSLLGDIDFGAVWAAIYRSRYWIGGIVIGALVLGVLVTLLTTPVYRAKATVQIDQEAAKILGTEDTNMTAAI
QDSDRFLQTQLDVIRSRSLTITIAEDLGFFDDPDFLVAMGYDPEVEAYGALTAEQAKREQVIQTLSENLGVALPVDSRVA
SITFDSPDPELAAQIANSYAENYIRSNLQRKFDTSAYAREFLKGQLDEAAARLAESERQALEYARNTRVIDASNAAQSET
GRSGPSSLVTATLVQLNEAYAVALARRIEAEQKWNETRSQPVMALPEVLNNLAIQRLLEERAKLQASYEEQLQRRRQDHP
VVKQAKASIDEIDRQISNIAVGIRQTVNSNYRAAVKQEQALEAQIAQLKTDTLDEQGKSVQLGILQRQTNNNRELYDLLL
QRFNELNAEAGVQANNVAIVDRADIPDKPVVPNIPLNLALSLVGGIAFAGAFVFGREQFFDTVRTADDLTRKVGVAVLGV
VPFVKGGVDVAEEAKDNKTTISEAFSSIRSSLMLSSSNGLPNSLMFTSAQQGEGKSSACFATALALGRVGKTVLLMDLDL
RRPRQHHLFNLDNACGMSNLLTHNATADEVIQKTEFEGISVIPSGGIAPNPTELLAGQTFREIVRKFEGLYDVVLIDSPP
LLALADAVEIGSATDGSIFVIESARTSSSALRSAMERLRHGGGSILGAVLTKFDPKEAGYSYYYAYDYQYKAGDN
>gnl|bykdb|A0A0F7KUD6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Altererythrobacter atlanticus] (length=718 residues).
MPNTETSEIAAESREAEAAQQSNALSLLPDPGLLWQVFRRNILLFFLVVSVVLGLTALFLVIQTPQYLAQASLLIQPSSD
PVRTSEPGDPSGIVNADEVDTEIRLISSRLVAERAAALYADRFASPDGDRFTPAEIESLAATMSRATFVARSGQTRVVDI
IAESSDPAFAATTANLIAEAYLQSQVEAKTARSESSGEFINARLEELESNAIAAQAALDNYRAARGLVSANGSTNAEMEV
SNLNTQLASARAELAEKRGRYNAARSQLSRGSGGADVGAALGSSTVGSLRQQEARVSAELAVLRERYGPLHPERRQAEQE
LADIRDRIQEEINRVLSNLQAEVQTAQSRVASLEGSRGAALSALQRNGQAQAGLSELEQKAEAAQAIYQSFLQRSQESGA
LRDSALPDAVISAKAVVPQLPASPNYPLTVLIGLFLALVSGFSAILLAEYLRRGVQTKRDVERRLRLRYAGAIPSLKSTI
KGRAPLEAPHDYVCNHPHSLFAEAFRSIRTFLTLSAGTRPRVIAITSALPGEGKTTTSLCLSRTTAADGIRVVLVDADLR
RRGASWALEYESETDIYDYLDGTASLNDCLHVDTRTGLHLLGSKSGQEGHRNPLTEGNVRRMFDELREHYDVIIIDTAPI
LGVAEGRILATEADRVLLVTQWKKTSMRAVEAVSDMLVDANAKITGLALTQVNIKKYASTGDGDVYAYTKKFRGYYVD
>gnl|bykdb|A0A0F7LHY5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Photorhabdus thracensis] (length=713 residues).
MTTSDKSSHTHTDSDEIDLGRLLSALFDYRWAIGGITLLFMVIGLGYSLVATPVYKANALLQVEKKSSALSLVGDMTDML
SGRQSDTSAELELLVSRMIIGKTVKDLNLDIQVTADYFPVIGKGIARLRGMPKPDIVIKNFTVSSEHIGKAIKIYVDDSE
NYQLEFDDQVFHGQVNKVLDADGINLLISNILASPGQSFTLVKQPRLDAVRSLQQALRVTEKGNNTGIISLEIEGDDRKR
IKSILDSVSKNYLQQNVTRKTEEAESSLSFLKNHLPKVKMALNSSEELLNQYRQANESVDLSLEAKSALETLVQIEKQLN
ELTFKEAELQQLYTKQHPAYVALLDKRKTLADTKKELNQSIKRLPKTQQEILRLTRDVQVGQEIYVQLLNKQQELNILKA
GTVGNVRIIDEAVVESAAVKPKKPLIIAAMTMLGLILSIGVVLLRVMFRKGIEGPEQLEEIGISVYATIPLSETQAKLEQ
QQKKRTHRQKLRLLAIHDPTDLAIEALRSLRTTLHFSMMESANKVILLSGSAPELGKSFISVNLAAVLALGNKRVLLIDA
DMRRGHLHKVLESPQSLGLSEYLAGQNQLKEIITRTYLTELDFVSRGDTPPNPSELLMHNRFKELLSWAEEHYDYVLIDT
PPILAVTDAAIIGRYAGTSLLIARYYKTRVKEVDIAIRRFEQNGIHIKGVLLNAVEKNSSLYYGGHYQYSYKD
>gnl|bykdb|A0A0F7M0M3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Spongiibacter sp. IMCC21906] (length=749 residues).
MTSQSSAPTSGTRHQQQDDEIDLLALFGTLWDHKFFIAAITAVFMVLGVAYALLAAPVYRSNAIIQVEEQKPSLPGMDDV
TEMFGGESAAVTEIELIKSRAVIGTAVNKLNLDIITQPHYFPVFGAAVSRRFNGLNGEIASPLFGLNSYAWGGEKISVSQ
FDVPTRLFSEEHTLIAGDKGNFSLYSPDDELILEGQIGQLAQSSGYALYVATLQANPGTRFELIRKRRLSAIIDFQAAVG
ASERGKDSGIIALSLENTDPEEASNILNVITEAYVRQNVERQSAEAAKSLEFLRDQLPGIKKELEQAESQLNEYQVKVGS
VNISAEAEVLLEQVVEIESAIAELQLQKAELDRKYTSDHPAYQAWREQMAEQKSRKAELSTRIKDLPETQQELIGLKRDL
EVGTEIYTQMLNNIQELDIVRAGTVGNVRIVDDAAVNIEEPVKPKKALIAVIATLLGGFLGVALVLVRAALNRGIENPED
IEALGLPVYASIPLSDEQRKLDRVDDKGKRLRKAKHLHPNALLAQRNPTDITIESLRSLRTSLHFAMMEAPNNIMMISGP
SPNVGKSFVSGNLAAVVAQAGQKVLLIDLDLRKGYMHKMFDTSPENGASDVLSKRISLAEAIKSTKVGELSFLPRGTIPP
NPSELLMSQGLSDLLNEVKDQYDLIIVDTPPVMAVTDAAIVGRHCGVTMLVTRFAMNPVKELEVTKQRFEQNGITVKGVV
LNAVERRASAYGYGYGYGYYHYEYKSDKT
>gnl|bykdb|A0A0F7YYU3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter baumannii AB5075] (length=728 residues).
MNQQNTNTEDTIDLKELFFSLIAQWKLIALCVILSVVCALLYLRVTPDTYSVDALVQVEDSKGASAALLGDLSDMIEQKS
PAQAEIEILKSRLVLGSVIKDLHLNIQVSSTENTLTHRLLSDTDYKTEYTKNSVIFKDGLKSFEIRQFEIPAYYLDKTLQ
LNFNKQSLRLTDPATEQTLLTVPLNQLNQVTGPQGIWKVSIFTKDKLDTTYNITSLSLPAAVDTIGSNYSVAERGKLTGV
LGLNYQGQDKEHITKVLNAILATYSAQNIERRSAESAQTLKFLDEQLPDLKKQLDDAERQFNKFRQQYNTVDVTKESELY
LTQSITLETKKAELEQKQAEMAAKYTAEHPAMREINGQLSAINKQIGELNSTLKQLPDVQRQYLQLYREVEVKTQLYTAL
LNSYQQLRIAKAGEIGNVRIVDTAVEPVEPIKPKKLQILILSIFLGGFIGTLIALLRNMLRTGIKDSGQIENELDLPVYA
TVPRSPIQESRVKILKKKKSIPILAVKNSDDIAIESLRSIRTAIYFALANAKNNIIMIAGPSPEVGKSFISTNLATIFAQ
GDKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQADLQKVLHKTQVTNLDVITRGKSPTNPSEILSSNQFKELLEQLQ
SQYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSQIKELELTLNRFEQAGVKVNGFILNDIQRASAGYGYGYNYAY
AYKAQKED
>gnl|bykdb|A0A0G2ZFU6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Archangium gephyra] (length=715 residues).
MQYVRALWRRKWLILGVMAVVMLVGLFHTLRQPKIYTANTSLIIDVAAPRVLDTEVKEVMGDERGNYWANKEYYQTQSEI
ITSRAVASRVVDRLGLRNDAAFLGVAGIQDEEARKKAMAAADPVSMVRSRITVIPSANSRVVRIAVEDVDPKRAALLANE
VADAYIAENLALRLKTTEGASVWLEERMGELGSRASTSELDLYKFKRSADVLSLSSNGKDGQPQPSTAKLAYDSYMSALI
AVRTKMAALQARVDAMRQLRNSASPDAEHWAEGLPEANEGALRELRNKVLEQRTGCVELSERYLPEHPKMQECQGKLTVL
QQELRRSLENLVKGAETDLAAAQANERTLLERVEQAKTEAFALTEKEIAYQKLRREAENDQRLYDMVLKRFKELELSGQL
RTSNVRVLDAALPNPAPVRPNTRSALMLFFLLGLMGGVAVALGLELLDASVATRADVEERLGLAFIGAMPPLKPDDGGPA
DLFIHRHPRSQAAEMCRAIRTNLLFMSPDKPFRTVVVSSAGPAEGKSTVVINLGMVMAQTGSRVLLMDTDMRRPRLHKAF
GVPDDVGVSSLVVGEGSLEGAIKSTDVPNLFVLPCGPLPPNPAELLHTRAFAELLGKLRERFDCVLLDSPPLGPVSDALV
LSKQTDGILLVLKAGTTQREQAKRATRALRDVKARVIGALLNHVDLKGGRYGADSYDGYGYRGYGNERDEQRSVS
>gnl|bykdb|A0A0G3CN57 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pragia fontium] (length=713 residues).
MVSTQKNVNNNWKENGEIHLGKIIGTIVDHKKFILIITLFCTTIAIFYSLLATPIYRADVLIQIEKNTQDNILSNFSDIL
SDDKPQSAAEMELLKSRMVMGKTIDDLNLDIQVSEKSYPIIGRVINLLQKKQATTIVVSKLEIPESIYDEELILTVLPND
HYKITSNNIEINGQVGVIKKQNEYTILISDIDAAVGTEFRIKRLDKITAVNNLLANFSVSDTTKDSGVLKLNFKGRNKHE
IRKILDNISNNYLQQNIERKSAEAAKSLDFLNQQLPLIKQQLEEAEGKLNQFRQTHESVDLNLEAKSTLESTVAITSQLN
EAIFKEAEISKLYTKEHPAYRSLLEKKEALLQEKNILNQRIANLPKTQQEILRLTRDVQSGQEIYVSLLNKQQELNINKA
SKVGNVRIIDKAVTQPDKIKPNPPVIIGLAFILSLLLSIALILGREYFRRFINDSTQLESLNINIYANIPLSKAESKKNK
EIQSDKNTNHIKLLAVKHPTDPAIEAIRSLRTALHFASQNTLNRILMVIGATPGVGKSFVSSNLAAVVANSGKKVLLIDA
DMRKGSLHKSFGRTPENGLSDILSNRKEIADCLYNTPVEGLDFLPRGTVPHNPSELLMNEYLAELLLWANSHYDLVIMDP
PPTLATTDSTIIGKYSGMNIIIVRFEKNTISEIESSIKRLEQSGAMINGVVLNAIQKRAAKHYSDGSYEYYIY
>gnl|bykdb|A0A0G3EPM4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pandoraea thiooxydans] (length=784 residues).
MSVRNIEWGAVPLRRGSGAVTPREALRLVADKARVVLLITAILVAFSALYAFLAQPIYSANALLRVSPPNANELGIGNRQ
KQMTLPENPDTATEIQLVKSREILLPAIKRFHLDIHVAAQRLPLIGSIAEKFAKDGHPAAPWFGLENYAWGGEAVSIGQL
HVPPELQNKPLELRVLPGRRFGLYDPAGTLLVTGEVGVPAQGAGVTVLVNRLSARAHTRFTVTRYDDITAVNLMLRHLQV
VEEGKNTGVVKVSYENSNPVLAMQVTNAVVQGYLAANAASHQEEANKMLTFVQGELPRLRAELDDAERKLSQYRTHAGTM
EPDRESQSYLRGGIDFDRQIAALKLQRTQLLSRFTANSPEVRNIDQQLAELEGYKHSFTARFDNLPASQRRLAELTRNEK
VASEIYVAMVNRAQELSVTRASNFGNVRIVDTALVPQKPIRPRRALIVAVATLLGLLLGALYVLLRRQLSSRIDDPLLVE
QRLRLPVFGTIAFSNQQSRLAGAAQGQLLAAHDERPGDLEPRLRPALAIPPPAQASARSRALEPAEPGSGEEIRAPRGVM
AVNRPHDVTVEALRSVRTALQSGAASATNNILVVSAPTPETGKSFVAANLAVLEAETGKRVLLIDGDMRRGRLATHFGHP
DAPGLSELLMGRAEIAQVIQSAGVGGMSFLAAGRTPGHPAELLSTRHMEGLLKMFSERFDLVVIDTPPVLAVADAPILAR
HAGTTVLVLRPNAQTEREIEDSVIWLGRAGARVAGTIFNAMPPRRGEKRSYVYAYASAPDSAGY
>gnl|bykdb|A0A0G3EWQ5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella pneumoniae] (length=721 residues).
MSSATSKNILKDDDEMDLGKLIGELIDHRKLIIAITSFCTLISLVYAIFATPIYQANSLIQVEQKQGNAILSNLSQMLPD
SQPQSAPEISLIQSRMILGKTVDDLNLQIMIKQNYFPIFGQGFARLLGEKPSNIEVTRLYVTNANDDVTQLELKIKDGEH
YQIKYDGAVFNGRVGELLENKQLAIKVNDISAKPGDTFTIYYFNRLKAIADLLDNLNVSDQGKDTGILSISYTGENPQLI
KNIVNSISENYLAQNISRQAAQDAKSLDFLNIQLPKVRNDLDIAENKLNAYRRQSDSVDLSLEAKAVLDQIVNVDNQLNE
LTFRESEISQLYTKEHPTYKALMEKRKTLQEEKLRLNKKVSSMPETQQEILRLSRDVESGRAVYMQLLNRQQELNIAKSS
AIGNVRIIDDAVTQLKPVKPKKILVVIIGFILGLSIAIGVVFLRIMLRRGIETPEQLEEIGINVYASVPVAESLVSNERS
IKNIRKKITHKEYTGLLATTNPADLAIEAIRGLRTSLHFAMIEARNNILMISGASPNAGKTFISSNLAAVVAQTGKKVLF
IDTDMRKGYVHKVFDVENDNGLSNYLSGKLGLEATLKKIPEAGFDFISRGVVPPNPTELLMHRRMEEMLKWASQNYDLVI
LDTPPILAVTDAAIIGHYAGTTLLVARFELNTVKEMDVAFKRFEQSGIVAKGCILNGIVKKASSYYGYGYNHYGYSYKDN
T
>gnl|bykdb|A0A0G3EWU3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella pneumoniae] (length=721 residues).
MSIVIKKNVATDADEIDLGRLIGEIIDHKKLIISITALFTLLALVYALFATPIYQADALIQVEQKQGNAILNNLSQMLPN
SQPMSAPEIALLQSRMVVGKTVDDLNLQANVEQDYFPLFGKGMARLMGEKSGSVVVTRLYLPEIDDIEPELKLLVKDNRH
YSIKYNGQEIEGKTGELLSSMGLSLKIEHIDAEPGTEFTISYTSRLKAITSLQDLFSVVDQGKDTGMLTLSITGENPELI
KEIVDSIANNYLAQNIARQAAQDEKSLNFLNLQLPKVRADLDVAEDKLNQYRRQNDSVDLSLEAKSVLEQIVNVDNQLNE
LTFRESEISQLYTKEHPTYKALMEKRKTLIDEKEKLNQRVSSMPKTQQEILRLNRDVESGQAVYMQLLNRQQELNIAKSS
AIGNVRIIDSAVTETKPVKPKKILVLLIGVIFGIVFSIGLVLFRVFLRRGIDSPEQLEEIGINVYASIPVSEDFSKNIAH
KANWKKNKGNEYSGFLAIDNPADLAIEAIRGLRTSLHFAMMEARNNVLMISGASPNAGKTFVSTNLAAVIAQTGKKVLLI
DTDMRKGYTHKLFNVGNDNGLSDFLSGKNDIEKSIKKISPIGFDFISRGIVPPNPAELLMHRRFGELISWASNNYDIIVL
DTPPILAVTDAAIIGHYAGTTLLIARFEQNTVKELEVSFKRFEQSGVIVKGCILNGVVKKASSYYGYGYSHYGYSYKDEK
S
>gnl|bykdb|A0A0G3EZW7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella pneumoniae] (length=719 residues).
MIVNKKFSEKHSDEIDLGRIFGELIDHRKLIVSITALFTLFSLVYALFATPVYQADAMIQVEQKQGNAILNNLSQMLPDS
QPQSAPEVALLQSRMILGKTVDDLNLQTRVTKKYFPLVGAGWARLTGEKESTISVSRFYVSSNSDDNEINAKITIVDPTH
YIFSGNGFELKGTVGELIDGNGVSIKIDSIDASVGTTFNISLVTRLKAITDLQKMFAVSDQGKDTGILTLTVTGENPVLI
RKILDSISENYLAQNIARQAAQDQKSLDFLNQQLPKVRDDLDNAEGKLNAYRRQNDSVDLSLEAKSVLDQIVNVDNQLNE
LTFRESEISQLYTKEHPTYKALLEKRKTLQDERSKLNKRVSGMPETQQVILRLSRDVESGRAVYMQLLNRQQELNIAKSS
AIGNVRIIDPAVTQPKAVKPKKTLIVLIGTILGGMVSIGLILLRVFLRRGIESPEQLEDIGINVYASVPVAETFSKSAQK
SKKWSRKAETAKGLLAIDNPADLAIEAIRGLRTSLHFAMMEARNNVLMISGASPNAGKTFVSTNLAAVIAQSGKRVLVVD
TDMRKGYTHKLFDLDNSSGLSDFLSGKVEINKVVKPTAIVGMDLITRGMVPPNPAELLMHKRFEDLISWAGKNYDIVILD
TPPVLAVTDAAIIGRYAGTTLLVARFELNTAKEIEVSVKRFEHSGITTKGCILNGVVKKASSYYGYGYNHYGYSYKEEK
>gnl|bykdb|A0A0G3F1G5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella pneumoniae] (length=723 residues).
MAPISYKKQELSETDELDLGRLVGEFIDHRKLILSVTIFFTVIALLYAMFSTPIYQADALVQVEQKQGNALLDSLNQVLP
TGTQQSAPEIALLQSRMVLGKTVDDLNLEIAIEKDYFPVFGRGWARLTGTDGGNIKVSKLILKKNDIENVKLKVINENDF
LVTTSSGDIKGRVGTAIDNRDFTLKVDEINADEGSSFTIQKITRLQAINNLLKVFSVTDQGKDTGMLNLTLVGEDPNQIT
NILNTISDNYLAQNISRQAAQDEKSLEFLKAQLPKVRDELDEAENKLNAYRRNKDSVDLTMEAQAVLNQIVNVDNQLNEL
IFREAEISQLFTTDHPTYKALLEKKKTLAQEKVRLNNQVTSMPTTQQEILRLSRDVESGRAVYMQLLNRQQELNISKSST
IGNVRIVDSAIAEPKPVKPKKIMVVLIGLVFGLFVSVGIVLARIFLRLGIESPEELEDMGINVYASVPVSEWLTQKHFKN
GKRLAAKNVFKEDRESLLALENPADLAIEAIRSLRTSLHFAMLESSNNILMISGASPNAGKSFISSNLGAIVAQTGKRVL
LIDADMRKGYIHKVFGVSNSNGISEILSGKSTVGSAILKTQLDNLDIITRGQVPPNPSELLMHERLKLFLESVSKEYDLI
LVDTPPILAVTDAAIIGQYVGTVLLVVRFELNTAKEIEISKRRFEQSGIPVKGCILNGVVKKASSYYGYGYNHYGYSYNT
DKK
>gnl|bykdb|A0A0G3F2Z0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella pneumoniae] (length=726 residues).
MPSSNVNMIPKKDADEIDIGRLIGELIDHRKLIISITLLTTVVAFIYALFSTPIYQANALIQVEQKQGNAILDSLSQVLP
NTTPQSAPEIALLQSRMILGKTVDDLNLQVVIEPRYFPVFGKGFARLSGENSGDVKISRLYVSDDIINNDKPLELDIINN
EQYVLKIAGRSHKGDIGVLVTGKDFSIKIDSINAKPNSKFEIHLQSKLKAISELADSFSVSDLGKDTGMLTLIYSGSNPD
RNTEILDSISQNYLSQNIARQAAQDAKSLEFLQQQLPKVRAELDQAEEKLNTFRRQNDSVDLSLEAKSVLDQIVNVDNQL
NELTFREAEISQLFTKEHPSYKSLLEKRKTLQQEKERLNSSVAKMPKTQQEILRLSRDVESGQAVYMQLLNRQQELNIAK
SSAIGNVRIIDTAVTDPIPIKPKKSLIILLGIFIGLVISICIILFRVMLRRGIESPEQLEELGINVYASVPVSEWLINKN
TKKTGRRNFKKNSQNNFSLLAIENPADLAVEAIRGLRTSLHFAMMEAKNNVLMISGASPNAGKTFISTNLAEVIAQSKQR
VLFIDSDMRKGYVHKMFGLSNDKQLGLSDYLSGKASIDSIVNNLENYNFDCIVRGMVPPNPAELLMHSRMAELLNWASQH
YDLIIVDTPPILAVTDAAIIGRYAGTTLLVARFEVNTAKEIDVSIRRFEQSGVVIKGCILNGIVKKASSYYGYGYNYYDY
TYVDKQ
>gnl|bykdb|A0A0G3K477 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli PCN033] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQSSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDDK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHASPGTEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGVKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A0G3QAX2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Phytobacter ursingii] (length=720 residues).
MTEKTHHSAASTVGNDEIDVGRLIGTVVEARWWVLGITGLFAVAAIVYCLFATPIYSADALVQIEQNTGNSLVQDIGSAL
ANKPPASEAEIQLIQSRLVLGKTVNDLNLDIAVTKNTFPVFGAGWDRLMGRQDDTVKVTTFTLPKEMKDQVFTLKVLGPK
QYSLTSDGGFSAHGEVGQPLSKDGVTMVVSAIQAANDSEFTVTKFSTLGMINNLQNNLSVTENGKDTGVLSLTYTGEDRD
QIRDILNSITRNYLQQNVERKSEEAAKSLEFLNKQLPEVRAKLDVAENKLNTYRQQQDSVDLPLEAKSVLDSMVNIDAQL
NELTFKEAEISKLYTKAHPAYRTLLEKRKALEDEKAKLNTRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELRITE
ASTVGDVRIVDAAITQPGVLKPKKALIILGSVILGLILSVVVVLLRSLFNRGIESPQSLEEQGISVYASIPLSEWQKARD
TVKTVKGSKRYKQRQLLAVGNPADLAIEAVRSLRTSLHFAMMQAPNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLM
IDCDMRKGYTHELLGTDNVNGLSDILVGKGSIENCAKKTSIANFDLVPRGQIPPNPSELLMSERFTQLLDWASKHYDLVL
IDTPPILAVTDAAIVGRHAGTTLMVARYAVNTVKEVQTSLSRFEQNGIQVKGVILNSIFRRATGYQDYGYYEYEYKSDSK
>gnl|bykdb|A0A0G3S556 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella oxytoca] (length=720 residues).
MSPVINKPQAKDSDEIDLGRLIGELIDHRKLIISITSLFTLIALAYAILSTPIYQADALIQVEQKQANALLSSLSQVLPD
SQPQSAPEVALLQSRMILGKTVDDLNLQIRIKQNYLPIVGRGWARLLGESPGSLTISRLYLHSTSEESPEITVIVKNNKE
FTIAGEDFTIEGHVGDLIERKDFSIKIDSIDAEPNTSFTVSYVSKLKAITDLQEVLSVADQGKDTGMLAISLTGADPELI
VKIIDNLSANYLAQNIARQAAQDAKSLEFLNNQLPKVRSELDLAEDKLNQYRRQNDSVDLSLEAKSVLDQIVNVDNQLNE
LTFRESEISQLYTKEHPTYKALMEKRKTLQDEKTKLNKRVSAMPETQQEVLRLSRDVESGRIVYMQLLNRQQELNIAKSS
AIGNVRIIDNAVTQPKPVKPKKILILAAGIILGTIFSFGLVLLRVVLRRGIETPEQLEELGINVYASIPVSETFTKKADQ
SKGWRKKQQSEIQGFLAVDNPADLAIEAIRGLRTSLHFAMMEARNNVLMISGASPNAGKTFVSSNLAAVIAQTGKKVLFI
DTDMRKGYTHKLFNVSNDNGLSDVLSGKVNKENAVKSISSASFDFISRGIAPPNPAELLMHKRFGELVAWASHNYDIVVL
DTPPILAVTDAAVIGHYAGTTLLVARFELNTAKEIDVSIKRFEHSGVMVKGCILNGIVKKASSYYGYGYSHYGYSYTEDK
>gnl|bykdb|A0A0G3WUW5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia pyrrocinia] (length=741 residues).
MVNTQAKHSYADLSVKTEEEDVVLGQLLQVIMDDIWLLLGIAVTVIALAGLYCYIAKPVYQADVHVRVESNDNTSQALTQ
TQTGATINTGPQQAQTDAEIEIIKSRGVVAPVVEQFKLNFSVVPKTLPVIGSLAARVATPGTPARPWLGLKSYAWGGEVA
DVDSISVAPALEGKKLTLTAGPNDTYSIVDQNGTRLLAGQVGESAQGGGVTLLVKKLVARPGTQFTVVRYNDLDAIGGFQ
AGIQVSEQGKQTGVVQISLEGKDPDQTAAIANALAQSYLNQHVIAKQAEATKMLDFLKGEEPRLKSDLERAEAALTQYQR
TSGSINASDEAKVYLEGSVQYEQQIAAQRLQLASLAQRFTESHPMVIAAKQQLAELQGEKDKYSNRFRSLPATEVKAVQL
QRDAKVAEDIYVLLLNRVQELSVQKAGTGGNIHLVDSALRPGDPVKPKKVLILSAAVFLGLILGTGVVFLRRNLFQGIED
PDRVERTFNLPLYGLVPQSAEQVKLDAAAEKSGSRARPILASLRPKDLSVESLRSLRTAMQFAMMDAKNRVIVLTGPTPG
IGKSFLAVNLAVLLAHSGKRVLLIDADMRRGLLDRYFGLTAQPGLSELLSDQSPLEDAVRETPVQGLSFIAAGTRPPNPS
ELLMSTRLPQYLEGLSKRYDVVLIDSPPVLAVTDATIIGRMAGSTFLVLRSGMHTEGEIADAIKRLRTAGVDLEGGIFNG
VPPKARGYGRGYAAVHEYLSA
>gnl|bykdb|A0A0G3X0N1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia pyrrocinia] (length=755 residues).
MNSLTLPDPHDGPALRPSYPYRRYWTMLVGGRRLILCTALAGALAGAVYALCARPVYRTDILFQVEQSPTESKPSSPAGD
PSSVFDLKTDASTEIEVLKSRAVMARAVDDTNLAVDARPHYLPIVGWRFVNAADGLSSPLPGGYVYGTERIDVPTFDVPK
RFLGMRFALTVGNDGAYTLQRTGLLGRTGPVWQGRVGQPLHVETPQGPLDVFVRGVAGEPGARFDLTRYADEEATAWLQK
NALISERGKQSNMIGVTLDGTDPVHDSRVLNAVGDAYLAQNTQRKSAAADKLIRFMDAQLPQLKAQLEQAESRFNAFRAS
HGTVNTSDEGLALRQQSVDIETRVQTLQQRREELLTRFMPKHPAVVAVDAQLADAQHALDTVRKQIQQLPTVEQGVLQLQ
RDVAVDTALYTNLLNSRQQMILARASKTGTVRIVDAAKVAETPTGPHRGMAVIASLILGLLAGAAVVIVRQRVAGTVGDA
EEIEWSTGLPVFAAVPHSPVSGQAVPPSKGARRRAARTPEPPGAPEGAALESLRNFRTALQLAMPDAPNRVVLISGPTTG
VGKSFVAANLASLVGAAKRRVLLIDADLRKGSLHERFRFSRAPGLADVVAGTHALDEAIKRDATPGLDFMPMGNVVPDPG
ELLLQPALAELIERVASRYDMVVIDAPPLLPVADALVLGRLAGTVFLVARSGVTTLTELDESARRLEHAHIDVRGVILND
FTGSPGRYDYGYTDANTHQAASGYAGAMAARRPAR
>gnl|bykdb|A0A0G3X2U2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia pyrrocinia] (length=764 residues).
MPTSPPPRMPEHADEITLAGVIDTFVSHRWLIACVTAACVGAGTLYAFLSHPQYQADILLQIEDSGDASAAKSLLGDVSS
LFDVKSTAAAEAQILASRLVVTRAVDDLRSYIDVRPKRFPVVGDFISRFNPDVARPGVLGIGGYAWGNERAELPRFDVPK
PLEGDRFELTVLDGGRYRLSGPGLSAPVVGQHGRTETFRTADGPLVVELTRVDAQPGTRFTVVRQSRAETIDTLRRTLDV
QEKVKQSGVIVATLRGPDPQRVQATLQAIANHYVRQHIERRSADAAQSLAFLNTQLPILKKQLQQAEQRYTDMRNAHGAV
DLTEEAKLVLQQTADAKTRLLELQQKRDEMATRFAPGHPDMIAIDAQIGTLRRQQQDVEQHVKRLPDLQQNALRLMLDVK
VDTDLYTALLGNAQQLELVKAGRTGSVRLVDAPTVPDEPVRPKRTIVIGAAALFGLVLGVGLAFARDFLFGGVDSADEIE
RHLGINVYATIPDSPEQRHVARRMATHAPGPHLLSVREPHDAAIESLRSLRTALRYAMQGARNNVLLLSGPAPGAGKSFV
SANFAALLAANGARVLLVDGDLRKGYLHDYFGVARERGFAEIVSGDLAPHDAIHASVVPNLDFVATGALQPNPDALLADE
RIAALLGEWSARYDAVVIDSAPILAVADAVVLGRHAGAVLLVARAGATRLAELGEAARQLTHNGIATAGVLLNGVIPRAG
RYGGRYGAYRYTRYGNAPRRDTHSSPARRALRALTARLRQGGSR
>gnl|bykdb|A0A0G3X3K3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia pyrrocinia] (length=728 residues).
MEVTQKLRRISLTGDDEIDLSEYLSVLRERWKTVVLCTLAGACIGASYVFVAQPVYRADAMFQIEDGVNSTQGMLGQLAS
VFDTKQSAIAEIEVIKSRKVVMAAVDELHIEITALPRYVPLVGAAIARRHAGDGLAPPMLWMSKFAWGGERIDVSRFDVP
RDTYEKRYTLVAGQGGYYDLLDPDGNAVLHGKAGELSQAGAIAVRVDRLTARPGTQFRLVRTSALKAAAKLQTALAFDDK
SKQADIIKMSLDGPDATRTALILSAIANAYLKQNIDRKSADAEHALTFLDEQLPVLRKQLEAAETRYNDYRNKKGATDMA
EESKLLLQQVVDNQTKLGGLQQNRAELGQRFAEGHPAMQSIDAQIGALDENQKRLNSRIASLPNTEQEAVRLLRDVRVNT
ELYMNLLDSAQQLRITKAAQIGNVRLVDDSAEPETPVWPKGPVIVAVTTLLGLVAGTMAAFARRIFVGGVERSEDVESAL
GVPVFAVVPRSPEQRRLSRLIRRKVGDGARVLATSSPEDIAIEGIRSLRTALKFGLGGAANNIIALTGPRPAGGKSFISQ
NLAAVLASGNKRVLLIDGDLRRGHLHEALGISREPGLADVIRGANLADAIVRGVLPGVDLLPRGAESLNSAELLLSDRLK
ATLDECSAAYDFVVIDTPPVLAVTDPVLICRYAGVSLLILRYGRSPISEVVDAANRLRNGGVRLNGVLMNDMPLERMQYG
AAYYGNSR
>gnl|bykdb|A0A0G3X408 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia pyrrocinia] (length=745 residues).
MTQQSAPPQQTAEDGSETDFVAVLDILLESRWLIATITCVFLAAGLAYAILGKPVFEANIMVQVEDSPDTSAAKSLLGDV
SSLFDVKSSAAAEQQILASRLVVERAVDKLNLFIDASPKRFPLIGDWIARHGDGLSDPGVAGLGGYAWGRERIDVTLFDV
PRKNEGDTFKLTSLGGKRYRLEGGDLDAAVDGTVGTLEHFRSPRGPIVLRVDAIVAKPGAAFVLVRNSRLKTIEDIRDRL
NVQERVKQSDVVVASLQDTDPKWVSDTMNEIGRQYVRQNIERKSAEAAQSLEFLTAQLPQLKQQLTDSEARLTKLRNEHG
TVDLTEEAKLALVQTADAKTRLLELQQKRQELMSRFTDRHPSVAALDEQIAALNGYRNTAELQIRRLPDLQQEAVRLMLD
VKVNTDLYTALLNNMQQLQLVQAGKVGNVRLVDVAAVPEVAVRPKKALVAVASLLLGLLAGCGAAIVRSMLFHGISDHNE
IERRLGLAVYATVPISEHQRDLAEEAARKSGHKSVLSIDFPNEPAVECLRSLRTALQFAMIEAKNNIVMIAGPAPGVGKT
FISANLAVVMASAGKRVLLIDGDIRKGRLHDYLGFPRDRGFTELIAGSARVEDVMHREVVDGLDFISTGTMPKNPAELLL
NRNLASLLDDLSSRYDIVIVDSAPVLAVPDSGILGAFAGTALLVTLAGKTKLGEIGESAKRFAQNGIRLNGVIFNGVNPR
LGQYGYGSKYGGYRYVAYEYGTHDA
>gnl|bykdb|A0A0G3XAM8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Altererythrobacter marensis] (length=718 residues).
MANALPYDTELEPVDEGEEKPGILAMERYWRQAVNSRVWIAAILAAGLVLGLLVTLLSTPLYQSTAVIEISRVSSNVTNI
DQTEIEELQADEQYFQTQYELLGSRFLAEAVVDAGNLTASEEFRNAFAGDPDVPLKRNEAVKILLENVSIQPVRMSNLVN
VNFSSPNRALSSDIANLWAEQFLAANYEKRFGANIDARRYLRDQIAELRERLAQSEKELVDYANANQIVIIDAASSSNDD
SSSSTARSLIGDSLTTLNAALAQATAKRIAAQSALQARSTSNETRSASSQLQNALAAAEAKLASLQANFGPDYPEVQAAR
SEVEAMREAISSSRGRDMSALEAAYRQARGEESALQAQVQQIQDRFLSQQGGGIQYGILKREVDTNRQLYDALLQRSKEL
EAAGAGKNNMTLVQPALPAEEPYRPSLILNLALSLLAAGAVAAAFVFLRETMDQTVRDPNDVQRLLGVPTLGLIPRVNEN
DILEELHRRSSELSEAYVAVRSNISFLTPSGAPKSLMLTSTRPNEGKSLTSVAICRSFAQLGKRTLLIDADLRNTALADF
LGKQATADTGLSSLLAGRGESLSHVIPIEEHGFDLIPSGATPPNPADLLASDALARLIREFEQSYDFILVDGPPVLGLAD
ALEISTAVEGAIYVIESNDVKIRAIDNALRRLRSANAKIYGAIVTKLDARNSAYGYGYGYGYGYGYGDSDRETNAPAS
>gnl|bykdb|A0A0G4JP10 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Brenneria goodwinii] (length=724 residues).
MAEKISVKASETTSDEIDLGRLLGTLLDNRWLIIGVTAVFAIIGILYATLATPVYKADALIQVEQNSGNKLLSDISSMLP
DAKPQSAAEIELIKSRMVIGKTIRDLSLDTVVEQKYFPMFGKGLARILNEKPGEIAVSRLEVPNSWQDEKIELTILSSTT
YQVEAGNIINYTGSVGKLESNNGLTLLVSDIAAPEGTVFRLKKLNELTAINDLLSDFTVADTGKDTGVLQLSLEGEDPVK
VSKILNSISQNYLQQNVERKSEEAGKSLEFLKEQLPTVRDSLNEAENKLNLYRQQNESVDLSLEAKAVLDTMVSVETQLN
ESTFKEAEISKLYTKEHPAYRALLEKRKTLEQERDKLNKRVSAMPATQQEILRLTRDVQSGQEVYMQLLNKQQELSINKA
SVVGNVRIIDSAATQLKPVKPKKTLLVLLSLILGGFISTTFVILKTILHKGIESPEQLEELGINVYASVPLSEWQQKKDR
ELFTRNKGKKANARANELLATGNPTDLAIEAIRSLRTSLHFAMMEAKNNVLMISGASPAIGKTFVSANLGAVIAQSGKRV
LIVDCDMRKGYAHELMGTDGTNGLSDILSGQTIAEKAVRKTDVENMDFIPRGQIPPNPSELLMHSHFSDFIDWASLHYDI
VLLDTPPILAVTDAAIISRHAGTSLLVARFEMNTLKEIEVSIRRFEQNGAEIKGVILNAIVKRAAGYYGYGNYDYYSYEY
KSDK
>gnl|bykdb|A0A0G9H151 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Dyella japonica DSM 16301] (length=733 residues).
MTASQTTAPQDDEIDLRELLGTLLDHKWLIGIVTGVFFVLSVGYAVLGTPIYEADAMVQVEQKVPDLPGLSAITQTLGAS
SSEATTEIALITSRSVIGKAVDELNLQVEVAPYHFPIFGGWMARHYVPDQPTDVASPLMGFSRYDWGGSRLDIFQLKVPA
SLEEKKLVLIAGEHGSYTLYSSGDVMLTGQVGNVATGHGFTMQVRELRANPGTHFAVVHHTALAVVNQLQLDINATEQGK
DSGIIQLMYDHEDPVLAAQLLDHVSQAYVKQNVERNSAEAANSLKFVREQLPRIRQDLDKAQSALNAFQTKAHSVDITLQ
TKGLLDQVVAIETSIQQLRMQQADMERRFTAEHPAYKALLEQIAQLQGQKNGIDKQVGGLPDTQQELLRLTRDVEVLNAT
YTGLLNQAQQLDIARAGTVGNVRVIDPAAVDISKPAKPKKALVALGGTFLGGFLAVAFVLVRQMLSRGVEDPSAIEQLGL
SVYASVPSSVAEKQSFLQGRRGRGDGKQKLLAVNAPADLAVEALRSLRTSLHFARIEAKNNILMISGASPGAGKTFISSN
LAAVIAKGGQRVLLIDGDMRKGALHTVIGGRPDKGLSELIAGQLSLDDAVRTVGDVEGLHFISRGKAPPNPSELLMHARF
ADLLETLKPKYDLVIIDTPPILAVTDAAIMGHHVGTSLLVIRFGLNQAREIALAKQRFEQNGVQIKGAVFNAVERRSTGY
YSYGYYEYSSSPA
>gnl|bykdb|A0A0G9ML73 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Erythrobacter gangjinensis] (length=739 residues).
MNEQISLRGEGDPNVDPYWDDPDFVADGNPYGRGKLVNFGVIRAMLWRQRFVLAGLVGAALLAGLVITMLMTPIYAATSS
VRVDSQPDQLIEGQELVNPYIGANEIDRYLLTLTHEVTSRDMALKVEEELDLANNAAFLGLERDVVDGHLPAEGEARREQ
TAIAMLQGNLEVEVPLMTSVISMTYESPNPEIAAAVANAYATNFLSSDIERALEANSYALEFLDEQIVELRAELQDAERA
AINYARANRLVGEALQSQDDNGDDAGAPATLSAANLGNINRTYTEARAERIAAEQRWRSVRDIPPAQLPEVRTSSYVEQL
RGQLAEAQADLVQLRERYQDDYPDIRQLEARIATLRSDIATAGAEIKASIRNDYTIALRQERALAGELERQSSVTLDEQD
RRVQFNLLDREVQARRSQLAALLARYNQVSSAANLQSSNATLLEQAVVPDAPVAPNLFKNLVIAFVLGTGLAVALAILRE
VLDDRLRSTEDVERVLGVRALGHTPNIDEADIASDIDDTFSHLSEAYASIRATLDYRLAKGRHSVIQVTSSGAGEGKTTT
AIALARRYAMLDRKVLLMDVDLRRPSVTRQLLGERPSKGLTEVLMGEATFDEAILKGGDDSLDVLGLAALPNEPVEMLSS
GLLPAFIQSQRPNYDIILLDSSPVMGIADAPLLARAVDATVFVVEANVAHNGQAKAAISRLRQVGANIVGAVLAKFRALE
AAGDYSYTYSYYNYQQKAS
>gnl|bykdb|A0A0G9MRA3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Erythrobacter gangjinensis] (length=701 residues).
MTDTAVTTAGEGPYYTANTQFQALDLSRLAARAVQLRYWLAGLFAAAIVIAIIFTTLQTPLFRSTAQIEISRVEISAGDS
GDLAAAGQENRDQQYFNTQYELLRSRAVATRVVDALDLSEDEQFASAYSADPGQISPERAASLILGSVEILPIPQSNLVD
IAVSSPSADLSARLANAWAEQFLELNYEKRFGDNILARELVEDQLAEMRVQLEEAEERLSAYASANEILVVESTGEDGNT
TQSTILARQLSAVNEALAAATVNRIAAASAVQSSNTPTTNGQSALRGRLADVESQLASARTTLGPQHPQVRALEAQQETL
RRALNGADGEASTQLANALQQAVLEERRLQDRFNSLRSQYLSQQGQGAQYGILEREVDTNRQIYAALLQRYNQLGVAGSG
SNNMTLIENARPAPGPYSPNMPLNIAIAVLASLLIGAGVVYAVELLDQSIRDPEDVQRQFGLPLLGLIPKSTDGEVHEEV
LERSSSTGEAYASARFALQHLDNADQLRTLMLTSARPGEGKTSSSLALAKSFADMGEKVVLVDFDLRRRGVSRLLGPAAS
DRGMLGFLKGSTPEPTFHSLTDYGVDFVGTSDIEREPVSLLTRPRIGALMNLLQSRYDRIVIDAPPVLGLADSVELAQSV
DGVVFVIEANVGSANAVRRALSRLRDANAPLLGSFVTKLDQRNALYGYGGDYGYGYSYSQS
>gnl|bykdb|A0A0H0H3B1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFAVCAVVYTFFATPIYSADALVQIEQNSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDDK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHARPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A0H0ZWI3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium sp. LC103] (length=792 residues).
MTYASFPFDGKMPAQPPGERNDDLIDIERLLRMALRQAKVVIVCAVIGLLLGVVYLQTTPPKYTAVARVLIDEGLSRITE
DAETTPLNMQSDGAVLSQIEILTSSRLAGNVVDHLRLTENENFMNPPSSLFGRIVGGLRGLVGYLRSQPEANDGDYDAET
LAAMKAAATRQYAIELLQKNVVANRVGRTFVVAVAYQSHDPQLAAEITNAYADAYLSHQLDASYEASERATVWLRDRLDE
LRAGSQNAALEVEKYRAEHGLSASQGQLLTEQQLTELTGQLIEAQADTAKTQARYQQYKAIVDAGSAEAVGNVAITSDQP
PTSTIATLKERYLNVTRREQEITRNYGEDHQQAVALRREQAELTRSIYAQLQQLTESYRNDFEVAQARETALRRTLSDAR
GESAEANQSRVVLRELEQQASALSALYQTFLSRYEETQQKQSFPIAKVRVISEATTPKAATSPRTSMVLGIALILGGMLG
GALGALNEFNERFFRTGEDVRDQLGMKFLGYLPLIGRAEVKGKTPAAPGASPDSKKAERATALMERRARMRVTVDAPASM
FAESLRNAKIAGDVVLQNSRSKVIGVVSVLPGEGKSTVASNLAELLALNNSRTLLIDADLRNPGLTRGLGIRSEAGLMEA
VVNLQNWRSLLKHDRQTNLAILPAVVRGQFSHTSELLSSPGMHQLIEQARESFEHIIVDLPPLGPVVDAKAFEPCADGFV
VVVEWGRTPRAVVRSTLASEPRIANKVLGVVLNKVKLASLPRYGSFGSSEQFLRRYSSYYLDNTETREKEPS
>gnl|bykdb|A0A0H1AN66 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Luteimonas sp. FCS-9] (length=768 residues).
MQDDHLPAVTGDDGHGERRLPAHGSGQLTPAGARGLSVELLEGKRGTGNEIDLLTYWRILVKRRWLVLGVLGAVVAVTLL
ATLLMPPVYRATATLQIDRETVQIMQVEGMTNAEGTSTPDFLTTQYELLRSRALAERVADELRIDRATVERLRATSWWQR
ASAALRPSAGNDATDTADENVADAVDEAAQDDGRADLAQGTALVRDGPTIEPVRNSRLVRVHFDSTLPGFSARVANAIAD
GFIESGVERRFGASSHASRYLEAQLALAKGRLEESERALVAFATRENIVGSGEGGLSLEGQNLSTLNTALAAAQDQRIQA
QALWQQVGGGGSLPAAAVGASIINTLQQQRAQLNAQYQQQLQTFKSDYPAMRALKEQIDEVGRQLQEERASVRASIKAEY
DAARARENMLLSQLAQLRTQALDVDNRSIDYNILRREVDTNRQLYDGLLQRYKQIGVAGGGGANNISIVDRAIVPASRFK
PSLPRNLALGLAIGLVLGALLAFLLEFLDDTLKSPDDVEQDLRLAVLGVIPRLKKQTVANAQADPRSAFSEAYRSVRTAL
QFSTDRGVPRTLLITSASAAEGKSTTALTLARNFAQLGKRVLLIDADLRNPSLHKTLEVRSETGLSSLLAGAAAMGKAVV
DTDDERLKVILAGPLPPNPAELLSGNRLLSLLTVAAEHYDQVIIDGPPVLGIADAPLLSNVVGGTLLVVQAGSTRRKTAQ
TALKRLLVARARVIGALLTHYDAKVAGQDDDYASYYAYGTSPRLTGNP
>gnl|bykdb|A0A0H1AN77 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Luteimonas sp. FCS-9] (length=746 residues).
MSKETGASPKDEDEIDLRELLGTLIDRKWWIIGITAVFFVASVAYALLATPIYQARSMVQVESKAPTIPGLPDLSSLGGG
VTSTAATTEVALITSRTVIGGAVDTTRADVIVEPARFPLIGGFLARRFSPETPDQVASPWFGLSRYGWGGEHVEIVGLEV
PSVLEGQPLTLRVGDDASRFSLLGPDDELLVEGTVGADAEGGGVRLQVAALRANPGTRFEVTKLRRLDVVAGYQQDVNAS
EQGRESGILQLAFEHPDPQFAEAFLQAVAAAYVRQNVERNSAEAGAQLEFVREQLPTVRLQVEAAQKAMNEYQTRANSVD
ITMQTQGLLQQEVAVETSIQQLRLQQAEMDRSFTREHPAYRALLKQIGELEARKAGFQKQVGQLPDTQQELLTLTRDLQV
SNELYTGLLNQAQQLDVARAGTVGNVRIVDPAVVDTQRPVKPRKSLIVLIGTLLGGFLSVALVFLQKLLNPGIEDPAQIE
ELGLPVYAAIPLSQARDLLIMDRLRNRKGRVRRDPGFDKRQHLLAVNAPADLAIEAIRSLRTSLHFAMLEAKNNILAISG
PRPAVGKTFVSANLAAVIAQAGQRVLVIDADMRKGTLHKVLGVPHAQGLSDVLGGKLDVAAAIRPADGVENMHYMVRGDI
PPNPSELLMHPRFGQLLETLSAQYDLVIVDTPPILAVTDAAVIARHAGSSLLVTRFGVNQPKEILLTKKRFEQNGVQVKG
VIFNAVEKRATGYYSYGYYEYKADKA
>gnl|bykdb|A0A0H1RE96 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Microvirga vignae] (length=624 residues).
MNLARNYSIKADYISTKTEAERQDLVDFGFILGAMKRQWLLIALAWFLFAALGVAYIVITPATFYASSSVIIDAKRIDPF
REDSGTASGAIDPGFIESQVATINSIAVVEDVVRRLGLQDDPEFGSGDDPTFNPISHVRAALKTALQSAGWLPPQPPNSN
DPIRIAVEKVKDNLDVHRGGLSYVIAIGFSSLDPEKAALIANAFSERYIEYQVASRLVGAGRTKDWLEERIEELRSRAAV
ADRAVAQFQPDGGSEAQVRLRELESNAQSYRTLYNNFLDRYARVVQEQSFSGSEARILTRAVPPTQRDAPIISIVMLMAS
SAGLALGTAGAFLREISDRKVKTTRQVESLANCDFLGFLPRFDVGSLDYAATRSVTSKLDGSSVAHHYQPLLSAVIHQPY
TRFTETIRNIVVTCNEIGRASRCKVIGVTSCIPHEGKSSVAVNLGHMFSRTGRRTLLIDLDFRFPYLTSALVDNPSRGIL
DLLESGGSLDDKLWIDAESGLHVLPGVSGEPEAAAHEMLGSRRMKQLMDDLSAHYDVIVLDMSPIAPSVDVRAAAHLLDG
VVLVVGWNMLTADVLRRTIETSGEIKSKIIGAVLNKVDEKRVRSYDSSYDESYWVGYYGPNLKK
>gnl|bykdb|A0A0H2M210 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Variovorax paradoxus] (length=754 residues).
MNTPAVNTSNAARAGQPATSLPARTDDDEINLSEWIDILIDRKWLVVAVTTLVLALGVAYALLSTPVYQSNLLIQVEDSA
ADAKGFLGDASSLFDVKTPATGEIQVIRSRMVLGAAVDQTRFYIDAKPRYLPVFGAWLARQADGLSDPGFLGIGGYVTGK
ERIGIARFNVPAELEDEDPFLVTAQGGGKYTLKHEALDQLLTGVVGQPLHHALEGGTIDLLINKLEGKPGAQFVVSRASQ
LRTIEDLQKRVQLSEQGRQSNVISAVLEDSDRDRLSGILNAIGDQYVQQNVERKAAEAQKTLQFLNEQLPEFKRQLEASE
DAYTRFRNKNGTVAFDEEAKGVLAQTIELQTKLLETQQRRREMAARFTDANSRVKIIDGQIAAIDKEIGGLNARVSRMPT
MQQDALRLERDVRVNSGLYQSLQNNALQLRLVKEGKTGNVRLLDKAVKPKEPIKPQKPLVLALSLALGLLAGVVLAIARG
SFFAGIRDPQEIEAHTGLTVYSVVPFTAEQTVLDQSVAEGARGIQLLAVTHPESPPIEALRSLRIALQFATLEAGNNRVL
ITGATPGIGKSFVSGNFAAIMAHAGKRVLLIDADMRKGHLNKQFGLPREDGLSELLAGELSAQQAIRSQVLPNLDVLTTG
KLPTNPADMLMSESFVRMLDMLSAQYELVVIDTPPVLVAADTAAVAPYMGAVLLVARADQTQLGELKESAKRLAHAGKTV
SGVIFNGIDLTRRHYGSHGYRYGGYRYTEYKYNA
>gnl|bykdb|A0A0H2M3H2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Variovorax paradoxus] (length=750 residues).
MNAPQQAALPMPALEEENDGFKLVEYLDILIDHRWFISIVVAVTLLLGMAYALFGQPMYETNVAVQVEDSGNSAGSFLGD
AASSLLSVKTPAAGEIEIIKSRAILGQAVENTKLYISAQPRYAPIVGSWLARRATDLSDPGFLGFSGYVTGAEAIMVPQF
DVPADLEAKQFMLTLGPDNRYELLVPNVETPLKGTVGTPLVASVPGGSLRLLVSSVSAKPGAQFQLARYSRQLALLSLQD
NLKVVEKGKQSGVLDVSLKSPNPEKLTQLLNEIGRLYVRQNIERKAAEAEKTLGFLDTALPQFKKQLEQSEDLYNRYRNE
NGTVSLDDEAKNALAQTVDLQSKLLEAEQKRRELSARFTDKHPNLQTLDAQISAWRSQISAVDSRIRKMPLLQQNTVQMQ
RDIKVNTDLYVSLLNSSLQMRLAKEGKVGNVRLLDDAILPEEPVWPKRPLIIALALLLGLAAGVVLAIVKNSLFGGIRNP
SEIEMHTGLNVYSSIPLSAAQRMIDKNIENRAPGMHVLALQQSEDPAVESLRSLRTALQFAMLEAPNNRLLISGATPGVG
KTFVSVNFAAITAASGKKVLLIDADLRKGRVNQFFSLSRSSGLSELIAGTLSFEKAIRSSILPNLDVITTGVLPPNPAEL
LMSDSFSQILEKLSPDYDLVIIDTAPVLVAADTASVAPLAGSLLLVARAEKTHLGELNESVRRLAHAGCSANGVILNAMD
LSRRHAGSSSYKYGGYRYTHYKYKNNRDTT
>gnl|bykdb|A0A0H2MP95 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Variovorax paradoxus] (length=764 residues).
MNAHWQPALPAPSAPEVAASDTPPSRLREHVDLLLDSRWKIAGITAVALLLGAGYAMFGPRVYEANVLIQVEDPDRSGGT
LVGDSASNALNAKTPTAGEAEILKSRLVLDQAIENTKLYIEAQPLYVPVVGAWLARRAKTLSEPGFAGLSGYVSGNEQIV
VAQMDVPTDLEGKRFLLTAGADGSYTLTHPKLDKPMAGSVGVPLDAQTPLGPIHLLVGSIAGRPGAAFELVRQSKQLVLL
ELQRELRVIEKGKQSSVMEVSWRDGNRMQLANLLNEVAQLYVRVNIDQKTAQAQRALNFLGSELPKLKQQLEQSEQTYNQ
YRNQNGTISLDDEARNALSQNLELQTKLFDATQKRIELTERFTARDPSVMTIDAQIASLRKALGGVEQRIRRMPMLQQDS
LRMQRDIKVNTDLYVSLLNSSLQMRLAKEGRIGNVRVLDQALLAEKPIRPKASIVMGIALIAGLSFGAGSAFLRRSWRKT
IASPAEIETHTGLDVYSTVTLSAHQYLLDRAICNGKPGVHLLAAQHPDDPALEGLRRLRTALKFAMPKASDNRLMISSAT
PGAGKTFVSANLAAVLASTGRRVLLIDADLRRSSLAAVFGLKRRGGLSELIQGSIEFQNAVHAGVMAHLDVMTTGALPTD
PSALLTSDAFARVLEKASARYDVVIVDTPPMLLASETAEMATCMGTLLMVARAGDNELGDLSESAHQLRHAGAQFQGVVL
NAMDTRQRYYGKLAYRYGGYQPRVHEYPRAVAELPQPAHASAAS
>gnl|bykdb|A0A0H2N3V4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio sp. VPAP30] (length=737 residues).
MNSQSETVPHSQLLDLGYYIHLIKTRWLPIVIFAVLCSAITVLVVLSITPVYKATATLLIDSSTKKAVSIEEIVGFDTST
KEYYQTQLEILKSNQVAQRVIDKLDLASVEEFNASLRQVDPGLFSQLKSALSELTVLKAYLSEKDREQSAQIDEEQQVNR
KVLKAFKAKLSIEPIRKTQLVKISFEAEDPKLAAQIANEVGHAFIENNLESKLLATEQATSWINSRLSELKNKLDESETK
LLAFLKQQELIDDSGIVALTSSELSNLTDRIAKAIEKRIETQSIYSALRKSESKEVAALASIPLISNHPQIRDIRQAESE
AVKRVSELSKRYGPKHDKMIQAQAQLETISLRANRVVAKLVNGIEKELASAVNQEMLLREELLAKKDEFQSLSIVKREYD
VLKRDVDTNAKLYDLFLTRQKEASATSDFSSSNARFSDYALIPESPSKPNRKLIVALAFALSLGFALVVVIAQDAFNNTI
ESSRDFENKLGLLPTGTIPKIKDKMYKKSPLDSSVFGNNKFVVFQESIDSIRTSLVLSLHNTQRKLIAVSSSVPGEGKTT
TSVNLALSFSKLEKVLLIDCDLRKPSIAQRFKLNPSTPGLVNHLLMNHPLEESITSIEGSNLDVMSAGMVAPDPQELLGS
QGFAEMIRDLETKYDRIIIDTPPILPVKDSFIVGKITGGIILVLKANSTTKSVYKHTMTLFTKHTIAIDGVVLNQVPAPK
KGKHTYSEYATYAYGQS
>gnl|bykdb|A0A0H2QI42 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Moellerella wisconsensis] (length=692 residues).
MNTTKSPSTAADEIDLLALFKVLKSHYLIIGFVTLFFLLLGAAYSFLATPIYQANATLQFDKQSQVSFFDQMGDLSPFSG
GGNQVDSEIEVIKSRMVLGKTVTDLNLDTQVSTDGFFNKLWGNNPQINITHYSIPDALVGEPATLTYLGDNQFSLKLEDI
VLKGKIGELVQHNDISLLISSIEAETGEEFTLTKNGRYSTIDELRNTLNLSEVGKGTGIISLTIKGADKTENVRILDSII
QNYVAQNTDRKKEVTNNTLIFLDDYLPKVKAKLDNYENQLNTFRKKNESIDLSLEAKSALESALQVEDKLNELTFKEIEI
QQLYTRNHPAYQSLIDKRQKLLNEKALISKNIQKLPNTQQQIVRLTRDVESEQAIYNQLVGKQQELSVMNSGITADVRVI
DSAESQPQPVAPKKSLILALSLILGFIIGCAYVIARELFNNKIKGTEDIDALGVNVYATIPFSSHEKKLIMNGNMKPLAL
ENPADTAVEAIRSLRTSVYFSVMNQGNNLVMVTSASPGAGKSFITSNMGVVLANAGKKVLLIDTDLRKGLIHKAFDLDNK
LGLSEYLSQMDSNKPVIHHNVIENLDVICRGKNVTHSSELLMSERFKDMLDNLKSQYDIVVIDTAPILAITDAAVIGKYV
GTSLLIAYYGVNTVKDIELSLKRFKQNDIEITGVILNGIDARSDDYNYVYEY
>gnl|bykdb|A0A0H2V0J1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Shigella flexneri] (length=732 residues).
MGAGIERRAGIRMTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITVVFALCAVVYTFFATPIYSADALVQIEQNS
GNSLVQDIGSALANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMA
DQVFTLNVLDDKNYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHARPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAG
VLSLTYTGEDREQIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKA
VLDSMVNIDAQLNELTFKEAEISKLYTKVHPAYRTLLEKRQALEEEKAKLNGRVTAMPKNQQEIVRLTRDVESGQQVYMQ
LLNKEQELKITEASTVGDVRIIDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYA
SIPLSEWQKARDSVKTIKGVKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLA
AVISQTNKRVLLIDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAEL
VNWASKNYDLVLIDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDY
GYYEYEYKSDAK
>gnl|bykdb|A0A0H2VB13 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli O6:H1] (length=732 residues).
MGAGIERRAGIRMTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCSVVYTFFATPIYSADALVQIEQNS
GNSLVQDIGSALANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMA
DRVFTLNVLDDKNYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHASPGSEFTVTKYFTLGMINQLQNSLTVTENGKDAG
VLSLTYTGEDREQIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKA
VLDSMVNIDAQLNELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQ
LLNKEQELKITEASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYA
SIPLSEWQKARDSVKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLA
AVISQTNKRVLLIDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAEL
VNWASKNYDLVLIDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDY
GYYEYEYKSDAK
>gnl|bykdb|A0A0H2VY19 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Shigella flexneri] (length=732 residues).
MGAGIERRAGIRMTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITVVFALCAVVYTFFATPIYSADALVQIEQNS
GNSLVQDIGSALANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMA
DQVFTLNVLDDKNYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHARPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAG
VLSLTYTGEDREQIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKA
VLDSMVNIDAQLNELTFKEAEISKLYTKVHPAYRTLLEKRQALEEEKAKLNGRVTAMPKNQQEIVRLTRDVESGQQVYMQ
LLNKEQELKITEASTVGDVRIIDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYA
SIPLSEWQKARDSVKTIKGVKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLA
AVISQTNKRVLLIDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAEL
VNWASKNYDLVLIDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDY
GYYEYEYKSDAK
>gnl|bykdb|A0A0H2WMX0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Salmonella paratyphi A] (length=719 residues).
MTEKVKQSAAVTGSDEIDIGCLVGTVIEARWWVLGTTAIFALCAVIYTFFATPIYSADALVQIEQNAGNSLVQDINSALA
NKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVTKNTFPLFGAGWERLMGRHNEMVKVTTFTRPETMSGQIFTLKVLGDKR
YQLVSDGGFSAQGVVGQPLNKDGVTMRVEAIDARPDTEFTVSKFSTLGMINNLQNNLTVTETGKDTGVLSLTFTGEDRDQ
IRDILNSITRNYLQQDIARKSEEAGKSLAFLAKQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQLN
ELTFKEAEISKLFTKAHPAYRTLLEKRKALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITEA
STVGDVRIVDLAITQPGVLKPKKALIILGSIILGLMLSIVGVLLRSLFNRGIESPQALEEHGISVYASIPLSEWQKARDS
VKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMLTGVSPSIGKTFVCANLAAVISQTHKRVLLI
DCDMRKGYTHELLGTNNVDGLSDILAGKGEIASCAKPTAIANFDLIPRGQVPPNPSELLMSERFGELIAWVSSRYDLVLI
DTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFDQNGIQVKGVILNSIFRRATGYQDYGYYEYEYQSDSK
>gnl|bykdb|A0A0H2XY28 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia cenocepacia] (length=741 residues).
MVNTQAKHSYADLTAKTEEEDFVLGQLLQVIMDDIWLLIGIAVTVVALAGLYCFIAKPVYQADVHVRVEGNDNTSQALTQ
TQTGASINSGPQQAPTDAEIEIIKSRGVVTPVVEQFKLNFSVAPKTLPVLGSLAARLATPGEPSRPWLGLKSYAWGGEVA
DVDSISVVPALEGKKLTLTAGPNGTYSLVDENGTRLLAGRVDEAAQGGGVTLLVRKLVARPGTQFTVVRYNDLDAISGFQ
AGIQVSEQGKQTGVVQISLEGKDPDQTAAIANALAQSYLNQHVVAKQAEATKMLDFLKGEEPRLKADLERAEAALTQYQR
TSGSINASDEAKVYLEGSVQYEQQIAAQRLQLASLAQRFTDSHPMVIAAKQQLAELQGEKDKFSNRFRSLPATEVKAVQL
QRDAKVAEDIYVLLLNRVQELSVQKAGTGGNIHLIDSALRPGAPVKPKKVLILSAAVFLGLILGTGVVFLRRNLFQGIED
PDRIERTFNLPLYGLVPQSAEQVKLDAAAEKGGSRARPILASLRPKDLSVESMRSLRTAMQFAMMDAKNRVIVLTGPTPG
IGKSFLTVNLAVLLAHSGKRVLLIDADMRRGMLDRYFGLTVQPGLSELLSDQSPLEEAIRETPVQGLSFIAAGTRPPNPS
ELLMSTRLPQYLEGLGKRYDVVLIDSPPVLAVTDATIIGRMAGSTFLVLRSGMHTEGEIADAIKRLRTAGVDLEGGIFNG
VPPKARGYGRGYAAVHEYLSA
>gnl|bykdb|A0A0H2Z086 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli O1:K1 / APEC] (length=732 residues).
MGAGIERRAGIRMTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQNS
GNSLVQDIGSALANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMA
DQVFTLNVLDDKNYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHARPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAG
VLSLTYTGEDREQIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKA
VLDSMVNIDAQLNELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQ
LLNKEQELKITEASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYA
SIPLSEWQKARDSVKTIKGVKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLA
AVISQTNKRVLLIDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAEL
VNWASKNYDLVLIDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDY
GYYEYEYKSDAK
>gnl|bykdb|A0A0H3AJP6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio cholerae serotype O1] (length=737 residues).
MTGKQFTQEEVIDIRQYFNVLLNYKWRILLFSVMVTAITLLFVLSMRSEYTARATILIESTQAKAVSIEEVYGLDTKSQE
YYLTQIEILKSDTIAQEVIERLDLASDPEFDLSPESDASPSLKERLVEWMPFLQGFKQEETVADPDLEAYRQNRLILYKF
KRGMEISPIRKTQLVNIYYTAGDPKLAAKIANEIARVYMDSHLEAKLEVELKANTWLNTRMEELRTQLRESEAKLQAFLQ
AEGLVDVQGVEGLATQELEELTSQMNKARDRRVAAETLYQVANSYSKNDSDLTALSSIPEISNHPTIRDLKVAEVDAERK
VSEFSKRYGPKHPKLKSASAQLEAVRKNLRAELRQLLNGINNELQAAKQSERSLQTEFNQRKSEFQTLTVKNAKYSELKR
EVQTNRELFDLFLARQKETSASGDFNTTIARFTDQASAPLTPSKPNKKLIVLLAFVVSFGFACVVAFIADAMTDTFADIK
QVEKQLALSLLGVVPVVRKQRGKLDAKAYFDEKLRELTEAVRTIRTSYLLAHVNQDQHVVMLTSCLPGEGKTTSSLNLAL
SLAQMEKTLLIDCDLRKPAIAHRFGISGSQPGVTNLLNGTQSLEDCVYHDEQSGLDILTAGVYASNPLELLSSSKFSELL
ADLRTRYQRIVIDTPPCLAVSDSFMLAQYVDSVILVIDANHTRTPVVREVVGKLTQQGSRIDGVILNRLNAKKASRYSGY
YHYQAYYGEETKSGAAK
>gnl|bykdb|A0A0H3BW19 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Salmonella newport] (length=719 residues).
MTEKAKQSAAVTGSDEIDIGRLVGTVIEARWWVLGTTAIFALCAVIYTFFATPIYSADALVQIEQNAGNSLVQDINSALA
NKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVTKNTFPLFGAGWERLMGRHNEMVKVTTFTRPETMSGQIFTLKVLGDKR
YQLVSDGGFSAQGVVGQPLNKDGVTMRVEAIDARPDTEFTVSKFSTLGMINNLQNNLTVTETGKDTGVLSLTFTGEDRDQ
IREILNSITRNYLQQDIARKSEEAGKSLAFLAKQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQLN
ELTFKEAEISKLFTKAHPAYRTLLEKRKALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITEA
STVGDVRIVDPAITQPGVLKPKKALIILGSIILGLMLSIVGVLLRSLFNRGIESPQALEEHGISVYASIPLSEWQKARDS
VKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMLTGVSPSIGKTFVCANLAAVISQTHKRVLLI
DCDMRKGYTHELLGTNNVDGLSDILAGKGEIASCAKPTAIANFDLIPRGQVPPNPSELLMSERFGELIAWASSRYDLVLI
DTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFDQNGIQVKGVILNSIFRRATGYQDYGYYEYEYQSDSK
>gnl|bykdb|A0A0H3C4L4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Caulobacter vibrioides] (length=739 residues).
MDGSRFETSNAPVNDTGALSFDLNIAIATFRRRFRLFAAVAVVVFAAVVLFTLQQTPKYTAIAQVMLDVRQEQVTDMSAV
LSGLPADSSVVDTEVEVLKSRSLAARVVKELKLEQDPYFNPYLSNAEGAGAWLSTVRKAAAPLDNVDSVELQRRSERIVD
SVLGGLKVRRAGLTYLISIEYTHKDPKRASELANAFANLYLTEQLEAKFDATQKANEWLDTRVGELREQVQAADAAVQQY
KIQNNLLSAEGATLTEQEISSLNQQLALSRASQAETDARLNIARQQLARGSTGEDVGESLNSPVVQQLRKQRSEKSAQVA
DLGGRYGDRHPELLKARRELADIDGQIQAEIRRIISNLEAQAQVARQRTGSVASSVAASKGTLAGNNRASIGLAELERKA
QSVKTLYETLLSRFKQTTTQEGIEQADARVVSPAKIPTRPSYPKPTLNLALGLVLALGAGVAAVVLAEILMAGLFTEDEV
ERRLGLPYLGAVPSLGTTVDDSKTLKGMTPPDYLLVKPLSSFAESLRKLRASILFSKVGETVQVIAVTSSLPGEGKTTTT
FSLARTLATSGAKVIVVDCDLRQSAISQFLKEPAPVGLLEVLNGVATLDQAIINDESGAHILPLAKSSYTPRDVLGSSAM
HRLLGELRGRYEIVLLDTAPLLAIADTRILAPHTDAVVMLVRWKKTPVKAVQSALALLQGTRAFIAGVALTQMDLKAQSR
YGYGDSYYYYANYRKYYAD
>gnl|bykdb|A0A0H3CG22 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Enterobacter cloacae subsp. cloacae] (length=715 residues).
MFDKQISNSQTDNVPRQEDIDIVQLLKVLYYSKVWIAATTLLFIAFGIVIAYTLAPVYKSDALIQVERNASTGLLNKLST
MLPEGSGVASESEISLIKSRMVIGKTVRDLGLDISVTEKRYPFANGLLLRLLGKPTGNIEVSTLTVPEEFLNEALILTIT
AAGEYTLQVGEAVLHGKVGVPLHAHGIDFMIERAELTQDTVFILRKHNEYSVIDEIKNNIVVDGKSGGNGMLHLSMTGTD
PVMISKILETISHNYLAQDVERKSEEASKSLAFVNEQLLQIKNNLVTAETKLNDFRKNNESVDLSLEAKFILDNVVSIDT
QLNELTFKEAEISKLYKRSHPAYKALSEKRAVLQEEKEKLNQRISTMPRTQQEILSMTRDVQMGNDIYMVLLNKQHELNI
NKASTLGNVRIIDNAVTQHKPIKPKKTLIVILSALLGFLFASGVILLRNMLIKGIKQPAELEKRGIPVHAVVPLAPELTK
SRRCRAITTYQSDELLVKSSPTSLAVEAIRGLRTSLHFAMLKSENKILMISGTSPGVGKSFVSSNLAVLMAQAGSRVLLV
DCDLRRGYLHSIFSQAEGHAGLADYLSANVAVSQVIEETEYQGVDFIGRGRMVNNPAELFMTEKFQTLVDACSAQYDVIL
LDTPPILSVTDAAIIGRFASTSLMVVRFEQNSVQEVEAGLRRFNQNGIAIQGVIFNGVEKRASATYSYGDYSYQE
>gnl|bykdb|A0A0H3CP51 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Enterobacter cloacae subsp. cloacae] (length=732 residues).
MSSYTTDSYGAAAPENHEIDLISLLGEVIDHRAVILSITFLFTLLAGLYAFLATPVYRADALIQVEGKQDNSLLKNLRQF
GSEMSPDVEPEILLLKSRMILGATVDELGLTQHVTQRTFPVVGRLWARLQGRKPATVALGWLQLPPVEGKPRTLVLTVLE
KGAYRLEGDNFYAEGREGKPLEKAGVSLLVVKMNAPTGTQFTVQNSTRLEAINTLSTQFSVVESAKQSGVLTLTLTGNNP
ERIAHVLDRIANNYLQQNIARQEAQDARSLAFLQKQLPKIRSELDLAEERLNQYRKQRDSVDLSLEAKSVLEQIVNIENQ
LNELTFREAEISQLFKKEHPNYRALREKRQTLEQEKVRLNQRVAAMPSTQQDILRLSRDVESGRTIYLQLLTRQQELNIS
RSSAIGNVRIIDSAVTQPDPIKPRKLVVIVLGILLGLICSMGLVLVRMALRRGINTSEQLEGLGVQVMATLPRSQWLWKK
TNLRKKRVFGSRWRHKIVDVPFLPVDRPADVFVEAVRGLRTSLHFTLQDAANRIVMISGPTQDCGKTLVSTSLAAIEAQA
GLRVLFIDADMREGYVHNIFDLKNHTGLSDVLDGKCHFQAAIQRYEKGNIDVLTCGPVPLRPSELLMSERFRALMTWADE
HYDLVILDTPPVLAVTDASVAAPVAATSLLVARYGKTSLKEMENSIKRLQQTGAHINGTVLNDVVKSAALYYRAGYGHYE
YGQRPTRQPRKD
>gnl|bykdb|A0A0H3CQW1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Enterobacter cloacae subsp. cloacae] (length=720 residues).
MTEKTKPSAAPISGSDEIDIGRLVGTVIEAKWWVLGITAVFAAAAIVYTLFATPIYSADALVQIEQNTGNSLVQDIGSAL
ANKPPASEAEIQLIQSRLVLGKTVHDLGLDISVTKNTFPIFGAGWDRLTGHSNDTVKVTDFVLPKGSADQTFTLTVLGPK
QYQLTSDAGFSARGEVGQMLTKDGVSMKVSAIQAQEGSEFTVTKFSTLGMINNLQNNLTVTENGKDTGVLSMTFTGEDKD
QIREILNSITRNYLEQNVERKSAEAAKSLAFLARQLPEVRARLDDAENKLNAFRQDKDSVDLPLEAKSVLDSMVNIDAQL
NELTFKEAEISKLYTKRHPAYRTLLEKRRTLEEEKAKLNDRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITE
ASTVGDVRIVDPAITQPGVLKPKKALIILGSIILGLMLSIVGVLLRSLFNRGIESPQVLEENGINVYASIPLSEWQKSHD
RVKSVKGVKRYKQSQLLAVGNPTDLAIEAVRSLRTSLHFAMMQAKNNVLMLTGVSPSIGKTFVCANLAAVVSQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILLGKGEISQSAKPTSIPKFDLIPRGQVPPNPSELLMSDRFAELVEWASKNYDLVL
IDTPPILAVTDAAVVGRLAGTTLMVARYAVNTLKEVETSLSRFEQNGIEVKGVILNSIFRRATGYQDYGYYEYEYKSDSK
>gnl|bykdb|A0A0H3EIP0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli O83:H1] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTIIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQSSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWERLMGRQNETVKVTTFNRPKEMADLVFTLNVLDDK
NYTLSSDGGFSARGQAGQMLKKEGITLMVEAIHASPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRNRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVKWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A0H3FDR9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rahnella sp.] (length=723 residues).
MSPAISKKPASPDSDEIDLGRLFGEIIDHRKLIITITAIFTVLALIYALFATPIYQADALIQVEQKQGNAILESLSQVLP
DSQPQSAPEIALLQSRMILGKTVDDLNLQALVKQKYFPVFGRGWARMTGEVPGKLSIGRLYLPASGSGMPKITIKVIDNN
NYLVEGDDFKIKGIVGEVFSEKGISLLVNDIQSAPGTKFDVYYLTRLRAINDLLNAFNVNDQGKDTGILNLVMNGDNKEL
ISATLNSISQNYLDQNIARQAAQDAKSLDFLERQLPQVRSDLNASEDALNTYRRQKDSVDLSLEAKSVLDQIVNVESQLN
ELTFREAEISQLYTKDHPTYKALLEKRQTLVKERERLNKSVSAMPATQQEVARLSRDAESNRAIYMQLLNRQQELSIAKS
SAIGNVRIIDDAVTEPTPVKPKKLLVVLIGIILGGVFSIGIVLLRVFLHRGIESPEQLEELGINVYASVPLSELVRKKSI
PINGKSKNNKENTFFLAQENPADLAIEAIRGLRTSLHFAMMEAKNNVLMISSASPGAGKTFISTNMAALLSMGDQRVLFI
DADMRKGYVHKLFKGGLENGLSDILVGKCTIEQGIKKVHSVGFDYISRGNVPPNPAELLMHPRFQQLIEWASNNYDIVVI
DTAPILAVTDAAVIGRYVGTSLLVARFEVNTPKEIEISIRRFEQSGVAIKGCILNGILKRSGSYYGYGYNHYGYSYSDNK
TES
>gnl|bykdb|A0A0H3FYJ2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella aerogenes] (length=720 residues).
MPSAIKKPNTVDTNDIDLGRLIGELIDHRKLIIAITSLFTLIALVYVLFATPIYQADAMIQVEKKQANAILSNLSDILPN
GQPQSAPEIALLQSRMIIGKTVDDLNLQAVISRKYFPIFGRGWSRLMGNSDGDINISQFSIEGSTESLPLNFNIEVIDSS
HYKFSGDGIEFEGVVGQLKQSSGVSIKVNSIDANPGNEFTLTYISRLQAITNLQNNFIVMDEGKDSGILTLTLTGDNPVQ
VKKIIDHISYNYLAQNISREAAQDAKSLEFLNQQLPQVRNDLDNAEDKLNAYRRQNDSVDLSLEAKSILDQIVNVDNQLN
TLTFREAEVSQLYTKEHPTYKALLEKRKTLQEEKGKLNKKVAEMPKTQQEILRLNRDVDSGRAIYMQLLNRQQELNIAKS
SAIGNVRIIDDGITQPKPVKPNKILVVLLGIILGGMVSVAIVLIRVFLRRGIETPEQLEELGINVYASIPVAERNIKSAR
YNKGIFDGKHQIQDLLAIDNPADLAIEAIRGLRTSLHFAMMESRNNVLMISGASPNAGKTFVSSNLAAIIAQTGQKVLFI
DADLRKGYSHKLFKVDNEKGLSDFLSGQVKSENIIKSVTSVGFDFIPRGMVPPNPAELLMHKKFGELIGWANEHYDLVIV
DTPPILAVTDAAIIGNYVGTTLLVTRFEQNTAKEIEVSIKRFEQSGILVKGCILNGVVKKASSYYGYGYNHYGYSYTDDK
>gnl|bykdb|A0A0H3GVU7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella pneumoniae subsp. pneumoniae] (length=718 residues).
MTSVMNNKPSPVDSDDIDLGRLIGELIDHRKLIVAITTGFTVIAVFYALLATPIYQANALVQVEQKQGNTILSNLSQILP
DSQPQSAPEITLLQSRMILGKTVDDLGLQTQIKQKFFPVIGRGLARIMGNKLGAIEVKDLYLPDNKSGENPEVILTVIDK
DNYSIEADGFDFNAKVGELVEKNGMSILVTTIEAEPGSKFSINYLTRLKAMNMLQNSFGVADQGKDTGMLTLTMTGDNPQ
QITKILDSISQNYLAQNVERQAAQDAKSLDFLNQQLPKVRNDLDQAEDKLNAYRKQRDSVDLTMEAKSVLDQIVNVDNQL
NEITFREAEISQLYTKEHPTYKALMEKRQTLQNEKTKLNKKVSSMPSTQQEVLRLSRDVESGRAVYLQLLNRQQELNIAK
SSAIGNVRIIDNAVSEPKPIKPNKPLIVVVGFIFGLLFSVGMVLLRILLRRGIESPEQLEEMGINVYASVPVSEWLSKNL
AKNKINRKESDILLAVENPADLAVEAIRGLRTSLHFAMMEAKNNILMISGASPNAGKTFISTNLAATIALTGKKVLFIDA
DLRKGFVHKMFGGNNEHGLSDILSGQTTLDNSLKHVKEGGFDYIGRGAVPPNPAELLMHPRFETLLKKVSNEYDLVIIDT
PPILAVTDAAIIGRYAGTTLLVARFEINTPKELMVSVKRFEQSGITIKGCILNGIVKKASSYYGYGYSHYGYSYEDKK
>gnl|bykdb|A0A0H3HC05 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella oxytoca] (length=721 residues).
MSSVKSRPVEKETDEIDLGRLVGELIDHRKLILSVTALFTLIALLYALFATPVYQADALLQVEQKQGNAILNSLSQMLPD
SQPQSAPEIALLQSRMILGKTVDDLNLQARVQQKYFPIFGKGWSRLTGKRAGSVTVSRLYLPSDGGSDTPSLKLTVKDKN
HYSVIFNDKQMSGEVGSLLDMNGIALKVDQIEAEPETEFVISYVSKLEAISDLQDMFSVVDQGKDTGMLNLSLSGPDPLL
LEKILDSISNNYLAQNVARQAAQNAKSLEFLNVQLPKVRNELDIAEDKLNQYRRQKDSIDLSLEAKSVLEQIVNVDNQLN
ELTFRESEISQLYTKEHPTYKALMEKRKTLQEEKARLNQRVSAMPKTQQDILQLSRDVDSGQAVYMQLLNRQQELSIAKS
SAIGNVRIIDNAVSQPKPVKPKKVIVLFVGIILGGMVSVGLVLLRVFLRRGIESPEQLEEIGINVYASIPVSETFVKRSQ
QSVRLKKKTEIGYQAFLAVENPADLAIEAIRGLRTSLHFAMMEARNNVLMISGASPNAGKTFVSSNLAAVVAQTGQKVLF
IDTDMRKGYTHKLFNLDNENGLSDILSGKTELNKAVKTVSNAGFDYISRGAVPPNPAELLMHRRFGELINWASGIYDIVI
LDTPPILAVTDAAIIGHYVGTTLLIARFEQNTTKEIEVSFKRFEQSGVMVKGCILNGVMKKASSYYGYGYNHYGYSYTDD
K
>gnl|bykdb|A0A0H3HGW4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia pseudomallei] (length=746 residues).
MNPNPTGTSTPADSEGDTDFIAVLDILIEGRWLIAAIALGVFIVGVAYAVFSKPVYQADILIQVEDSPDTSAAKSLLGDV
SSLFDVKSSAAAETQILASRLVVSRAVDNLKLFIDAKPKRFPVIGHWLARRSEGLSDPGLAGFGGYAWGQERIDVATFDV
PRAMEGDTFELTMLDARRYRLDGGDLERGAVGVVGRLERIAAKGGPIALRVDAFAAKPGATFVLVRHSRLRTIEALQDNL
DVQERVKQSDVVVASLRDTDPDLVSRALNEIGRQYIAQNIQRKSAEAAQSLEFLNGQLPTLKQQLTDSEARLTKLRDEHG
SVDLTEEAKLVLAQSADAKTRLLELQQKRRELLSRFMPKHPSVVAIDQQIAALDGYRGTAEQQIKRLPALQQQFVRLMLD
VKVNTDLYTALLNNMQQLQLVRAGKVGNVRLVDTAAVPEVPVKPKKALVALASLLLGVLAGCGTAVGRSMLFHGISDPNE
IERRLGLSVYATVPRSDRQRALTERAKHKARALSLLCVAHPDEPAVESLRSLRTALQFAMLDAKNNVVVIAGPAPGVGKS
FVSANLAAVLTMAGKRVLLIDGDIRKGHLNDYLGLARGKGFSELIAGSAQPDDVLHRDVIAGLDFISTGAMPKNPAELLL
NARVSTLIDTFSQRYDAVVIDSPPVLAVADTGILAATAGTAFLVTLAGSTKLGEIAESAKRLAQNGVRLSGVVFNGINPR
LGQYGYGSKYGGYRYVAYEYGAKRDA
>gnl|bykdb|A0A0H3HZ46 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia pseudomallei] (length=739 residues).
MVNTQAKHPYADLAVKTDEEDVVLGQMIQVILDDIWLLLGIALVVVALAGLYCYVAKPLYSADAQVRVEASDNTSQALTQ
TQTGAMINSGPPTPPTDAEIEIIKSRGVVAPVVEQFKLNASVTPNTLPILGAIAARLATPGHPGKPWLGLSSYAWGGEEA
SIDSIDVTPVLEGKQLTLTAGADGGYALADPDGAVLVRGKVGEREQGGGVTINVSKLVARPGTRFTVVRQNDLDAITAFQ
SAIQVAEQGKQTGVIQISLEGKDPEQTAQIANALAQSYLHQHVTSKQAEATKMLEFLKNEEPRLKSDLERAEAELTQYQR
TSGSINASDEAKVYLEGSVQYEQQVAAQRLQLAALAQRYTDEHPLVVAAKQQLGQLEAERAKYDGKFRGLPATEVKAVAL
QRNAKVAEDIYVLLLNRVQELSVQKAGTGGNIRLVDAALRPGVPVKPKKVLILSAATLLGLILGTSVVFLRRNLFHGIED
PDRVERAFNLPLYGLVPMSAEQARFDAADKGNRVRPILACARPKDLSVESLRSLRTAMQFALMDAKNRVIVLTGPTPGIG
KSFLAVNLAALVAHSGKRVLLIDADMRRGSLDRHFGTGGRRGLSELLSDQVALEEAIRETSVPGLSFIPSGARPPNPSEL
LMSPRLSQYLDGLAKRYDMVIVDSPPILAVTDATIFGELAGSTFLVLRSGMHTEGEIGDAIKRLRTAGVQLQGGIFNGVP
ARTRGYGRGYAAVHEYLSA
>gnl|bykdb|A0A0H3I799 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pectobacterium parmentieri] (length=723 residues).
MTEKTSVKVSETHSDEIDLGRLLGTLLDNRWLIIGVTAVFTVLGIIYAMLATPVYKADALIQVEQSSGNSLLNDISSMLP
DAKPQSAAEVELIKSRMVIGKTVNDLVLDINVQQKYFPLVGKGLARLAGNEPGKIAVSRLDVPASWQDETLLLEVLPNQQ
YAVEAGDVVKFTGTIGQLENHNGITLLVSDIVAEPGTIFRIQKLNQLTAINDLLENFTVADKGKDTGVLALSLEGEAPVL
TTKILSSISQNYLQQNVERKSEEAGKSLEFLKEQLPNVRSSLNDAENKLNQFRQQNESVDLSLEAKAVLDTTVAVEAQLN
ELTFKEAEISKLYTREHPAYRALMEKRKTLQQERDKLNKRVGAMPKTQQEILRLTRDVQAGQEVYMQLLNKQQELNINKA
STVGNVRIIDNSVIQPKPVKPKKTLIVLIAMILGGTISTAFVILKTLLHKGIESPEQLEELGINVYASVPLSEWQQKKDR
ALLGKKNKKGNTRATDLLAVGNPADLAIEAIRSLRTSLHFAMMEAKNNVLMISGASPAIGKTFVSANLGAVIAQSGQRVL
IVDCDMRKGYAHELMGTHGADGLSDILSGQCKAEKSVRKTAVENMDFIPRGQVPPNPSELLMHSRFTEFLKWAGEHYDLV
LLDTPPILAVTDAAIISRHAGTSLLVARFEMNTLKEIEVSIRRFEQNGAEIKGVILNAIMKRAASYYGYGNYDYYTYEYK
SKS
>gnl|bykdb|A0A0H3KJS9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia multivorans] (length=741 residues).
MVNTQAKHSYADPTAKTDEEDVVLGQLLQVILDDIWLLLGIAVAVVALAGLYCYVAKPVYQADVHVRVEGNDNTTQALTQ
TQTGAMINSGPQQAPTDAEIEIIKSRGVVAPVVEQFKLNFSVVPKTIPLLGSLTARLATPGEPARPWLGLKSYAWGGEVA
DIDSINVVPALEGKKLTLTAGPNGNYVLTDENGMRLLTGRVGESAQGGGVTLLVQKLVARPGTQFTVTRYNDLDAITGFQ
SGIQVSEQGKQTGVVQISLEGKDPEQTAAIANALAQSYLHQHVIAKQAEATKMLDFLKGEEPRLKADLERAEAALTQYQR
TSGSINASDEAKVYLEGSVQYEQQIAAQRLQLASLAQRFTDSHPLVIAAKQQLAELQGEKEKFSNRFRSLPATEVKAVQL
QRDAKVAEDIYVLLLNRVQELSVQKAGTGGNIHLIDSALRPGAPVKPKKVLILSAAVFLGLILGTGVVFLRRNLFQGIED
PDRIERAFNLPLYGLVPQSAEQAKLDAAAEKSGGRTRPILASLRPKDLSVESLRSLRTAMQFAMMDAKNRVIVLTGPTPG
IGKSFLTVNLAVLLAHSGKRVLLIDADMRRGVLDRYFGLTAQPGMSELLSGQSALEEAVRETPVQGLSFIAAGTRPPNPS
ELLMSARLPQYLEGLGKRYDVVLIDSPPVLAVTDATIIGRMAGSTFLVLRSGMHTAGEIADAIKRLRTAGVDLEGGIFNG
VAPKTRGYGRGYAAVHEYLSA
>gnl|bykdb|A0A0H3L4W4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pantoea ananatis] (length=725 residues).
MNIKNKVMTAPREESNGWDLAHLVGQLIDHRWVIVAVTAFFMLVATLYTLFATPIYSADAMVQVEQKNTSTVLNELQTLM
PTTPASDTEIQILESRMVLGKTVQDLGLDAVVSQNYFPVIGKGLSRLMGNKPGNVAISRLEIPRTIEKRSVELEVTGKDS
YTVSADGDELFKGKVGQFEKHGDVSMLVSDINAEPGTTFTVTKLNDLQAINSILSNLTVADKGKDTGVLGLQYVGEDQEQ
ISKVLNQIVNNYLLQNVQRKSEQAEKSLEFLKQQLPEVRGKLDQAEDKLNAFRRENESVDLSLEAKSALDSSVSVQSQLN
ELTFREAEVSQLFTKDHPTYRALLEKRKTLEDEQAQLNKKIAQMPKTQQEILRLTRDVQSGQEIYMQLLNRQQELSISKA
STVGDVRIIDQAATANSPVAPKKLLIIAASLILGLMVSVGVVLLKALLHHGIENPEQLEELGMNVYASVPLSEWQRKKDT
EALARRGHKGKTDPHETLLALGNPTDLSIEAIRSLRTSLHFAMMEAKNNILMITGASPGIGKTFICVNLATLVAKAGQKV
LFIDGDMRRGYTHELLGADNKSGLSNVLSGKTEFTPTMIQQGPYGFDFLPRGQVPPNPSELLMHRRMGELLEWASKNYDL
VLIDTPPILAVTDASIIGKLAGTSLMVARFETNTTKEVDVSFKRFAQNGIEIKGVILNAVVRKAANSYGYGYDYYDYEYG
KPTKS
>gnl|bykdb|A0A0H3MF20 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli O7:K1] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQNSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDDK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHSSPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGVKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A0H3NIQ9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Salmonella typhimurium] (length=719 residues).
MTEKAKQSAAVTGSDEIDIGRLVGTVIEARWWVLGTTAIFALCAVIYTFFATPIYSADALVQIEQNAGNSLVQDINSALA
NKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVTKNTFPLFGAGWERLMGRHNEMVKVTTFTRPETMSGQIFTLKVLGDKR
YQLVSDGGFSAQGVVGQPLNKDGVTMRVEAIDARPDTEFTVSKFSTLGMINNLQNNLTVTETGKDTGVLSLTFTGEDRDQ
IREILNSITRNYLQQDIARKSEEAGKSLAFLAKQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQLN
ELTFKEAEISKLFTKAHPAYRTLLEKRKALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITEA
STVGDVRIVDPAITQPGVLKPKKALIILGSIILGLMLSIVGVLLRSLFNRGIESPQALEEHGISVYASIPLSEWQKARDS
VKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMLTGVSPSIGKTFVCANLAAVISQTHKRVLLI
DCDMRKGYTHELLGTNNVDGLSDILAGKGEIASCAKPTAIANFDLIPRGQVPPNPSELLMSERFGELIAWASSRYDLVLI
DTPPILAVTDAAIVGRHAGTTLMVARYAVNTLKEVETSLSRFDQNGIQVKGVILNSIFRRATGYQDYGYYEYEYQSDSK
>gnl|bykdb|A0A0H3PSH8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli O157:H7] (length=726 residues).
MTTKNMNTPPGSTQENEIDLLRLVGELWDHRKFIISVTALFTLIAVAYSLLSTPIYQADTLVQVEQKQGNAILSGLSDMI
PNSSPESAPEIQLLQSRMILGKTIAELNLRDMVEQKYFPIVGRGWARLTKEKPGELAISWMHIPQLNGQDQQLTLTVGEN
GHYTLEGEEFTVNGMVGQRLEKDGVALTIADIKAKPGTQFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDDPQ
LITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDNQL
NELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISK
SSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEHGISVYATIPMSEWLDKRT
RLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSD
QKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDH
YDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGY
SYSEKE
>gnl|bykdb|A0A0H3PU59 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli O157:H7] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQSSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMEDQVFTLNVLDNK
NYTLSSDGGFSARGQAGQILKKEGVTLMVEAIHARPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A0H3Q0E5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio cholerae B33] (length=737 residues).
MTGKQFTQEEVIDIRQYFNVLLNYKWRILLFSVMVTAITLLFVLSMRSEYTARATILIESTQAKAVSIEEVYGLDTKSQE
YYLTQIEILKSDTIAQEVIERLDLASDPEFDLSPESDASPSLKERLVEWMPFLQGFKQEETVADPDLEAYRQNRLILYKF
KRGMEISPIRKTQLVNIYYTAGDPKLAAKIANEIARVYMDSHLEAKLEVELKANTWLNTRMEELRTQLRESEAKLQAFLQ
AEGLVDVQGVEGLATQELEELTSQMNKARDRRVAAETLYQVANSYSKNDSDLTALSSIPEISNHPTIRDLKVAEVDAERK
VSEFSKRYGPKHPKLKSASAQLEAVRKNLRAELRQLLNGINNELQAAKQSERSLQTEFNQRKSEFQTLTVKNAKYSELKR
EVQTNRELFDLFLARQKETSASGDFNTTIARFTDQASAPLTPSKPNKKLIVLLAFVVSFGFACVVAFIADAMTDTFADIK
QVEKQLALSLLGVVPVVRKQRGKLDAKAYFDEKLRELTEAVRTIRTSYLLAHVNQDQHVVMLTSCLPGEGKTTSSLNLAL
SLAQMEKTLLIDCDLRKPAIAHRFGISGSQPGVTNLLNGTQSLEDCVYHDEQSGLDILTAGVYASNPLELLSSSKFSELL
ADLRTRYQRIVIDTPPCLAVSDSFMLAQYVDSVILVIDANHTRTPVVREVVGKLTQQGSRIDGVILNRLNAKKASRYSGY
YHYQAYYGEETKSGAAK
>gnl|bykdb|A0A0H3YT30 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas stutzeri] (length=738 residues).
MTTMPRPIYETKEDKDIDLAHLFDTFINNRMLILGITGFFAALGIAYALLATPVYLASAMIQIEPKSGLPSLTDVVNNNP
PVSPAQTEIALLKSRSVVGGAVSNLNLDIIIKPHHFPIIGGFMARRFEPTEEGELGWYPTGLGAYAWGGEVLKVTQMEVP
DKVHGKELTLEAAENNGFILRDEDGEVVVQGVTGEPVENEGYRVTVAELNARPGTTFTVIKNRTYNTTESYQQRLSAAER
GKQSGIVNVTLEDPDPQHAIRVLEEVANRYVDQNVARNAAEATQSLEFLNEQVPAVRRNLEAAQTALNKYQTGSRSVDIT
AETQSVLDRIVDLEKQISEQNLKRTEMERRFTRQHPNFQALMNQINQLQMQKDQLEKQIDTLPSTQQELLRLTRDVEVSS
ETYSMLLNKTQELDIIRAGTVGNVRIIDHAAADLENPVKPNKPLVVIVATLLGALLATAFVYVREALKRGVENPEDIERT
GTPVYASIPFTEKQATLEKRLANFKRDKSTASYLLTINDPADLATEAMRSLRTSLHFAMIEAKNNVLMITGPSPAVGKSF
VTTNLAAVVAQSGKRVLLIDADMRKGYLHKVMRCDGDKGLSDILSGRITLFDAIQKTQLNNLHVITHGQLPPNPSELLMH
ENFSRFVKEISHMYDLVIFDTPPILAVTDAALVGSQAGTTLMVTRYGLNGLKEIEAAKRRLEQNGLLVKGVIFNAVVRKA
STYGEYGYYQYEYASTNK
>gnl|bykdb|A0A0H3YVM7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas stutzeri] (length=736 residues).
MTALTRSSLEYDADNRIDLAGIMRTAYDHKALIIAITGLFTVLGVLYALIATPIYQATAMIQIEPKKAAITGIPEISPRP
DSVSQAVTEISLLKSRAVLGKAVEELKLYIVAKPRQFPLIGGYMARQHDPATDGALAKPLFGLTAFAWGGEKLDVFQLDV
PEAYLGMDLTLVAGTAGNYSLYDDEEQLILRGQVNQAVETQGFKVQIAELEARPGTEFRLVRNRPQTTALDYQDRLKVGE
AGKDSGIIYMSLEDPDPQLASRVLDEISRLYVSQNIQRSSAEAAQRLDFLRSQLPQVRKELEKAEAALHDYQTSSKSVDI
SIETKGVLDQIVQLETQLSELTLKRVDYDRLYTREHPTYRTLMSQMNELQAQKAQLLKKVDALPMTQQELLRLKRDMEVT
TQTYTLLMNQAQEQDVLRAGTIGNVRIIDNAYSMTEKPSKPVRPLVVALAIFVGLLVSAAVILLRQAFYRGVESPDVIEK
LGVPVYAGLPYSPSQEQLNRRRKARDGKTRLLSLTEPTDLAVESLRSLRTSLKFAMLEARNKVLMITSPTPAVGKSFVSS
NLAAVIAQTGQRVLLIDADMRRGYLHTLFGMAPRNGLSDALASGLSLAEITNRTEVKNLHFISAGFSAPNPSELLMHENF
SRLLKEAERLYDFIVIDTPPVLAVTDAVLVAQQAGTNLLVARFGLSTSSQIDASKRRLAQNGVLLKGVILNAVKRKASTS
PYDSGAYGYYTYTQQA
>gnl|bykdb|A0A0H4UQY0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter baumannii] (length=727 residues).
MNQNTKTEDSIDLKELFFSLITQWKLIALCTILSLVCALLYLRVTPNTYSVDALVQVEDSKGASAALLGDLSQMIEQKSP
AQAEIEILKSRLVLGSVIKDLHLNVQISSTENTLTHRLLSGTEYKTEYTQKSVIFKDGLKSFEVREFEIPAYYLDKTLHL
NFDKQSLRLTDPKTEEVILTVPLNQVNRVAGPHGLWKVAIFTKEQFDATYNITNLSLPATVSAISSNYSVAERGKLTGVL
SLSYQGQDKEYITKVLNAILSTYSAQNIERRSAESAQTLKFLDEQLPDLKKQLDDAERQFNKFRQQYNTVDVTKESELYL
TQSITLETKKAELEQKQAEMAAKYTAEHPAMREINGQIAAINKQIGELNSTLKQLPDVQRQYLQLYREVEVKTQLYTALL
NSYQQLRIAKAGEIGNVRIVDTAVEPIEPIKPKKLQILILSILLGGFIGTVIALLRNMLRTGIKDSGQIENELDLPVYAT
VPRSPIQESRVKILKKKKSIPILAVKNSDDIAIESLRSIRTAIHFALANAKNNIIMIAGPSPEVGKSFISTNLATIFAQG
NKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQADLQKVLHKTQVTNLDVITRGKSPTNPSEILSSNQFKELLEQLQS
QYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSQMKELELTVNRFEQAGVKVNGFILNDIQRASAGYGYGYNYAYA
YKAQKED
>gnl|bykdb|A0A0H4V9K9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Erythrobacter atlanticus] (length=729 residues).
MVDRYLPQDTAVESPNGAYGTASRSFFTFATIRGILWRQRFIIIGAVALALLAALIITLLTRPIYQASSTVVYQPPGTSI
IEGQDLEPYISTNEVARHMETLAGVVVSRSMAMSVVDNLNLYDSEELLGEMLEQGRPQNMTEEAWLDQRRNAAAGILRGG
VSAQTPYDVRIMTINFASTDPRLAARIATGYADTFVQRGISDTSETNEFAREFLQKQIAEIREELRSREIENNSYARSNG
LIAMPDPVGSEDGANSGQTQTLTATNLASINATFTQARVARIEAEERWRAVENVPAGRIPEVQASGAVQAQRAQLATMRG
QLSDLSQRYQDEYPPLQELRAQIETTQSQLQTTENEIKQSLRSAYRIALQQEQALGEEVSRVSDEALNEQDRRVQLSLLD
REASALRDQLASLLARYNQLSAASTLQTSSLTKLDPASVPSSPSSPNLLRNLIAGLAAGLALAGGLAVLRETLDDKLYSI
DDIETRIGVKALGQTPHITENLDDALENPFSILSEAYSSIRATLDYNVLRDGKEIIQITSAEVGEGKSTTSIALAQRYAA
VGKKTLLVDMDLRRPALARRLGITKNKSAGLIDALFKRAPLDSAIIKGADGGFDLLPISERPDSPISVLSSGLVPELLAQ
LRLKYDTIIVDSSPLLGLADAPMLARYVDAVLLIVEANRSRAAQTRATIRRLGEVGVEPAGIVLTKFKSLEAGQSYDYKY
RYYEYKADD
>gnl|bykdb|A0A0H4X022 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Myxococcus hansupus] (length=730 residues).
MDGTGFDPASGAGGLTPAGLMQHLRAVWRRKWVVLGVAVIAVALTAAYTLRQPKLYSSSASLIIDVMAPRFLDGEVKEVM
GEERSNYWFNKEYYATQSQIITSRAVAGRVVDKLGLSTDAGFLGVAHVADEKQRLQAMQGLDAVSLLQSRIRVIPARDSR
VMNIAVDDFDAQRAALLANEVAAAYMAENLALKLRTTEDARDWLEGRLSELESQSRSSEMAVYDFKKDADMLSTSLESRL
SIVSERINSFNTRLTEVRIQIAAQQARVEAIHRLRKASPEDETWAEALSGGNEGPIQDLRRSYTELRVSCAELEERYLAE
HPKLLECRRKLSVVREDFLKSLANVVRGAETALTEAVAQEKNLVRLLDAEKAEAFLVNKKSIELDRLTRDSDNNQRLYEL
VAKRLKDIELSGMLRTSNVRVLDPARPVLAPVKPHVRRNLAVGLVMGLLAGLGVVLLLELLENSVATQADVEERLGLAFL
GVMPRLDGNKAPRDRDLHVHREPKSIAAECCRAIRTNLLFMSPDNPFKTLVVTSSGPQEGKSTTCVSVGVAMAQSGNRVL
LLDTDMRRPRLHRAFGVPNELGISSLVVGEGTLDAAVKSTEVPGLFVLPCGPIPPNPAELLHTQAFTDLLKAASERFDRV
ILDSPPINAVADAAVLATKCDGVVLVLKAAKTNRESARRALRSLADVQARMYGAILNDVDFAAPRYGDSYLAYQGYGQYG
EEPKDGVASS
>gnl|bykdb|A0A0H5AHB4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas trivialis] (length=740 residues).
MQSAPAIASHNGEETDLDFMMLLGTLLDHKWLIGGISIAFMALGVAYAVLTPPVYQATALVQVEPKKSDMLGFSDVGSLL
GKESPTVTEVELIRSRITIGTAVDNLNLDLDVKPKRFPLVGDFIARRFKPAQAHAVASPWLGLDSYGWGGEALKFSQLRL
PADLLGQELTLTAGSGASFTLSDQDDTVLLTGQVGRFYDSNGIKLQVEVLQANPGAQFSVVRSPRLTSILRYQKLLDVAE
RGKESGIIGLALESTQPAAAIQVLNEVARIYVRQNIDRTSAEAAQSLAFLKDQLPQVRKDVEQAETALNQFQIRNKTIDI
SLEAKAILDQIVALDASISELKMQQAEIERKFTPQHPVYRALLTQLAELTARQNELAKKVESLPTTQQELLSLTRDLKVS
TEIYTQLLNKYQELDVMRAGTVGNVRLIDTADVDLRNPIRPQKALIVVIATLLGAFLAIALVLFRKALNRGVSNPNELEK
LGLPVYAAIPFSTLQKDMDQKLFRAGKSASTQLLALSNPTDLAIEGLRSLRTSLHFAMLEAGNNRLMISGPSPQVGKTFI
SSNLAAVVAQSGQRVLLVDVDMRKGYLHKVFGVPAENGLSDLLAKSCELTTAIHHTAVDNLHVLSRGRIPPNPSELLMHA
NFSEFLEHVSALYDLVILDTPPFLAVTDATIVGRQSGTNLIVTRFELNSAREVELTMRRYQQNGIELKGAIFNGIEKRSS
AKYGYGAYSYYNYEYKSDSV
>gnl|bykdb|A0A0H5CXW8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Phaeobacter italicus] (length=727 residues).
MIFARSLAGQSRPGPRRYRAAQGGWGRNNNDGVNHVSTPKTSFAADDGQEVLDLGAIFAIIWRGRLLILLCVLLGLAFGV
WRGFIAAVPLYGAEVQLVLDPRDEKVVDIESVVSSLSATDEVIRTEVHILGGRELGGQVVDRLNLVADPEFNMLLRDPGF
DPVQSLKDAIKTILGMEVYQITGDPDPAFLREKVIQTLLSNVEVVNIPDTFIFSIWVLSENPFKAAEIANAFADIYVENQ
VAVKLDVTAQATGWLAERVTELRGQLEKNERRVAEIRAQADVTSPAQLIGLENRLISLRSALSERSEEVASRASAQAELS
AVQTEADQRAAARRFGYGALMSRASDPQTGWRAVLAQAARDLREAETKEQAIRTSMAELEITIATQSDALTEIVQAERDA
ESSRLLFENFQNRLRETSMQVGLQRADSRVISRAFPPDRPALPQKSRILILSVFFGGFIGTVLVVALQLTRARLHSASQI
ANITSVPVIAVLDQFTQKVRPEDAAALGPQTRDGEAIRNLRTSLLMARDDVPPQVVVFTSAESGDGKSTLSAAMAHNIAQ
IGKSVLLIDGDIRRHYLSNPLANGNQHPGLSDVLSGKVALADAILPGALGQVDILPAGTVSGSAADLLSQGGLPDLLAEV
RNHWDVIVIDTPPISVVPDARIIGRHADLLILLAQWNTTRQSVFADALRQLEQGGRSPDGIVLTKVKAGRKPLYGPARRS
HDNYYRG
>gnl|bykdb|A0A0H6UYD8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio cholerae] (length=737 residues).
MTGKQFTQEEVIDIRQYFNVLLNYKWRILLFSVMVTAITLLFVLSMRSEYTARATILIESTQAKAVSIEEVYGLDTKSQE
YYLTQIEILKSDTIAQEVIERLDLASDPEFDLSPESDTSPSLKERLVEWMPFLQGFKQEETVADPDLEAYRQNRLILYKF
KRGMEISPIRKTQLVNIYYTAGDPKLAAKIANEIARVYMDSHLEAKLEVELKANTWLNTRMEELRTQLRESEAKLQAFLQ
AEGLVDVQGVEGLATQELEELTSQMNKARDRRVAAETLYQVANSYSKNDSDLTALSSIPEISNHPTIRDLKVAEVDAERK
VSEFSKRYGPKHPKLKSASAQLEAVRKNLRAELRQLLNGINNELQAAKQSERSLQTEFNQRKSEFQTLTVKNAKYSELKR
EVQTNRELFDLFLARQKETSASGDFNTTIARFTDQASAPLAPSKPNKKLIVLLAFVVSFGFACVVAFIADAMTDTFADIK
QVEKQLALSLLGVVPVVRKQRGKLDAKAYFDEKLRELTEAVRTIRTSYLLAHVNQDQHVVMLTSCLPGEGKTTSSLNLAL
SLAQMEKTLLIDCDLRKPAIAHRFGISGSQPGVTNLLNGTQSLEDCVYHDEQSGLDILTAGVYASNPLELLSSSKFSELL
ADLRTRYQRIVIDTPPCLAVSDSFMLAQYVDSVILVIDANHTRTPVVREVVGKLTQQGSRIDGVILNRLNAKKASRYSGY
YHYQAYYGEETKSGAAK
>gnl|bykdb|A0A0H6VVE6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio cholerae] (length=752 residues).
MTGKQFTQEEVIDIRQYFNVLLNYKWRILLFSVMVTAITLLFVLSMRSEYTARATILIESTQAKAVSIEEVYGLDTKSQE
YYLTQIEILKSDTIAQEVIERLDLASDPEFDLSPESDASPSLKERLVEWMPFLQGFKQEETVADPDLEAYRQNRLILYKF
KRGMEISPIRKTQLVNIYYTAGDPKLAAKIANEIARVYMDSHLEAKLEVELKANTWLNTRMEELRTQLRESEAKLQAFLQ
AEGLVDVQGVEGLATQELEELTSQMNKAXXXXXXXXXXXXVAAETLYQVANSYSKNDSDLTALSSIPEISNHPTIRDLKV
AEVDAERKVSEFSKRYGPKHPKLKSASAQLEAVRKNLRAELRQLLNGINNELQAAKQSERSLQTEFNQRKSEFQTLTVKN
AKYSELKREVQTNRELFDLFLARQKETSASGDFNTTIARFTDQASAPLTPSKPNKKLIVLLAFVVSFGFACVVAFIADAM
TDTFADIKQVEKQLALSLLGVVPVVRKQRGKLDAKAYFDEKLRELTEAVRTIRTSYLLAHVNQDQHVVMLTSCLPGEGKT
TSSLNLALSLAQMEKTLLIDCDLRKPAIAXXXXXXXXRFGISGSQPGVTNLLNGTQSLEDCVYHDEQSGLDILTAGVYAS
NPLELLSSSKFSELLADLRTRYQRIVIDTPPCLAVSDSFMLAQYVDSVILVIDANHTRTPVVREVVGKLTQQGSRIDGVI
LNRLNAKKASRYSGYYHYQAYYGEETKSGAAK
>gnl|bykdb|A0A0H6WTF3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio cholerae] (length=737 residues).
MTGKQFTQEEVIDIRQYFNVLLNYKWRILLFSVMVTAITLLFVLSMRSEYTARATILIESTQAKAVSIEEVYGLDTKSQE
YYLTQIEILKSDTIAQEVIERLDLASDPEFDLSPESDASPSLKERLVEWMPFLQGFKQEETVADPDLEAYRQNRLILYKF
KRGMEISPIRKTQLVNIYYTAGDPKLAAKIANEIARVYMDSHLEAKLEVELKANTWLNTRMEELRTQLRESEAKLQAFLQ
AEGLVDVQGVEGLATQELEELTSQMNKARDRRVAAETLYQVANSYSKNDSDLTALSSIPEISNHPTIRDLKVAEVDAERK
VSEFSKRYGPKHPKLKSASAQLEAVRKNLRAELRQLLNGINNELQAAKQSERSLQTEFNQRKSEFQTLTVKNAKYSELKR
EVQTNRELFDLFLARQKETSASGDFNTTIARFTDQASAPLTPSKPNKKLIVLLAFVVSFGFACVVAFIADAMTDTFADIK
QVEKQLALSLLGVVPVVRKQRGKLDAKAYFDEKLRELTEAVRTIRTSYLLAHVNQDQHVVMLTSCLPGEGKTTSSLNLAL
SLAQMEKTLLIDCDLRKPAIAHRFGISGSQPGVTNLLNGTQSLEDCVYHDEQSGLDILTAGVYASNPLELLSSSKFSELL
ADLRTRYQRIVIDTPPCLAVSDSFMLAQYVDSVILVIDANHTRTPVVREVVGKLTQQGSRIDGVILNRLNAKKASRYSGY
YHYQAYYGEETKSGAAK
>gnl|bykdb|A0A0I0HGV8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Shigella sonnei] (length=726 residues).
MTTKNMNTPPGSTQENEIDLLRLVGELWDHRKFIISVTALFTLIAVAYSLLSTPIYQADTLVQVEQKQGNAILSGLSDMI
PNSSPESAPEIQLLQSRMILGKTIAELNLRDIVEQKYFPIVGRGWARLTKEKPGELAISWMHIPQLNGQDQQLTLTVGEN
GHYTLEGEEFTVNGMVGQRLEKDGVALTIADIKAKPGTQFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDDPQ
LITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDNQL
NELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISK
SSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEHGISVYATIPMSEWLDKRT
RLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSD
QKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDH
YDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGY
SYSEKE
>gnl|bykdb|A0A0I1BGQ4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Shigella sonnei] (length=648 residues).
MIPNSSPESAPEIQLLQSRMILGKTIAELNLRDIVEQKYFPIVGRGWARLTKEKPGELAISWMHIPQLNGQDQQLTLTVG
ENGHYTLEGEEFTVNGMVGQRLEKDGVALTIADIKAKPGTQFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDD
PQLITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDN
QLNELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSI
SKSSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEHGISVYATIPMSEWLDK
RTRLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQ
SDQKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWAN
DHYDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYY
GYSYSEKE
>gnl|bykdb|A0A0I3LGJ1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Shigella sonnei] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQNSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWERLMGRQNETVKVTTFNRPKEMAGQVFTLNVLDNK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHARPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEEEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVSWASKNYDLVL
IDTPPILAVTDAAIVGRHAGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A0I9SJQ5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas sp. BICA1-14] (length=738 residues).
MTTMPRPIYETKEDKDIDLAHLFDTFINNRLLILGITGFFAALGIAYALLATPVYLASAMIQIEPKNGLPSLTDVVNTNP
PVSPAQTEIALLKSRSVVGGAVASLNLDIQITPHHFPIIGGFMARRFEPSEEGELGWHPAGLGAYAWGGETLKVTQLEVP
DKVHGKELTLEAAENNGFILRDKDDEVVVQGVVGEPVETEDYRVTVAELNARPGTTFTVVKNRTYNTTESYQQRLSAAER
GKQSGIVNVTLEDPNPEHAIRVLEEVASRYVDQNVARNAAEATQSLEFLNEQVPAVRKKLEAAQTALNKYQTGSGSVDIT
AETQSVLDRIVDLEKQISEQNLKRTEMERRFTRQHPNFQALMNQINQLQMQKEELEKQIGTLPSTQQELLRLTRDVEVSS
ETYSMLLNKTQELDIIRAGTVGNVRIIDHAAADLENPVKPNKPLVVIVATLLGALLATAFVYVREALKRGVENPEDIERT
GTPVYASIPFTDKQAALEKRLANFKRDKSTASYLLTINDPADLATEAMRSLRTSLHFAMIEAKNNVLMITGPSPAVGKSF
VTTNLAAVVAQSGKRVLLIDADMRKGYLHKVMRCDGDKGLSDILSGRITLFDAIQKTQLNNLHVITHGQLPPNPSELLMH
ENFSRFVKEISHMYDLVIFDTPPILAVTDAALVGSQAGTTLMVTRYALNGVKEIEAAKRRLEQNGLIVKGVIFNAVVRKA
STYGEYGYYQYEYASTSK
>gnl|bykdb|A0A0I9SSI0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas sp. BICA1-14] (length=736 residues).
MTALTRSSLEYDADNRIDLAGIMRTAYDHKALIITITGFFAALGVLYAVIATPIYQATAMIQIEPKKAAITGVPEISARP
DSVSQAVTEISLLKSRAVLGRAVEELKLYIVAKPHHFPVFGAFMARKHDPATDGALATPLFGLTGYAWGGEELEVFQLDV
PEAYLGVELTLIAGTAGSFTLHDDEQQLILRGQVNEAVENQGFKVQIAQLEARPGTEFLLVRNRPQTTALDYQNRLKVGE
AGKDSGIIYMSLEDPDPQLASHVLDEISRLYVSQNIQRSSAEAAQRLDFLRSQLPQVRKELEKAEAALNAYQTSSKSVDI
SIETKGVLDQIVALETQISELSLKRVEYDRLYTREHPTYRTLITQMNELQAQKAQLLKKVDALPMTQQELLRLQRDMEVT
TQTYTLLMNQAQEQDILRAGTIGNVRIIDNAYSMIEKPSKPVKPLVVAIAIFVGLLVSAAVILLRQAFYRGVESPDVIEK
LGVPVYAGLPYSASQDQLNRSRKSRDGKTRLLSLTEPTDLAVESLRSLRTSLKFAMLEARNKVLMITSPTPSVGKSFVSS
NLAAVIAQTGQRVLLIDADMRRGYLHTLFGMAPRHGLSDALASGLNLAEITNRTEQKNLHFISAGFSAPNPSELLMHDNF
SRLLREAEKLYDFIIIDTPPVLAVTDAVLVAQQSGTNLLVARFGLSTSSQIDASKRRLAQNGVLLKGVILNAVKRKASTS
PYDSGAYGYYTYTQQA
>gnl|bykdb|A0A0J0GR09 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Enterobacter asburiae] (length=726 residues).
MSSSKSDKYSAATPQNNEIDLLQLLAEMFDNRVTIACVTLLFTVCAGIYAFSATPVYQADALVQVEAKQNNSLLKNLTPF
ESELSPDVAPELLLLRSRMILGETVDQLGLTYNARRRVFPVIGSLWEHVRGRKSDEITIGALTIPLLEGKPQTLLLTVQG
KGRYRLEGKTLQAEGIVGKTLVKDGMSLLVTSLSAEPGTQFTLEAVTRLDAIGSIQNRLTVVESAKQSGMIALTLMGEDP
ARIATVLNTIAENFLSQNIARQEAKDSRSLTFLQEQLPKISRELDEAEARLNAYREQRDSVDLSLEAKSVLDQVVNVENQ
LNELTFREAEVSQLFKKDHPTYRALLEKKQTLERERARLSNRVSTMPSTQQEILRLSRDVESGRAIYLQLLTRQQELSIS
RSSTIGNVRIIDPAIAKPDPIKPHKALIIVLGMLMGLMLSAGMVLARSAFKRGITSSEQLEVQGIPLLATLPRSVWLWKK
THLRRRTLFASHWKHRTSNVPFLPVDRPADMFVEAVRGLCTSLHFTMMDATNRIVVVSGPTQDCGKTLVSTSMASIAAQA
GQRVLFIDADMRKGYVHNVFKLSNHRGLSCVLAGAVEWQEAVQHVEKGGFDVLTCGPQPSHPVELLMGERFQAVMSQIDK
LYDIVIVDTPPVLAVTDALLIARAAATTLLVARFGKTNVKEIENCLKRLQQMGVQVNGAILNDIVKSAVLYYNSGYSHYD
YGYTQE
>gnl|bykdb|A0A0J0H0Q7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Enterobacter cloacae] (length=732 residues).
MSSYTTDNYGAAAPQQHEVDLVRLLVEMIDHRTMILCVTFLFTLCAGLYAWVTPPVYQADAMVQIESKQDNSLLKGLSQL
GTDVSPDVAPEILLLKSRMILGETVDKLGLTQQAKQRVLPVVGRLWQRLQGRGQGKITLGELQIPQVEGKAQGLTLTVQE
AGKYHLTGENIEADGRVGKTLVTQGIVLLVTSIEATPGTQFSLKSLTRLETINALKKSLTVAESEKQSGIVTLTLTGEDP
DNIARVLNAIADNYLQQNIARQEAQDSRSLDFLQEQLPKIRADLDQAEARLNAYRAQRDSVDLSLEAKSVLDQVVNVENQ
LNELTFREAEISQLFKKSHPTYRALHEKRQTLERERDRLNNRVSAMPSTQQEILRLSRDVESGRTIYLQLLTRQQELNIS
RSSAVGNVRIIDEAVTHPDPIKPRKALIIILGALFGLMLAMGTVLVRQAFKRGITLSEQLEAQGLPVLATLPRSQWLWSK
THLRRKNPFSRRWKHKTSNVPFLPVDRPADMFVEAVRGLRTSLYFAMMEAENRIVMISGPTQDCGKTLVATNLAAVAGQS
GQRVLFIDADMRQGYVHNIFGLENRYGLSCLLEGKCDCTEVIQHAEKAGIDVITCGPEPLRPLELLLSERFLDIMSWVNE
QYDIVIIDTPPVLAVTDASLVARAAGTTLMVARFDKTSVKEMENTVKRLQHVGVKVSGTILNDIVKSAALFYSSGYSQCD
YGYASKKKGDRR
>gnl|bykdb|A0A0J0IDA6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Enterobacter sp. GN02600] (length=720 residues).
MTEKVKQSAAPVTGNDEIDIGRLVATVVEARWWVLGITAAFALCAAVYTLFATPIYSADALVQIEQNTGNSLVQDIGSAL
SNKPPASEAEIQLIQSRLVLGKTVDDLNLDIAVTKDTFPIFGAGWDRLMGRQNETVNVTTFTLPKAMNEQTFTLSVLNDK
RYQLVSDGGFSAQGQVGQVLKHDGVTMLVEAIHASPESQFTVSKFSTLGMINTLQNNLMVTETGKDTGVLSLTFTGEDRE
QIRQILDSITRNYLQQNVERKSEEAAKSLAFLAKQLPEVRNRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLFTKAHPAYRTLLEKRQALEDEKSKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITE
ASTVGDVRIVDPAIAQPGVLKPKTTLIILGSIILGLMLSVVGVLLRSLFNRGIESPQALEEQGISVYASIPLSEWQKARD
NVQTIKGVKRYKQSQLLAVGNPTDLAIEAVRSLRTSLHFAMMQARNNVLMLTGVSPSIGKTFVCANLAAVVSQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGKGDISSSAKPTSIPHFDLIPRGQIPPNPSELLMSERFGELIAWASSHYDLVL
IDTPPILAVTDAAIVGRHAGTTLMVARYAVNTLKEVETSLSRFEQNGIQVKGVILNSIFRRASGYQDYGYYEYEYTSDSK
>gnl|bykdb|A0A0J0LDS5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Enterobacter asburiae] (length=720 residues).
MTEKTRPSAAPTSGSDEIDIGRLVGTVVEAKWWVLGITAVFAAAAVVYTLFATPIYSADALVQIEQNTGNSLVQDIGSAL
ANKPPASDAEIQLIQSRLVLGKTVHDLGLDISVTKNTFPVFGAGWDRLMGRNNDTVKVTDFVLPKGAGDQTFTLKVLGPK
QYQLTSDAGFSARGEVGQMLTKDGVSMMVSAINAQEGGEFTVTKFSTLGMINNLQNNLTVTENGKDTGVLSMTFTGEDKE
QIRDILNSITRNYLEQNVERKSAEAAKSLAFLAKQLPEVRTHLDDAENKLNAYRQDKDSVDLPLEAKSVLDSMVNIDAQL
NELTFKEAEISKLYTKRHPAYRTLLEKRRTLEEEKAKLNDRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITE
ASTVGDVRIVDPAITQPGVLKPKKALIILGSIILGLMLSIVGVLLRSLFNRGIESPQVLEESGINVYASIPLSEWQKSRD
SVKTIKGVKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAKNNVLMLTGVSPSIGKTFVCANLAAVVSQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILLGKGEISQSAKPTTVPKFDLIPRGQVPPNPSELLMSERFTQLIEWASKNYDLVL
IDTPPILAVTDAAVVGRHAGTTLMVARYAVNTLKEVETSLSRFEQNGIEVKGVILNSIFRRATGYQDYGYYEYEYKSDSK
>gnl|bykdb|A0A0J1A8T3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter baumannii MRSN 3527] (length=727 residues).
MNQNTNTEDTIDLKELFFSLIAQWKLIALCVILSLVCALLYLRVTPDTYSVDALVQVEDSKGASAALLGDLSQMIEQKSP
AQAEIEILKSRLVLGSVIKDLHLNIQVSSTENTFTHRLLSNPEYKTEYTKKSVIFKDGLKSFDIHQFDIPAYYLDKNLFL
DFDKQSFRLTDPKTEEVILTLPLNQLNQVTGPHGTWKVAIFTKDQFDATYNIRNLSLPAAVNSISSNYSVAERGKLTGIL
GLNYQGQDQEHITKVLNAILATYSAQNIERRSAESAQTLKFLDEQLPDLKKQLDDAERQFNKFRQQYNTVDVTKESELYL
TQSITLETKKAELEQKQAEMAAKYTAEHPAMREINGQITAINKQIGELNSTLKQLPDVQRQYLQLYREVEVKTQLYTALL
NSYQQLRIAKAGEIGNVRIVDTAVEPIEPIKPKKLQILVLALFLGGFIGALVALLRNMLRTGIKDSSQIENELNLPVYAT
VPRSPIQESRIKILKKKKSIPILAVKNSDDIAIESLRSIRTAIHFALANAKNNIIMIAGPSPEVGKSFISTNLATIFAQG
DKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQADLQKVLHKTQVANLDVITRGKSPTNPSEILSSNQFKELLEQLQS
QYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSQMKELELTVNRFEQAGVKVNGFILNDIQRASAGYGYGYNYAYA
YKAQKED
>gnl|bykdb|A0A0J1C684 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Neisseria arctica] (length=716 residues).
MNQPYSNYPPSEKDNEIDVSKQLHHLLEHKKAIGLAILLGALAGGLYSFSASPVYRADAMLELQTKQNQILNEINSLFSS
EPSPSEAEIELIQSRLVIGKTVEDLQLDQSVTPKYFPVFGQLAHNLSSDTDPELKIQAFTVSEEWHNKPIILTAADNQHY
SIKLPDGSVSEGRVGQPLKVDNRLVLQINQILANAGQQFTLTKFSRLNTINQINQNFSVISKGKTSPILNLGYVGSDPKQ
IENILNSIINNYVSQNKDRDVQVAANGLAFISEELPRLREALQDAENRLNEYRMKSGSLDIPIEAKSALESLASIEAQIT
TLKTEEAGLAELYTKEHPALKSVLDKLSVLEQAKNKINRQIAVLPNTQQEVIRLTRDVDTNQATYMQLLNKQQELNILRA
SAQGNVRVVDQAVTAEQPIKPRKGMIILMSALTAGLAASAWFLLRSSFRRTVTSPEEIEMLGLEVAAVIPLSETQKKRDA
QSKRLSRKKTPSSFLLAAEDSSDIAVEAIRSLRTGIHFAMMNTKNKVLMISGATPEVGKSFISANLATVMAQSGKKTLLI
DADMRKGYLHRIFGLNEEIGLAEVLAGDTNPMQAAQTTKIDNLDVISHGKLPDHPSELLMSNRLYAVLEWAKQRYDYVIV
DTPPILAVTDAAVIGQFAGNTMLVAHHNRTTPRELEISMQRFAQNSISVKGVIFNGLSRSAQNGHSYYAYAKYAKK
>gnl|bykdb|A0A0J1CJY4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Caballeronia mineralivorans PML] (length=801 residues).
MSTYEMLEHSPTQAKDEEFVLRDLVRMIVDQIWWVLGIALGILLVAVLYAKMSTPVYSADALVQVETPSPNSPNSAQASL
AAALMPSAGSMHADAEIEIIKSRAVIDPVVEQFNLNFGTSTNVMPVIGRVTSWFAHKGHPLPALFGFDAYAWGGEEFKVD
SVNVPTILQDQRLTLRALGEGRFALLDAENHELLQGEAGTVATGNGVTLLVSQLVARPGTEFFVTRASQLEAGQVFGAGM
QVAEKGKDTGIVQISYSGSQPIFITEVANAVAASYLKQRTERAQEEANRMLTFLNNELPRVRNELRASETALAQYQTAAG
SFQPTQEAQTYLSGGLDYERQIAALRMQRVQLLQRFTDGADEVRAIDAQLAALNVEKSRFENQFKTLPGSERQAVSLQRE
AKVNSEIYVALLNKTQELSISRAGTVGNVHIVDMALVPSQPVKPKAGLIIAAGGLLGVIAGVVFAFVRRAFFAGVDDPDL
VERRFNLPIFGAIPFSAEQARVDRVRLDRPVALPLPSVKGAAGGAKRLGTQPVGDGFVSTPGMAAKTRVAMALKHATVLP
ASRSTTQPLLSTTHPFDTSIEGLRGLRATLQFALVDAPNRVIAITSPAPSDGKSFLSANLAALLAESGKRVLLIDADLRR
GRLAQYLGRSPHGGLTELLTGQTDFEMAARETGVHGLHFIGSGAHPPNPSEILTSARFASLLQAFEKQFDLVIVDTPPLL
AVPDAAVIASLAGSTVLVMRSGAHSEKNIADSLKKLKRAHARVVGGVLNAMPAKRGGRNGTYDYAYAYTYSSDPLTAEVK
Q
>gnl|bykdb|A0A0J1CKU5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Caballeronia mineralivorans PML] (length=752 residues).
MLNLMHDHLWEILNVIGIVVALAVVYLLVATPIYSADVLVRVDPPEQNALGIAIQNQETLPPPAPAPSAEMAVMRSRSVL
EPVIERYRFDVSVKPRTIPLLGDLAEKLATPGQPAAPWLGLKSFAWGGERLQIANLDVPQDLEEEKLNMVVLDGGQYELR
GPSNELLLRGAVGKPANSNGVSMLVAQLVARPGTSFEVIRWNSLDAVKRFGDVIKVTDKVKDSGLIEMQYSDSNRAKAVE
VTNALAQQYLATAVASRQSNDSQTLAFINGELPRLLADLRRKEEALRNFRASSNSMQPTSEAQAYLQGGIDFDRQIATLQ
LQRTQMMEKFTPDSRWVQNIDIQLAQLNKAKAAFDGRFSAMPSSERNSVDLARDAKVAETIYLGMVQKAEQLSVRRASTT
GGAHIVDAAIRPLHPTKPSRPIVLGGAVALGLISGMFLVFMRRHVMTGVTDPLFVERRLSVPVIGEILFSQQQVQLARDA
DGAARKALPGNRWATSPVWRDSLEDHPFDSNAGATALDGVGTKVLAARFPNDPSVEALREVRTALARDLAHAPNNIVMFT
GPTPSAGKSFVAANLAVLHAEIGSKVLLIDADMRRGHLASYFGMSNRGGLSEVLSGRIPVRNALRHVGVHGMSFLACGER
PNNPAALLMKQTFRDLLDRLSKQFDLVIIDTPPILAVTDASIIASEAGATMLVLRSGMQSEDEIADTVKKLERTEGRIAG
AVFNAIPLRRSNRNYEYTTNYASDTGHLGMAS
>gnl|bykdb|A0A0J1CSA5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Caballeronia mineralivorans PML] (length=746 residues).
MNLMTRPPSPPVDKEEDLDLVTILDVMIESRWLIALVTGAFLALGLLYAFATEPVYQTDIMIQVEESPDSSAAKSMLGDV
SSLFDVKSTAAAESQILASRLVVTRAVEQLRTYIEAGPRRFPVIGNWLARQNDNLSTPGLFGFGGYGWGNERIDVQRFDV
PQDLESKRFTLAVTDATHYRLSGSDLDQPFTGQVGRLETIPSSYGNLSLLVNSLHGNAGAEFVLRRYSKLKTIEKLQDNL
DVQEKVKQSGILIASLQDTKPRRVADLLNAIATLYVAQNVARKSAEAAQSLQFLDTQLPEIKSRLEVAQARYTAMRDRRG
SIDMTEEAKLALAQSADAKTRLLELQQRRDELILRFNPTHPAIRAIDEQLASLRRFTDTSAAQIKLLPDAQQDIVRSMLD
VQVNTDLYTSLLNNFQQLQLVKAGKTGNVRLVDTAVTPEDPVKPKRLLVVLGSLLAGGFLGVVVAFVRNMLFRGISDPNE
IERRSGLHVYSTIPLSERQQALSKRIRAKAPGVKMLALDAPEDPSIESFRSLRTALQFTMFNAKNNVVLITGPAPSVGKS
FVSANFATVLSTAGKRVLLIDADLRKGYLHQYFGLERGVGLSEVISGQSSVEAALHRGVVPDLDFISTGAQPRNPAELLL
NDRLLKLVQEVSEAYDIVVIDTAPVLVAADAGILAPAAGTVFLVAWASVTKMGEITESVKRLAQSGVEPTGVLFNGLNLM
HVKYGYGSKYGAYRYAAYAYESDAKK
>gnl|bykdb|A0A0J1D571 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Caballeronia mineralivorans PML] (length=740 residues).
MVSTPHSYQGKTEEEDVVLGQLLQVILDDIWWLIGTAAFIILAAAAYCYVAKPVYSADAHVRVEQSDNTSQALTQTQTGA
AIGNSSGALPTDAEIEIIKSRGVVAPVITQCKLNFSVSPMTIPLLGSLAARLATPGKPAKPWFGMTSYAWGGEEAVVDSV
EVVQPLEGVKMTMTALGNDRYSLATPEGVPLLEGRVGEMAKGNGVSINVTKLVARPGTRFEVMRANDLDAIAAFQSGITV
VEQGKSTGVIQISLENRDPARAAEIANALADSYLLQHIESKQADAEKMLAFLKSEQPRLKGDLEHAEAALTEYQSKSGSI
NASDEAKVYLEGSITYEAQISALKLQIATLNQRFESSHPALIVAQQQLSQLEAERARFSERFKNLPASEVKAVSLQRDAK
VAEDIYVLLLNRVQELSVQKAGTGGNVHIVDAALRPGAPIKPKKVLIMSAAVILGLILGTGLVFLRRAMFKGIVDPDKVE
RLAGLPLIGLVPMSVEQVKLDAEAKRTERDRDRVSPILATMRPNDVCVEIMRSLRTSLQFTLMEARNHTVMLTGPASGVG
KSFLAVNLAVLLAASGKKVLLIDADMRRGKLERSFGIERTNGLAELLAGTIGLEQAIRTTRTPFLSFMPTGKRPENPSEL
LMSPRLQQYLDGLGRVYDVVFIDTPPVLAVTDASIIGKLSGTNFLVMRSGAHNEMEISDAIRRLRTAGIPLHGAIMNGMP
QRSRGYNRGHYAAVEDYLNV
>gnl|bykdb|A0A0J1D5C5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Caballeronia mineralivorans PML] (length=744 residues).
MAINFENRYADVVSTGDELRLSDYLAAILGSWRIIVMVTLAVVVLGTAYAFLAPPVYRADAMIQVTESNPANNANNNNAN
AVQTVSQMFDAKSTTAAEIELLRSRLVVEDTVNRLHLDIAARPRYFPIVGGMISDILGTRNGQAPVSWLSGFAWGNESIS
VPKFDTPKEAYDKTYILTAGENGSYVLSDPDGIAILNGKVGQEASGTSTLGPVTLLVENMVGEQGAKFELSRASTLGTVD
ALQKRLTVAETTLQSGIIALSLEGHDSKLTSQIVNNIARRFIQQDLDTRSAEAGKTLAFLEQQLPEVRAQLDQAEQKYNS
FRNKQGTVDLSEESRLLLQQVVDNKSKLMDLQQQRAELSQRFTANHPSVAALDAQIGALQAAQGSLTKNVSVLPDTEQTA
LRLLRDVRVDTELYTNLLNSAQQLRVAKAGQVGNVRVVDFAEAADDPVRPKRLLVILISLGTGLVLGIIVAFIRKALYGG
VERPEEIENRLGVRVFAIVPRSSQQLRLQQKVGSRSQGLHVLAATSPEDAAVEGIRGLRTSLQLQMADARNNVVMLTGSR
PDAGKSFLSVNLATLVASTRKRVLLIDGDMRRGDVHSHFGVRHMPGLSDVLMGSDIESAVLHDVLPGVDLLTKGSLPSHP
SELLMSDRMHEVLEVLKHKYDLVIIDTPPVLAVTDATVIGKHAGTSLLVVRHGRNQVEEIGETMKRLHHGGVNMKGVLLT
DVPQSKLMSGSSYTNYYGYESIPE
>gnl|bykdb|A0A0J1DG44 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Massilia sp. WF1] (length=761 residues).
MNIHGEPNSLSRVVHPSPIAGIPFDARTVEGSPDEPAFDLKGYFHTLYDNRWLIGGITAFITLVAVLYALVAKPVYESNL
MIHVEEESPNASKNILSEASSLFETKKAAIAEMELLRSRMVVSRAVDNLQLYIDVQPKYFPIAGFWFANQNNNGLSDPGL
FGYGGYVWGAEKAEVSVFEVPESWLGREFNLTALGNGRYRFSGGGQRIVFDGAVGLGYRVPTPEGMVELKVDRMAANPGA
RFRLRRISRVAMIQAIQSALVITEQGKQSGIIEVKLQGENARRTHTLLSEIGREYMRQNLARKTEEAEKSLAFLNQQLPI
LKRQLEQAEDRYNQFRNANGTVDLQEEARMSLAQAAAARARRIDLIQKKTELLSRFTEDHPVVAAINRQRKEVDAEIEEV
NARIKALPVLEQDEARLTRDIKVNTDLYTALSNTAQQLRLISVGRVSNVRMVDAPVPPEKPIKPNRPLIVALAVVTGLFL
GTLVAFARKAMKGGIDDPQRIERLLRARVVYATIPHSSNQDKLTRKTRDDAEPLPLLANIIPEDAAVESLRSFRAALQFS
MPHFKNNVVMFAGPTHGLGKSFVSANFAAVMAAAGKRVLLIDADFRSGRLHRYFGVNPDQGLSKAISGAASATEIIHHNV
VENLDFIPTGPLPPNRSEFLLDVNLSALLDTLSADYDLVLIDTPPILAAADALIIGAQAGAVFLLARASVTTEAEITESI
KRLNYAGMSPQGVLFNDMTYGIARYSTLHQASPANQLAFTG
>gnl|bykdb|A0A0J1G1V1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Caballeronia mineralivorans PML] (length=731 residues).
MTRRIAPRYIDPPVRDDVSLSENVDVVMENRKTVFWVVVTIFLLGLAYAFLAPPVYRADAMIQVEDPNSSNTSSPTPWQN
KDASTPFDPAAATAAESELIRSRAVIQPTVKALNLSVDATPKYFPVIGHWIARQMTGSEPAKPLLGLSGYAWGGEKISVA
TFSAKEDETYTLTAGTGGSYVLQNSDDIIVARGTVGEDTVGNDQGENVSIKVSSLAANPGTRFSVKRLRELDAIDRLQND
LKVEELGKQAGILSVTLEGQDNVKITQIVNEIARKYVAQNVEHKRQEAQTTLAFLDQQLPILKTALEHSENAYNAFRNAH
GTVDLSEESRLLLGQMVDAQSRQMDLEQRRNELAHRFSDQYPAVASLTQSIEQLKEQQRAFTDRVAVLPNTEQNALRLLR
DVRVNTELYTNMLNSAQQLNIVRAGQMGNVRVVDWAMTSAKPVKPRKTVIAGMSLMVGLVLGLGMPFLRRRFRPGMEHSE
HFEHVLGAPVYSVVPHSEKQAKLENRLRRGAKGQHLLATQAPDDIAVEAIRSLQTALHFGAFQPQNNIILLTGPRPDVGK
SFLAANLATVLAAGGKMVLLVDADMRGGDINTYFDVPASPGLSEAVGGQPPERLIRRGVAGTNLDFLPKGTKPGNPTELL
MSNRFKSLLDEFSRRYDVVVIDAPPLLAVADAAVVARYAGTTLFAVRHGRHTSAEIAEAERRLLNANVEVSGVLVNDVPQ
RSMKYGSYYPG
>gnl|bykdb|A0A0J1GH23 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Photobacterium aphoticum] (length=721 residues).
MSITQNTTVKPVESDEIDIGKLFGILIDSRWSIIFITALFALCGIAYALLSTPVYKADALIQVEQKSSGMTALGDMGELF
ASESSATTEIEIIRSRMILGKTVEELNLTTFVIPEYTPVIGKGLARLKKQSIHVSIPRFEIPDNTAEPTFTLVINDAKAG
TYTLLDQQEQPILDGVTGELTKAKDFTLLITSIQAIDGSRFTIQKHKPLDAIQTLQQNLSIAERGKQTGILKLSYTGEDR
QAIEAILNDISHNYFMQNVARNSAEAENSLTFLRTHLPDIKTELTKSEDLLNQFRQQNESIDLGLEAKSTLDVMVNIEAQ
LNELTFKESEISQRFTKEHPTYVALLDKRRTLMSERDRLNKQIQKLPKTQREVLRLTRDVEVNQQIYVQLLNKVQELNIV
KASTVGNVRILDTAQSYSIAVKPKKSLIVILATVLGSMFAIAITFIRNAFQRGVESPDQIEALGLPVYASIPMSDWQAEL
EKKQRRNKAIKIEDRLLALSNPADLSVEALRSLRTSLHFAMMEAKNNILMISGPSPGIGKSFVSANMAAVIAKSDQRVLL
IDADMRKGRMEVQMNLDAKPGLSTYLSGQIGLKEIIKQPGIEGLDFISRGIVPPNPSELLMHPRFKALLEWASENYDIVV
IDTPPILAVTDAAIVGSHAGTSLLVGRFGQSALKEIEITKQRFEQNGVQVKGFILNAVVRKASNYYGGNYGYYNYSYTSS
S
>gnl|bykdb|A0A0J1HH51 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Photobacterium ganghwense] (length=719 residues).
MSVPHNTQVKQDSAEIDLGKLFGILIDNRWMIIAVTFIFAVVGIAYALMATPIYKADALIQVEQKSSGMPALGDMGELFA
SESSATTEIEIIKSRMILGKTVDALNLTTVATPNYLPIVGKGLARIQGNKRDIVISRFEVPEYITEPVFELKVMDGEAGT
FALIDANEKTVLDGRVGELAQQGDFKLFVTALSAENDAAFTLAKRSRLGAIEWLQQNLSVSERGKQTGILQLSFTGENRN
EIEEILNDISQNYFLQNVARNSAEAENSLQFLRTHLPDIKAQLTASEDTLNKFRQENESIDLGLEAKSTLDVMVTIEAQL
NELTFKESEISQRFTREHPAYVALLDKRRTLLGERERLNRQIQKLPKTQREVLRMTRDVEVNQQIYVQLLNKVQELNIVK
ASTVGNVRILDAAQSYSRAVKPKKPLIVVLATLLGGMLAVAIALLRAAFHRGVENPDEIEAIGLPVYASVPMSDWQIELE
KKQKGKKQLTVNETLLAVSNPADLSIEALRSLRTSLHFAMMEAKNNIIMISGPSPGIGKSFVSANMAAVVAKSGSKVLVI
DADMRKGRMENQMAVNPKPGLSDFLSGQTDIESLLKKPGVEGMDFIGRGDVPPNPSELLMHPRFKQLMDWASENYDIVIV
DTPPILAVTDPAIVGAHAGTTLLVGRFGQNSVKEIEVTKQRFEQNGIEVKGFILNAVIRKASSYYGGNYGYYNYSYESK
>gnl|bykdb|A0A0J1JBA8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Photobacterium aphoticum] (length=720 residues).
MSVTHNTQVKQDADELDLGKLFGILIDARWSIIGTTFLFAMVGITYALLATPIYKADALIQVEQKNSGMPALGEMSELFA
SESSATTEIEIIKSRMILGKTVNELNLNYVATPVYLPIIGKGLARIQGKEITLEVGRFDIPENVKKPEYQVVVIDAEQGL
YELLDSEEQAVLTGKVGELAKKGGLQLFVTQWNAQNGDAFKITKRSDLDAIQWLQQNLSVSERGKQTGILQLSFTGENRK
QIEAILNDISQNYFMQNVARNSAEAENSLSFLRSHLPDIKAQLTVSEDLLNQFRQDNESIDLGLEAKSTLDVMVKIEAQL
NELTFKESEISQRFTKEHPAYIALLDKRQTLLGERERFNKQVQQLPKTQREVLRLTRDVEVNQQIYVQLLNKVQELNIIK
ASTVGNVRILDTAQSYTQPLKPKKSMIVVLATLLGGMFAVAVTLLRAALHRGVETPDEIEAIGLPVYASIPMSDWQVELE
KKQGKKKALTVQDTLLAVSNPADLSIEALRSLRTSLHFAMMEAKNNILMISGPSPGIGKSFVSANMAAVIAKSGSRVLVI
DADMRKGRMEKQMAVTSTPGLSSYLAGQTSIETLIKQLGIEGLNFIGRGEVPPNPSELLMHPRFKVLMDWASENYDIVIV
DTPPILAVTDAAIVGAHAGTSLLVGRFGQNAVKEIEITKQRFEQNGIEIKGFILNAVVRKASSYYGGNYGYYNYSYESNK
>gnl|bykdb|A0A0J1JP40 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Photobacterium aquae] (length=720 residues).
MSVSQHTQIKQDSDEIDLGKFFGILLDARWSIIAITFLFAIGGIAYALLATPVYKADALIQVEQKKSGMPALGEMGELFA
GESSATTEIEIIKSRMILGKTVDKLNLTTVVEPVYLPIIGKGLARIEGEIVDMNVGRFEVPVFVEKPQYTLTVTDAKLGK
YELYDSQERKVLEGKVGELAQNGDLKLFVTQLDANNDSLFTLAKRSKLDAIQWLQQNLSVSERGKQTGILQLSFTGENRA
DIEAILNDISQNYFLQNVERNSAEAENSLVFLRQHLPAIKVQLTASEDLLNKFRQENESIDLGLEAKSTLDVMVTIEAQL
NELTFKESEISQRFTKEHPAYVALMDKRRTLLNERERLNKQIQKLPKTQREVLRLTRDVEVNQQIYVQLLNKVQELNIVK
ASTVGNVRILDNAQSYTQAVKPKKSFIVVLATLLGGMLAVAIALLRAALHRGVENPDEIEAIGLPVYASVPMSDWQIELE
KKQKSKKQLTVQETLLAVSNPADLSIEALRSLRTSLHFAMMEAKNNIMMISGPSPGIGKSFVSANMAAVVAKSGQRVLVI
DADMRKGRMEKQMGVSHKPGLSNYLSGQTTIESLIKQPGVEGLHFIGRGEVPPNPSELLMHPRFKALMDWASENYDIVIV
DTPPILAVTDPAIVGAHVGTTLLVGRFGQNSVKEIEVTKQRFEQNGIEIKGFILNAVVRKASSYYGGNYGYYNYSYESNK
>gnl|bykdb|A0A0J1KC39 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Citrobacter sp. MGH100] (length=720 residues).
MTEKEKQSATSATGNDEIDIGRLVGTVVEARWWVLGITAAFALCAALYTLFATPIYSADALVQIEQNTGSSLVQDIGSAL
SNKPPASEAEIQLIQSRRVLGKTVDDLNLDISVTKDSFPLFGAGWDRLMGRQNETVNVTTFALPTSMNEQTFTLNVLNDK
SYQLVSDGGFSARGQVGQLLNHDGVTMLVEAIHASPGSVFTVSKFSTLGTINNLQNNLMVTETGKDTGVLSLTFTGEDRE
QIRQILDSITRNYLQQNVERKSEEAAKSLAFLAKQLPEVRNRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLFTKAHPAYRTLLEKRQALEDEKNKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITE
ASTVGDVRIVDPAIAQPGVLKPKTALIILGSILLGLMLSVVGVLLRSLFNRGIESPQALEEQGISVYASIPLSEWQKARD
NVQTIKGVKRYKQSQLLAVGNPTDLAIEAVRSLRTSLHFAMMQSRNNVLMLTGVSPSIGKTFVCANLAAVISQTDKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILSGKGDIPSCAKPTSIAHFDLVPRGQVPPNPSELLMSERFGELMTWASANYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFGQNGIQVKGVILNSIFRRASGYQDYGYYEYEYTSDSK
>gnl|bykdb|A0A0J1LHI9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Citrobacter sp. MGH105] (length=720 residues).
MTEKVKQSAAPVTGNDEIDIGRLVATVVEARWWVLGITTAFALCAAVYTLFATPIYSADALVQIEQNTGNSLVQDIGSAL
SNKPPASEAEIQLIQSRLVLGKTVDDLNLDIAVTKDTFPIFGAGWDRLMGRQNETVNVTTFTLPKAMNEQTFTLNVLNDK
SYQLVSDGGFSARGQVGKVLEHDGVTMLVEAIHASPESQFTVSKFSTLGMINTLQNNLMVTETGKDTGVLSLTFTGEDRE
QIRQILDSITRNYLQQNVERKSEEAAKSLAFLAKQLPEVRNRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLFTKAHPAYRTLLEKRQALEDEKSKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITE
ASTVGDVRIVDPAIAQPGVLKPKTALIILGSIILGLMLSVVGVLLRSLFNRGIESPQALEEHGISVYASIPLSEWQKARD
NVQTIKGVKRYKQSQLLAVGNPTDLAIEAVRSLRTSLHFAMMQARNNVLMLTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGKGDISSSAKPTSIPHFDLIPRGQVPPNPSELLMSERFGELIAWASSHYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIQVKGVILNSIFRRASGYQDYGYYEYEYTSDAK
>gnl|bykdb|A0A0J1LVU8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Citrobacter sp. MGH106] (length=720 residues).
MTENIKQSATPVTGNDEIDIGRLVGTVIEARWWVLGITTAFALCAAIYTLFATPIYSADALVQIEQNTGNSLVQDIGSAL
SNKPPASEAEIQLIQSRLVLGKTVDDLDLDIAVTKNTFPIFGAGWERLMGRQNETVKVTTFTFPKPMNEQIFTLTVLNAK
SYQLTSDGGFSARGQVGKLLNHDGVTMQVQAIHASPESEFTISKFSTLGMINTLQNNLSVTETGKDTGVLSLTFTGEDRE
QIRQILDSITRNYLEQNVARKSEEAAKSLAFLAKQLPEVRNDLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLFTKAHPAYRTLLEKRQALEDEKSKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITE
ASTVGDVRIVDPAIAQPGVLKPKTALIILGSIILGLMLSVVGVLLRSLFNRGIENPQVLEENGISVYASIPLSEWQKARD
SVKTIKGVKRYKQSQLLAVGNPTDLAIEAVRSLRTSLHFAMMQARNNVLMLTGVSPSIGKTFVCANLAAVISQTHKRVLL
IDCDMRKGYTHELLGTNNVNGLSDLLIGKSDLSSCAKPTSIANFDLVPRGQVPPNPSELLMSERFGELMAWASSNYDLVL
IDTPPILAVTDAAIVGRHAGTTLMVARYAVNTLKEVETSLSRFEQNGIQVKGVILNSIFRRASGYQDYGYYEYEYMSDSK
>gnl|bykdb|A0A0J1NXE6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Citrobacter sp. MGH103] (length=720 residues).
MTEKVKQSAAPVTGNDEIDIGRLVATVVEARWWVLGITAAFALCAAVYTLFATPIYSADALVQIEQNTGNSLVQDIGSAL
SNKPPASEAEIQLIQSRLVLGKTVDDLNLDIGVTKDTFPIFGAGWDRLMGRQNETVNVTTFTLPKAMNEQTFTLNVLNDK
SYQLVSDGGFSVRGQVGKVLEHDGVTMLVEAIHASPESQFTVSKFSTLGMINTLQNNLMVTETGKDTGVLSLTFTGEDRE
QIRQILDSITRNYLQQNVERKSEEAAKSLAFLARQLPEVRSHLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLFTKAHPAYRTLLEKRQALEDEKSKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITE
ASTVGDVRIVDPAIAQPGVLKPKTALIILGSIILGLMLSVVGVLLRSLFNRGIESPQALEEHGISVYASIPLSEWQKARD
NVQTIKGVKRYKQSQLLAVGNPTDLAIEAVRSLRTSLHFAMMQARNNVLMLTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGKGDISSSAKPTSIPHFDLIPRGQIPPNPSELLMSERFGELIAWASSHYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLGRFEQNGIQVKGVILNSIFRRSSGYQDYGYYEYEYTSDSK
>gnl|bykdb|A0A0J1R5I1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Citrobacter sp. MGH109] (length=720 residues).
MTEKVKQSAAPVTGNDEIDIGRLVATVVEARWWVLGITAAFALCAAVYTLFATPIYSADALVQIEQNTGNSLVQDIGSAL
SNKPPASEAEIQLIQSRLVLGKTVDDLNLDIAVTKDTFPIFGAGWDRLMGRQNETVNVTTFTLPKAMNEQTFTLNVLNDK
SYQLVSDGGFSARGQVGKALEHDGVTMLVEAIHASPESQFTVSKFSTLGMINTLQNNLMVAETGKDTGVLSLTFTGEDRE
QIRQILDSITRNYLQQNVERKSEEAAKSLAFLAKQLPEVRNRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLFTKAHPAYRTLLEKRQALEDEKSKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITE
ASTVGDVRIVDPAIAQPGVLKPKTALIILGSIILGLMLSVVGVLLRSLFNRGIESPQALEEHGISVYASIPLSEWQKARD
NVQTIKGVKRYKQSQLLAVGNPTDLAIEAVRSLRTSLHFAMMQARNNVLMLTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGKGDISSSAKPTSIPHFDLIPRGQIPPNPSELLMSERFGELIAWASSHYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIQVKGVILNSIFRRASGYQDYGYYEYEYTSDSK
>gnl|bykdb|A0A0J1VNC2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Enterobacter sp. BIDMC92] (length=727 residues).
MSSYTTDSYGAAAPENQEIDLLRLLSEMLDHRVLILSVTFVFTVLAGLYAFLATPVYRADALIQVEGKQDNSLLKNLRQF
SNALSPDVEPEILLLKSRMILGATVDELGLTQNVAQRGRLWARLQGHKPATLTLGWLQLSPVEGKPRTLLLTVLEKGAYR
LEGDNFSAEGREGKALEKAGVSLLVVNLDAPPGTQFTLQSSTRLEAINALSTQFSVVESAKQSGVLTLTLTGSDPERIAH
VLDRIANNYLQQNINRQEAQDSRSLAFLQQQLPKIRSELDQAEERLNQYRKQRDSVDLSLEAKSVLEQIVNIENQLNELT
FREAEISQLFKKEHPNYRALREKRHILEQEKIHLNQRVAAMPSTQQDILRLSRDVESGRTIYLQLLTRQQELNISRSSAI
GNVRIIDSAVTQPDPIKPKKTLIMVSGTLLGLMCSVGLVLLRIAFRRGINTSEQLEGFGVQVMATLPRSMWLWKKTNLRR
KRVLGSRWRHRINDVPFLPVDRPADIFVEAVRGLRTSLHFTLQDAANRIVMISGPTQDCGKTLVSTSLAAIEAQAGLRVL
FIDADMREGYVHNVFGLKNHTGLSCVLEEQCACQEAIQHYEQGNIDVLTCGPVPSHPSELLMSERFRAVMAWANEQYDLV
ILDTPPVLAVTDAAVAVRVAGTSLLVARFGKTRLKEMENSIKRLQQTGARIGGTVLNDVIKSATQYYRAGYDHYEYGQSP
ARRQRKD
>gnl|bykdb|A0A0J1VVL3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Enterobacter sp. BIDMC92] (length=715 residues).
MFDKHISKSQTDNVPREEDVDLFQILKVLYYSKVWIAVTTLLFIAFGIVIAYSLAPVYKSDALIQVEKNASTGLLNKLST
MLPEGSGVASESEISLIKSRMVIGKTVRDLALDISVTEKRYPFANALLLRLFGKPTGKIEISTLAVPEAFLNEAMILTIT
MAGDYTLQVGETVLQGNVGVPLHAHGIDFMIEHAELTQNTVFILRKHNEYSVIDEIKNNLVVDGKSGGNGMLHLSMTGSD
PVMISKILETISHNYLAQDVARKSEEASKSLAFVNEQLLQIKNNLVTAENKLNDFRKNNESVDLSLEAKFILDNVVSIDT
QLNELTFKEAEISKLYKRSHPAYKALSEKRAVLQEEKEKLNQRISTMPRTQQEILSMTRDVQMGNDIYMLLLNKQHELNI
NKASTLGNVRIIDNAVTQHKPVKPKKLLIVILSALTGFLFASGVILIRNMLIKGIKQPAELEKRGIPVHAVVPLAPERTK
SRRCRAITTYQSDELLAKSSPTSLAVEAIRGLRTSLHFAMLKAENKILMISGTSPGVGKSFISSNLAVLMAQAGTRVLVI
DCDLRRGYLHSIFSQTDGHAGLADYLSSDAEVARVIEETEYQGVDFIGRGRMVNNPAELFMTPKFRTLIDACSAQYDVII
LDTPPILSVTDAAIIGRFASTSLMVVRFEQNSIQEVEAGLRRFDQNGIAIQGVIFNGVEKRASASYSYGDYSYQE
>gnl|bykdb|A0A0J1VY95 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Enterobacter sp. BIDMC92] (length=720 residues).
MTEKTRPSAAPTSGSDEIDIGRLVGTVVEAKWWVLGITAVFAAAAVVYTLFATPIYSADALVQIEQNTGNSLVQDIGSAL
ANKPPASEAEIQLIQSRLVLGKTVHDLGLDISVTKNTFPIFGAGWDRLMGRNNDTVKVTDFVLPKGAADQTFTLTVLGPK
QYQLTSDAGFSARGEVGQMLTKDGVSMMVSAINAQEGGEFTVTKFSTLGMINNLQNNLTVTENGKDTGVLSMTFTGEDKD
QIRDILNSITRNYLEQNVERKSAEAAKSLAFLSKQLPEVRARLDEAENKLNAYRQDKDSVDLPLEAKSVLDSMVNIDAQL
NELTFKEAEISKLYTKRHPAYRTLLEKRRTLEEEKAKLNDRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITE
ASTVGDVRIVDPAITQPGVLKPKKALIILGSIILGLMLSIVGVLLRSLFNRGIESTQVLEESGINVYASIPLSEWQKSRD
SVKTIKGVKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAKNNVLMLTGVSPSIGKTFVCANLAAVVSQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILLGKGDISQSAKPTSIPKFDLIPRGQVPPNPSELLMSERFTELVEWASKNYDLVL
IDTPPILAVTDAAVVGRLAGTTLMVARYAVNTLKEVETSLSRFEQNGIEVKGVILNSIFRRASGYQDYGYYEYEYKSDSK
>gnl|bykdb|A0A0J2BE45 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQSSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDDK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHASPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAYRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGVKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A0J2BMN9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=726 residues).
MTTKNMNTPPGSTQENEIDLLRLVGELWDHRKFIVSVTALFTLIAVAYSLLSTPIYQADTLVQVEQKQGNAILSGLSDMI
PNSSPESAPEIQLLQSRMILGKTIAELNLRDMVEQKYFPIVGRGWARLTKEKPGELAISWMHIPQLNGQDQQLTLTVGEN
GHYTLEGEEFTVNGMVGQRLEKDGVALTIADIKAKPGTQFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDDPQ
LITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDNQL
NELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISK
SSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEHGISVYATIPMSEWLDKRT
RLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSD
QKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDH
YDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGY
SYSEKE
>gnl|bykdb|A0A0J2EY09 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=726 residues).
MTTKNMNTPPGSTQENEIDLLRLVGELWDHRKFIISVTALFTLIAVAYSLLSTPIYQADTLVQVEQKQGNAILSGLSDMI
PNSSPESAPEIQLLQSRMILGKTIAELNLRDIVEQKYFPIVGRGWARLTKEKPGELAISWMHIPQLNGQDQQLTLTVGEN
GHYTLEGEEFTVNGMVGQRLEKDGVALTIADIKAKPGTQFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDDPQ
LITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDNQL
NELTFREAEISRLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISK
SSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEHGISVYATIPMSEWLDKRT
RLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSD
QKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDH
YDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGY
SYSEKE
>gnl|bykdb|A0A0J2GYG4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella michiganensis] (length=720 residues).
MSVNNKTTVTESDDIDLGKLVGELIDHRKLIISITALFTLIAIIYALFATPVYQADAMVQVEEKQANAILGNLSQMLPDS
QPQSAPEIALLQSRMILGKTVDDLNLQTLVSEKYFPLFGEGWAKLTGQKPHSISVSRFYVGEIDNNDETDAIVTVLDSKN
YTITGENFELKGTVGELVEGNGVSVKIAEIDAPKGTEFKISSITKLKAISDLQKIFSVADQGKDTGILSLTITGEDPILI
KKILNSISENYLAQNIARQAAQDQKSLEFLNQQLPKVRSDLDNAEDRLNAYRRQNDSVDLSLEAKSVLDQIVNVDNQLNE
LTFRESEISQLYTKEHPTYKALLEKRKTLQDEKGKLNKRVSSMPETQQEILRLSRDVESGRAVYMQLLNRQQELNIAKSS
AIGNVRIIDSAVTQPTPVKPKKILIIIVGLVLGGFISIGFVLFRVFLRRGIESPEQLEELGINVYASIPVAEAFAEKALQ
KSSWKRKSVEEYASFLAIDNPADLAIEAIRGLRTSLHFAMMEARNNVLMISGASPNAGKTFVSTNLAAVIAQTGKKVLLV
DTDMRKGYTHRLFNVSNDNGLSDVLSGKIKVENAVKQVKDIGLDFISRGMVPPNPAELLMHRRFGELIEWASKNYDIIVL
DTPPILAVTDAAVIGNYAGTTLLVARFEQNTVKEIEVSFKRFDQSGVAVKGCILNGVVKKASSYYGYGYNHYGYSYNNDK
>gnl|bykdb|A0A0J2HL15 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQNSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDDK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHARPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEEEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGIKRYKQSQLLAMGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLTAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A0J3VWG4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQSSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDDK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHASPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEEEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A0J4X4K0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella pneumoniae] (length=718 residues).
MQLKNKTDLNQEKAEFDLGRFIGDVIDHRKLIISVTSLCTLLALVYILFSTPIYQADALVQVEQKKGNAILNSLSQVLPD
TQPQSAPEIALLRSRMILGKTVDDLNLQASIKQDYFPIFGQGWSRLIGKKEGNLHINRLYLTGENDGPSAITIIVKDANN
YSVVIGQKILNGKVGQLLDLDDGSLNIDKIDALPGTKFKISYLPRLKAITDLQTNLVVADLGKDTGMLNVSYTGDNAELI
KNIVDSITRNYLEQNISRQAAQDAKSLEFLSQQLPKVRSELDFAEDKLNLYRQQNDSVDLSLEAKSVLDQIVNVDNQLNE
LTFRESEISQLYTKEHPTYKALMEKRKTLQDEKAKLNKRVSSMPETQQEILRLSRDVESGRAVYMQLLNRQQELNIAKSS
AIGNVRIIDEAVTQPKPVKPKKVLVLLLGIFIGVIVSLALVFLRKLLRRGIESPEQLEEIGVSVYASIPVSETFAKTPQK
RMLNKFKEEGIGFLAIDNPADLAIEAIRGLRTSLHFAMMESRNNILMISGASPNAGKTFVSSNLASVIAQTGKKVLFIDT
DMRKGYTHKLFSVNNTNGLSDVLSGKVKPFEAIKTIPSAGIDFISRGVSPPNPAELLMNRYFGELVTWASDNYDLVVLDT
PPILAVTDPAIIGNYAGTTLLVARFELNTVKEIEVSIKRFEQSGVLIKGCILNGVVKKASSYYSYGYNHYGYTYDDKK
>gnl|bykdb|A0A0J5P8Z5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Muribacter muris] (length=703 residues).
MNKNDEYQIDLVKLFGSLLDHKWLIACITLAFSLLGGVYSLLVTPIYTANATIQIEKNSTASIFKDFTSILDQQSYVQTE
ISILKSRLVLEKTVQELNLTTQISAIYPIPFISKALERLFGDYSDITIAEFEPTNESFEQLILEIAPEENQYSLFSDTGE
LLLKGMINHKYSNNNFTIQVSKLKGSIGKKFRISKISHLLSIQKLQKNLLVSEKGKQTGVIEISLNGENKNQIKQIVKSV
SDNYISQNILRSSEDASKSLDFLQNRLPEIRENLANSENTLNEYRQKNSSIDLSLETKSYLDTLVRLDTDLNVLLSKESE
ISQKFTKRHPNYISLLEQKRVLLREKEKISRQISDLPDTQKEILRLSRDLEIEQQIYIQLLKKMQELDVIKAGIIGNARV
LDIAQVMPDIVFPKKMLIVALSTLLGIVFSFAFVMLKMLFRRTIESVDEIQEQIGLVVYGTIPFSREQIEVSVDKIYKRS
AYPLLSDFNPADLSIEALRSLRTSIHFAMMETNNNIIAFSGSSPSVGKSFISLNFSNIAAKAGQKVLLIDMDLRRSYIHK
LLGLEESPGISDILTNHIDFKEAIITKSNLSFDILTKGTFVKNPAEILSSKRVQDLFQWASKNYDLVIVDTPPILAVTDA
AIIGNYISMVFLIGRYEQTTLREVKLSKEIFEKSGVLVKGFILNGIKRKASNRYDYYQYDYTS
>gnl|bykdb|A0A0J5WBE1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia cepacia] (length=741 residues).
MVNTQAKHSYADLSVKTEEEDVVLGQLLQVIMDDIWLLLGIAVTVIALAGLYCYIAKPVYQADVHVRVESNDNTSQALTQ
TQTGAMINTGPQQAQTDAEIEIIKSRGVVAPVVEQFKLNFSVAPKTLPVIGSLAARVATPGVPARPWLGLKSYAWGGEVA
DIDSISVAPALEGKKLTLTAGPNDTYALADENGGRLLSGRVGESAQGGGVTLLVQKLAARPGTQFTVVRYNDLDAISGFQ
TGIQVTEQGKQTGVVQISLEGKDPDQTAAIANALAQSYLNQHVVAKQAETTKMLDFLKGEEPRLKSDLERAEAALTQYQR
TSGSINASDEAKVYLEGSVQYEQQIAAQRLQLASLAQRFTDSHPMVIAAKQQLAELQGEKDKFSNRFRSLPATEVKAVQL
QRDAKVAEDIYVLLLNRVQELSVQKAGTGGNIHLVDSALRPGDPVKPKKVLILSAAVFLGLILGTGVVFLRRNMFQGIED
PDRVERAFNLPLYGLVPQSAELAKLDAAAEKGGGRARPILASLRPKDLSVESLRSLRTAMQFAMMDAKNRVIVLTGPTPG
IGKSFLAVNLAVLLAHSGKRVLLVDADMRRGLLDRYFGLTPQPGLSELLSDQSALEDAVRETPIPGLSFIAAGTRPPNPS
ELLMSTRLPQYLEGLSKRYDVVLIDSPPVLAVTDATIIGRMAGSTFLVLRSGMHTEGEIADAIKRLRTAGVDLEGGIFNG
VPPKSRGYGRGYAAVHEYLSA
>gnl|bykdb|A0A0J5WDA9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia cepacia] (length=765 residues).
MTTTPSHEHPHDRDDELDLAGAIDVLVSRRWLIAIVTAACMGAGTLYAFLAPRQYQADIMVQVEDSGDSSAAKSVLGDVS
SLFDIKSSAAAEAQILASRLVITRAVDELRSYIVAQPKRFPVVGEFVSRFNTGISRPGLLGLGGYAWGDESAELARFDVP
KPLEGERFELSLLDSSRYRLTSAALPEPVTGTFGHPETFATAYGPIAIEVTRIDAHPDTRFTLVRESRAGTIDALRRGLD
VQEKIKQSGVIVATLRGADSQRVQAQLQAIANHYVRQHIERKSADAAQSLAFLNAQLPVLKKQLQDAEQRYTNMRNANGA
IDLDEEAKLILQQSADAKTRRLELQQKRDAMGSRFAPGHPDMIALDAQIATLAREQQSFEQQVRRLPDLQQNAVRLMLDV
KVDTDLYTALLANAQQLELVKAGKTGSVRLVDTPVAPEDPVRPNRPVVIAAAALLGLALGVALAFVRDTLFGGVRSADEI
ERPLGIDVYATVPESTGQRQVARRIAQCVPGPHLLSVLHPHDPAVESLRSLRTALRFAMQRARNNVLLLTGPVPGAGKSF
VASNFAALLAANGERVLLVDGDLRRGYLHDALGVEREPGFAELMSGTVEPDAAIRRDVIPNLDFIPTGAIPAHPAELIVD
DRVGALLDTLSARYDLVVIDAAPILAVTDAVMLGRHAGTVLLAARAASTRVAELGEAIRRLAHNGVDASGVLLNGVDPRS
GGYGSRYGAYRYTEYRYAPSRCGIAASIGQSLRAFAARLRRGAQR
>gnl|bykdb|A0A0J5XMN2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pectobacterium peruviense] (length=722 residues).
MAEKISVKTSETNSDEIDLGRLLGTLLDHRWLIIGVTAIFTIIGILYATFATPIYRSDALIQVEQNTGNSLLKDISSVLP
DAKPESAAEIELIKSRMVLGKTISDLSLDIVVQKKYFPIFGKGFSRLMEYVPEKVAVSRLEVPASWQDEWFELRIIDNST
YEVNVGDTVKFEGKVGQIEKQSGLSILVSDVQAEKNTVFRIKKLNSITAINDVLEDLTVADKGKDTGVLSLSYEGEKADL
INKILNSISQNYLQQNVERKSEEAGKSLEFLKEQLPSVRTGLDEADNKLNSYRQKNESVDLTLEAKAVLETMVAVESQLN
ELTFKEAEISKLYTKEHPAYRALMEKRKTLEEEREKINKRVGAMPKTQQEILRLTRDVNVGQEVYMQLLNKQQELSINKA
STVGNVRIIDAAAVKIKPVKPKKVIVVLLSMFAGAVVSIAFVVLKNFLHKGLESPEQLEELGINVYASVPLSEWQQKKDR
ALLSRNKKGNTRSTELLAVGNPADLAIEAIRSLRTSLHFAMMEAKNNVLMISGASPAIGKTFVSANLGAVIAQSGQRVLI
VDCDMRKGYAHELMGVQGTNGLSDILSGQIPTEKSIRKTAVENMDFIPRGQIPPNPSELLMHSRFSQFIDWAIKNYDIVL
LDTPPILAVTDAAVISRHAGTSLLVARFEVNTLKEIEVSIRRFEQNGTEIKGVILNAIVKRAASYYGYGNYNYYSYEYKS
DK
>gnl|bykdb|A0A0J6G786 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas deceptionensis] (length=742 residues).
MQQAPVTKPHEQDDDNDEIDLMGLLGTLLDHKWLIAGVTGAFMVAGVAYALLATPVYQANALIQVEPKKSDPLGFSDIGG
MLGKESPSATEIELIKSRKTIGTAVDNLQLDIEIEPNYFPLIGEFLARRFKPEPGTDLASPVLGFNSYAWGGEQLKIAEL
ELPAELLGQELTLINGEAGNFVLKDEDNNILAEAMVGELYNKEGIKLLVERLRANPGTEFSVTREPRLTAILNYQKVLDV
AERGKESGMISLALESTDPSKAIQTLNEIARLYVQQNIERTSAEAEQSLGFLKDQLPQVRQDLEKAENALNAFQIRSKSI
DISLEAKAILDQIVALDTSISTLKLQQAEMDRKFTPQHPAYRALMGQLAELTSKQKRLAKQVEGLPTTQQEVLSLTRDLK
VSTEIYTQLLNKSQELDVMRAGTVGNVRLIDVADVDTRSPVKPNKPLIVLIATLLGGLIAVGYVLFRKALNRGVENPEDI
EKLGLPVYASIPFSSLQKVEDGKSSSGRGRRATPLLASSHPTDLAIEGLRSLRTSLHFAMLEADNNRLMISGPSPKVGKS
FVSANLAAVIAQSGQRVLLVDVDMRKGYIHKMFDIPVENGLSDLLTKRCDLNAATHKTEVENLFVIGRGQIPPNPSELLM
HKNFSEFLEQVSAQYDLVILDTPPFLAVTDAAIVGRQSGTNLIVTRFELNPAREVELTMRRFAQNGIDLKGAIFNGVERR
ASAKYGYGAYGYYNYEYKSDKV
>gnl|bykdb|A0A0J6HHU9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas lini] (length=742 residues).
MQQAPVVNVRDDDNDEIDLLGLFGTLIDHKWLIAAVTGAFMVAGVAYAVLATPVYQANALLQVEAKKNDLLGFSDVSSML
GKESPSATEIELIKSRAVIGKTVDNLKLDIVIQPMYFPVVGEFLARRFQSKNPGEIADPLLGLNSFAWGGESLKIFKLDL
PDSQLGKKLTLTAGESGHYTLVDEDDNLLVASQAGQLFEQNGVEFQIEEMQANPGTRFRIIRNSRLTSILDYQEDLDVTE
RGKESGMIGLALESTDPNQAIKTLNEIAAIYVRQNVERTSAEAAQSLAFLKEQLPVVKKDLEKAGNALNEYQTRSKSVDI
TLETKAILDQIVGLDTSISGLKLQQAEMDRKFTRQHPAYRALLTQIGELSSKQKSLASKVEGLPSTQQELLSLTRDVEVG
TAIYTQLLNKSQELDVMRAGTVGNVRLIDTADVNFFKPVKPKKVLIVLIATILGGFLAVVLVLVRKALNRGLESPEAIEQ
LGLPVYASIPYSILQKSEEDKVSRGRGRSGAGSTLLAVTHPTDLAVEALRSLRTSLHFAMHEAGNNRLMISGPSPQVGKT
FVSVNLAVVIAQTGLRVLLIDVDMRKGYLHKVLGVNSDNGLSDILARRCDVATAIHKTEIDNFDFVSRGQIPPNPSELLM
HANFSALLEQASELYDLVILDTPPILAVTDAAIVGRLSGTNLIVTRYGLNPAKEIELTVRRFSQNGVAIKGAIFNGVEKK
ASNKYGYSDYGYYHYAYASDKN
>gnl|bykdb|A0A0J6HLN5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas lini] (length=751 residues).
MDNSPSLYVERPIQPHVPQHQPYSEEKDTIDLLKYWRVIWRAHWKIGGLIVLGCVLAMATLSFIPAQYTGSTTLLIKEKT
PPLLTFQQVTDSSSGTVDYLQTQLALLQSRDLAERAVKKLSLTTHPVTDPRQQPKSWFAPRRWLAALELDQWLPVLGRFI
PVQVRPSEADVFNQVTQDLMRRTHVKFVGKSQLIKIEVELPDPGLAAATANAIAQGFIDSQFDNNLRSSQTNTSWMNSRL
IELRNNLRSAENKLQAYREAQGLVDVGGVGGVATISANELEMTGNRMIDARRNLAEAESRFRQVQTLSNGNLSKLSSVPA
VLSNPLVQKFQAQQAKAQAKVEELSGRYGPKHPTLAAARAELRTATDSLRLQVRQVVASIEQDYQLARTSENSLRKSFNS
NKAQIQDISRKEFQLREFQREVDSSRALYETFITRLKETTATADMDATKARIVDPAIVPLEPSKPRKSLIVAIVAIVAAL
IGVVLALLSETLNKTFKTDEAIESTLDVPLLSVVPLVTRKSRRQLARLFDDNDHPRFCETIRNLRTWLMLHSSDMPSHVV
LVASTMADEGKSTIANNLAYSLAKLERVLLIDADMRRPSLSLNFDFPADGPGLANVLAGTARLEDCIRTVGNLDMLPAGK
LSPPPLDLLSSPRLAPMLEALKSRYQRIIIDSPPAQMVSDALLLAKHSDAVIYVIKAQSTPVSQVQKCLAILQQSHAPVF
GVVLNQVDLSKARKQGYSHSDTFQNYDYMSR
>gnl|bykdb|A0A0J6HNL3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas psychrophila] (length=742 residues).
MQQAPVTKPHEQDDDNDQIDLMGLLGTLIDHKWLIAGVTGVFMAAGVAYALLATPVYQANALIQVEAKKNDPLGFSDISS
MLGKESPSATEIELIKSRKNIGAAVDNLKLDIKVEPNYFPLIGEFFARRFKPDAENSVASPMFGMDSFAWGGEQLKLAEL
ALPPELLGKQLILVSGESGSFTLLDDDDNLLVKGQIGEFINENGIKLQVETLKSNPGTTFTVIRSPRLTTILNYQQALDV
AERGKESGMVGLALESTAPAKAIEILNEISRLYVLQNIERTSAEAAQSLGFLKDQLPQVRKDLEKAETALNQFQIRSKSI
DISLEAKAILDQIVALDTSISTLKLQQAEMDRKFTPQHPAYRALMGQLAELTSKQQRLAKQVEGLPSTQQELLSLTRDLK
VSTEIYTQLLNKSQELDVMRAGAVGNVRLIDTADVDLRTPVKPKKSLIVLVATLLGAFLAIGYVLFRKALNRGVENPDDI
EKLGLPVYASIPFSSLQKVEDDKSTHGRGTRVTPLLASSHPTDLAIEGLRSLRTSLHFAMLEANNNRLMISGPSPKVGKS
FVSANLAAVIAQSGQKVLLVDVDMRKGYIHKMFGIPVENGLSDVLAKRCDLSNAIHKTEIENLDVIGRGQIPPNPSELLM
HKNFSDFLEQISSKYDQVILDTPPFLAVTDAAIVGRQSGTNLIVTRFELNPAREIELTMRRFAQSGIELKGAIFNGVEKR
ASAKYGYGAYGYYNYEYKSDKV
>gnl|bykdb|A0A0J6I529 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas helleri] (length=742 residues).
MQQAPVTKSHEHEDDNDEIDLMGLLGTLIDHKWLIAGVTGAFMAAGVAYALLATPVYQANALIQVEPKKNDPLGFSDVSS
LLGKESPSTTEIELIKSRKNIGATVDNLQLDIDVRPNRFPLIGEFIARRFKPEIDGEIASPLLGLNSYGWGGEELKLAQL
EVPRELLGKSLTLISGDSGAFSLIDDEDNLLIKGNAGKDINENGVKLQVETLHANPGTKFTIIRNPRFNTIADYQKALDV
AERGKDSGMIALALEDQDPAKAILTLNEIARLYVLQNVERTSAEAAQSLGFLKDQLPQVRKDLEKAENALNAFQIRSKSI
DISLEAKAILDQIVALDTSISALKLQKAEMDRKFTPQHPAYRALMGQLAELTAKQSRLAKQVEGLPTTQQEVLSLTRDLK
VSTEIYTQLLNKSQELDVMRAGAVGNVRLIDTADVDLLSPVKPKKALIVLIATFLGAILAIGYVLFRKALNRGVQNPDDI
EKLGLPVYASIPFSSLQKVEDDKSSGGRGTRVTPLLASSHPTDLAVEALRSLRTSLHFAMLEADNNRLMISGPSPKVGKS
FVSSNLAAVIAQSGQRVLLVDVDMRKGYIHKMFDIPVENGLSDVLAKRCDLSTATHSTEVENLFVIGRGQVPPNPSELLM
HKNFSEFLDEISSQYDMVILDTPPFLAVTDAAIVGRQSGTNLIVTRFELNPAREVELTMRRFAQNGIDLKGAIFNGVEKR
ASAKYGYGAYGYYNYEYKSDKA
>gnl|bykdb|A0A0J6MB40 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Leclercia sp. LK8] (length=720 residues).
MTEKTRPSAAPTSGSDEIDIGRLVGTVVEAKWWVLGITAVFAAAAVVYTLFATPIYSADALVQIEQNTGNSLVQDIGSAL
ANKPPASDAEIQLIQSRLVLGKTVHDLGLDISVTKNTFPIFGAGWDRLMGRNNDTVKVTDFVLPKGAADQTFTLTVLGPK
QYQLTSDAGFSARGEVGQMLTKDGVSMMVSAINAQEGGEFTVTKFSTLGMINNLQNNLTVTENGKDTGVLSMTFTGEDKD
QIRDILNSITRNYLEQNVERKSAEAAKSLAFLAKQLPEVRGRLDDAENKLNAYRQDKDSVDLPLEAKSVLDSMVNIDAQL
NELTFKEAEISKLYTKRHPAYRTLLEKRRTLEEEKAKLNDRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITE
ASTVGDVRIVDPAITQPGVLKPKKALIILGSIILGLMLSIVGVLLRSLFNRGIESPQVLEENGINVYASIPLSEWQKSRD
SVKTIKGVKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAKNNVLMLTGVSPSIGKTFVCANLAAVVSQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILLGKGDISQSAKPTTVPKFDLIPRGQVPPNPSELLMSERFSELVEWASKNYDLVL
IDTPPILAVTDAAVVGRHAGTTLMVARYAVNTLKEVETSLSRFEQNGIEVKGVILNSIFRRATGYQDYGYYEYEYKSDSK
>gnl|bykdb|A0A0J6MG48 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Leclercia sp. LK8] (length=726 residues).
MSSSQSDKYRAATPQNNEMDLIQLLAEMFDHRVTIACVTLLFTVCAGIYAFSATPVYQADALVQVEAKQGNALLKNLTSF
RPDLSPDVAPELLLLKSRMVLGETVDQLGLTYEVSQRMFPVIGALWQHVQGRKPAEITIGSLNIPLVEGEPQTLLLTVQE
QGRYRLEGKTLEAEGVVGKALVKEGVSLLVTSLSAVPGTQFTLNTVTRLDAINALQSRLTIAESAKQSGMIALTLTGDDP
DKTATILNSIAEHFLSQNIARQEAKDSRSLAFLQDQLPKISLELNEAEARLNAYREQRDSVDLSLEAKSVLDQVVNVENQ
LNELIFREAEVSQLFKKDHPTYRALREKKQTLERERARLNSRVSSMPSTQQEILRLSRDVESGRTVYMQLLTRQQELSIS
RSSAIGNVRIIDPAMTQPAPVEPRKALIIVFGMLMGLILSAGTVLVRSAFKRGITSSEQLDELGMPLLVTLPRSAWLWKK
THLRRRNLFTSHWKHKIANVPFLPIDRPADSFVEAIRGLRTSLHFTMMDATNRIVVVSGPTQDCGKTLVSSSLASILAQA
GQRVLFIDADMRKGYVHNVFRLDNQRGLSSVLDGTVEWQEAVQRFEKGGFDVLTCGPQPAHPVDLLMSECLQGIMSQIEK
RYDMVIIDTPPVLAVTDALLIARAAATTLLVARFGKTSVKEIETSLKRMERMGVQVSGTILNDIVKSAALYYNSGYSYYD
YGYSPE
>gnl|bykdb|A0A0J7Y2D8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingobium czechense LL01] (length=705 residues).
MGLPAFPMRDDADNGGEGFSARLSAAAQRCWLVLRRHRVILFVTMALCLLAGALFILTSTPDYRATASVEVEDVPAGAAG
SAAAQRAGSANDTETLMQTELEVLRSRALAEEVARDLSLVGTPTFFKGMDEVRPPEGVGTLSQRQVEQDMVVRLLRDNLE
VELPGKSRVLRISFVSADPVLSARVANSYADSLIRADLKRGFESGVQARRFLLGELDGARNDLARAERDMAVYATRTGTP
AQSGEESKPVKPAAPDGSVATRLAQLNAFRAQAAADRIAAQKRWESARRASADTLPEVLGNGAMQQIMADRAQARAAVAE
ERQFRKDAHPEMREARAKLAALDEQADSMANTIRASLREQYEVAVRGEDQIAKEIAQLEQQAQVEQGRDVQMGIMERSVD
TYRMLHDSLLQRYRDMASQAGFQAGRIQPLDRAAVPTRPFSPRIGVTLLLASLGGLALGLLLVAARHMFDDAVTSADTLA
ERVGLSLLGAVPVTGDNPQPAEIFTPIAASLLLASADGLPRSILVTSAQEGEGKSLTLHALALALAGLGKSVLVIDGDMR
RPVQHRLFRLSPARGISEVLTGQAMAQDVIVDTGIAGVALLPCGTLPPNPSELLSTPALDGLLTAVRDRYDTVLIDAPPI
LGIGDAPLLAAKAQASLLVVEWGRNHHGGLRAAVERLRRSGGAIVGAILTKQQGRAMDYDYHRGG
>gnl|bykdb|A0A0J8A5G4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Novosphingobium barchaimii LL02] (length=705 residues).
MRQYLRIAMRWRYVILGAVAVCFLIGLIATLLMTPQYTASSTIEISREADKVTDLQGVEREAGIADQEFYQTQYGLLESR
ALSERVATQLKLTESQNFFEMFGFESDDPAFALANGRYPASGRATRQRVAGEILREHLSISPTRMSRLVEIKFTSPDPAF
SAKVANTWGENFIQTNLERKIQATSYGRDLLQKQLGQLKQRLDESQRQLVNYASSAKIINLPAQSGNGQSSSERSIVVDD
LAALNASLAQATASRIEAQARYQQSGRAGASAEALSNSAINSLRQRRAELAAEYRRLMTQFEPGYPAAQAIQAQITQLDR
SIAGEEGRVTSSLLADYRRTEEQEKALQAKVEQLKGDYLDLRRRSIQYNIYQQEVDTNQALYDGLLQRFKEIGVAGGVGV
NNISIVDPAQAPKLPSSPKLLINLAIALLAGLGIGAALAFGLEQIDEGITDPAEAKRELGLPLLGSIPKIDEAPKDILLD
RKSDLVDAYLTVQTNLAFSTEHGVPRSFSVTSTRPIEGKSTTCLALATTLSRGGKRVILIDGDMRNPSVHHLGGVRHDRG
LSNYLTGEDNIDALTFPMEDLGFTAMSAGPLPPNAAELLTGSRLSQLIVQLLETYDHVVIDSPPVMGLADAPLIAAKVEG
VIYVVESHGIRTGLVKEALGRLITANVRIIGCVLTKFDAKKAHYGYGYGYEYGYRYGRKAEPDAA
>gnl|bykdb|A0A0J8AKB5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Novosphingobium barchaimii LL02] (length=724 residues).
MNKSVVLAPQPGSLVPATRPAAAPAPADRIDPGLLLAFLRRRWPLILGVLLLCLAAGLVITARQTPTYLSTAEVTLDAKV
EPIAPLSEDDRLAAQGSLGETYIDTQVEVMTSSHNVAGVVDRLGLARDRRFMQEGVNAAGARDAAIAYVEDGVTAFRSGA
TYTISVAFESEDPAEAARIANAFAEQYTLGTLADKETGDGKALKEVGARMEAARIQASTDAATLSRYRLAHNLPTTTDRS
LTEQEISAYNQQVTEARAQAAEDTARLATARQQLGMGSAGDDVGEALGSGVVASLRQQQAGYAAEIASLSSKYGPRHPDL
LRARSQLDAVTGQIREEIGRVISNLSAKAAVSQKRLDSLSGSLNTSQGALRRDNVAMVDLQDIDQRAQASKSLYENYLSR
YKELAARIGIRQPEARVLHPALPSETPARPNFLLNMVLSGALGLALGIICAITAEMMFSGLTSGEDVERRLGVHYLCSVP
ELTSVLSRKERGGVAGDPVEAVVDHPRSAFAEAFRNLRASIAFAVENPRIIAITSALPSEGKTTVALCLARSMASGSDRI
LLIDCDVRRRGVSRWLAGTREVGLLEVLRGDAKLEDAIVTDPRTGLSILPLSSSAQEDHALLTGTGMDTLLALAAQSFDA
VIMDTAPVLPMADARLLLCKADASIIAARWRRTPEAAVRSLLRMLPAGYFGMAGMILTRVDVRKQAAFGVDENAFYKAYK
DYYA
>gnl|bykdb|A0A0J8SMY0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter sp. VT 511] (length=727 residues).
MSQTTNAEDTIDLKELFFSLIAQWKLIALCVILSIVAALLYLRVTPDTYRVDALVQVEESKGASAALLGDMSNMIEQKQP
AQAEIEILKSRLVLGDVIDRLNLDLQVAGTENSLFDRLLNPHDYRTEYSPQSVLFRDGDQAFDIRQFDIPQAYYDKTLEL
QFKEQQFSLTDPRTGQVVFSGLLNRNNQATHANGTWKVAIFSQDQFQDRYLISKQSLPAAANRLLANYSVAEKGKMTGIL
GLNYEGQDKAHITQVLNAILQAYSQQNVERRSAETAQTLKFLEDQLPELRQQLDVAEREFNQFRQQSNTVDVTKESELYL
TQSIALETQKAQLEQSVAEASAKYTSEHPVMQQMEAQLAAINSRIAELNGTLKQLPDLQRRYLQLYREVEVKQQLYTALL
NSYQQLRIAKAGEIGNVRIVDTAVEPLKPIAPKKLQILILSIFLGGFLGILIALLRNMMRSGIKDAAQIENELDIPVYAT
VPRSAVQESRVKLLKKKKSIPILAVKDSEDIAVESIRSIRTTIHFSLTEAKNNIIAISGPAPEVGKSFITANLGAILAQG
GKKVLVMDGDMRRGYLHKYFNQDTAPGLSELLLGTHTLEQVIKADSYEGLYFISRGKNPSNPAELLGSQKFQALLSELSA
QFDHILIDTPPALAVTDGVIIAQSAGVNLLVVRHAKTQMKELELTINRFEQAKVKVNGVILNDVQKGVASSYGYNYAYVY
TANKDND
>gnl|bykdb|A0A0J8V5A3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Photobacterium swingsii] (length=722 residues).
MSISQNLPPKQSESDEIDLGKLFGILVDSRWMIIAITIIFSVVGVCYALLATPVYKADALLQVETKSSGMPALGDMGELF
AQESSATTEIEIIKSRMVLGKTVDKLNLTTIAKPNYFPFIGKGLARITGNESSISIARFEIPKYVAEPNFTLVVTDSEAG
KFTLIDSNEREVLTGKVNELAQNGEYRLFVTALVGEVDSEFTLAKRSRLDAIQALQQDLAVSERGKQTGILQLSLTGENR
ANIERVLNDISQNYFLQNVERNSAEAENSLAFLRKHLPDIKSELITAEDKLNRFRQANDSIDLGLEAKSTLEVMVKLEAQ
LNELTFKESEISQRFTKEHPAYSALLEKRQTLLGERERLNKQVQKLPKTQREILRMTRDVEVNQQIYVQLLNKVQELNIV
KASTVGNVRILDVAQSYTRAVKPKKPLIVVLATLLGGMLSVAIVLLKAAFHRGVENPDDIEALGLPVYASVPMSDWQTEI
EKKRGNKKTLLPVEQTLLAVSNPADLSIEALRSLRTSLHFAMMEAKNNILMISGPSPGIGKSFVSSNMAAVVAKAGQRVL
VIDADMRKGRMEQQLAVENKIGLSDFLSGQTSIESLIKKPGVDNLDFITRGNVPPNPSELLMHPRFKQLMDWASENYDIV
IVDTPPILAVTDPAIVGAHAGTTLLVGRFGQNTAKEIAVTKQRFEQNGIEVKGFILNAVVRKASSYYGGNYGYYNYSYES
KK
>gnl|bykdb|A0A0J8VMR2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Franconibacter pulveris] (length=720 residues).
MTEKVRHSAASSEGSDEIDIGRLIGTVIEAKWWVLGITALFGLLALIYVLFATPIYSADALVQIEQDAGNSLVQDINSAL
TNKPPASDAEIQLIQSRLVLGKTVDDLDLDIAVEKNTFPVFGAGWDRLTGHANDTVKVTTFNLPKGMAQDTFTLEVLGPQ
QYQLTSDAGFSARGTVGQMLSKDGVQMMVSAIQAGEGSDFTVTKYSTLGMINQLQGNLTVTENGKDTGVLSLTFTGEDRD
KIRDILNSITRNYLEQNVQRKSEEAAKSLAFLDKQLPEVRARLDDAENKLNAYRQEKDSVDLPLEAKSVLDSMVNIDAQL
NELTFKEAEISKLYTKAHPAYRTLLEKRQALEDEKAKLNKRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITQ
ASTVGDVRIVDPAITQPGIVKPKKALIILGSLILGLLLSVVVVLLRSLFNRGIESPQALEEAGINVYASIPLSEWQKERD
SVKTVKGVKRYKQSQLLAVGNPTDLAVEAIRSLRTSLHFAMMQARNNVLMLTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTTNVNGLSDVLAGQGDISRCAQKTSIPGFDLVPRGQIPPNPSELLMSERFAELVKWASSQYDMVL
IDTPPILAVTDAAVVGRHAGTTLMVARYAVNTLKEVETSLSRFEQNGIQVKGVILNSIFRRATGYQDYGYYEYEYKSDHK
>gnl|bykdb|A0A0J8YNH2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][bacteria symbiont BFo1 of Frankliniella occidentalis] (length=726 residues).
MKIKSKAPSAPKDDSSGFDLAHLVGQLIDHRWIIVAVTALFMLMGTLYSLFATPIYSADAMVQVESKNANTVLNDLTQMM
PNSQPASATEVEIVTSRMVLGKTVQDLGLDVLVQEDFFPLIGKGLSRMMGNKPAQIAISRMKVPAVWEKRQLTVEVDGPD
SYTVSKDGDELFKGKVGQFEQHGDVTMLVSDIKADEGTSFTVTKLSDLQAIKLVSSNLTVADMGKDTGVLGLTYNGEDPQ
QISMVLNQIINNYLYQNVERKSEEAEKSLEFLKHQLPEVRAKLDQAEDKLNSYRRQNDSVDMSLEAKSALDSSVSIQSQL
NELTFREAEVSQLFKKDHPTYRALLEKRQTLEDQQKKLNGKISQMPQTQQEIVRLTRDVQAGQEIYMQLLNRQQELNISK
ASTVGDVRIIDHAETAGTPVAPKKLLLIAASLIVGLVVSVGVILLKALFHHGIDNPEQLEELGLSVYASVPLSDWQRKKD
AEALAKRGLKAKADPHNTLLALGNPTDLSIEAIRSLRTSLHFAMMEAKNNILMITGASPGIGKTFISTNLATLVAQAGQK
VLFIDGDMRRGYTHDLLGAETKSGLSNILSGKTPLSSELVQHGPYGFDFIARGQVPPNPSELLMHNRMSELLDWASKNYD
LVLIDTPPILAVTDASIIGKMAGTSLMVARFETNTVKEVEFSYKRFAQNGIDIKGVILNAVVRKAANSHGYGYDYYDYSY
KQDAKS
>gnl|bykdb|A0A0J9FK39 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingobium yanoikuyae] (length=714 residues).
MVSRIIELEQRQAGEEDRTTRFVESARGTWTVVRRHRVILFVTMALCVLAGVIYILLSTPDYRATASVEVEDVPAGAAGA
GAMQKPVSAADTESMMQTELEVLRSRALAEDVARDLALVGSPVFFQGMDARRPAQGQGSLTQRQVEHEQVIKLLRDNLQV
ELPGKSRVLRISFVSADPALSARVANSYADSLIRADLKRGFESGVQARRFLLGELDGARKDLERAERDLAVYASRTGAVP
AEPATDEDKKSDGKDAKPDAAPVPEGSTAARLAQLNAFRAQAVADRIAAQKRWESAKAASAETLPEVLGNGAMQQLMAER
AQARAALVEERQFRKDAHPEMREARARLAALDDQAESMANTIRASLRQEYEVAAHGEKQIASEIAALEGDARVERGRDMQ
MSMMSRSVETYRLLHDSLLQRYRDMASQAGFQAGRIQPLDRAAVPTTPFAPHVGQIMLVALLGGMLLGLLLIAARHMFDD
AVTSADTLAERVDLPLLGAVPTTGDQPSAPDIFAPIAASLQLASVAGLPRSILVTSAQEEEGKSLTVNALARALARLDKK
VLVIDADMRRPVQHSLFRVTATRGISEVLTGQGKVEDLILDSGVAGVSLLPCGAVPPNPAELLSTPALDALLGAVRDRYD
TVLIDAPPILGMSDAQLLAAKVQVTLLVVEWGRNHHGGLRVAVERLRRAGGSIVGAVLTKAHGRAYDYDYHRGG
>gnl|bykdb|A0A0K0HBL8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Salmonella bongori] (length=718 residues).
MTEKVKQSATAGSDEIDIGRLVGTVVEARWWVLGTTALFALCALIYTLFATPIYSADALVQIEQNTGNSLVQDINSALAN
KPPASDAEIQLIRSRLVLGKTVDDLDLDIAVTKNTFPLFGAGWERLMGRQNETVKVTTFTRPETMNGQIFTLKVLNDKRY
QLVSDGGFNAQGNVGQLLNKGGVTMRVEAIDARPETQFTVSKFSTLGMINNLQNNLTVTETGKDTGVLSLTFTGEDRDQI
RDILNSITRNYLEQDIARKSEEAGKSLAFLAKQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQLNE
LTFKEAEISKLFTKAHPAYRTLLEKRKALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITEAS
TVGDVRIVDPAITQPGVLKPKKALIILGSIILGLMLSIVGVLLRSLFNRGIESPQALEEHGISVYASIPLSEWQKARDSV
KTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMLTGVSPSIGKTFVCANLAAVISQTHKRVLLID
CDMRKGYTHELLGTNNVDGLSDILAGKGEITSCAKPTAIANFDLIPRGQVPPNPSELLMSERFGELIAWASRRYDLVLID
TPPILAVTDAAIAGRHAGTTLMVARYAVNTLKEVETSLSRFEQNGIQVKGVILNSIFRRAAGYQDYGYYEYEYQSDSK
>gnl|bykdb|A0A0K0TR74 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Devosia sp. H5989] (length=554 residues).
MQEDAWGFDSFEGLIRRQWRMIALIWVGIVAAAALALTLMPASFTATTWLFSDPTVRTILPGESRGSAPLNDTARLESAV
ELIGSERTLQAVVRDLGLAVGMPGATAMEREHQAIRWLGERIKAQRRGQTYLISVRASAGDPLMAARLANGVANAFLRIE
VEGKVDDILAEQAALRDRVIAAGVAVDRTQGILDATAEPGYEARQEAQAAQAQYQMLLGRLKQVETEAFLQVPSTRIVVE
ATAPLYAAAPRSNLALALAAGFATVLGLLVALVRERTTTGFVDEQEAVRTLGVKPILSVPRQKLQRGVDGEWCLSPADQL
TRAPLAEFPEAVRRLRVSIDQARHREGLDHAGTVVMMASATPGEGKTTLALALARSYALAGHSSLVIDCDLRNPSLHKHL
GLEPCCGLFEYLTGPSEPSRLKAMLIPDDISGAHLAVGGLGAHKATDDLIAGPAFARLIAAAKRSFELVILDSPPMGTVV
DGLYLAPFADVVAFVMRYRSTPRAAAVQALAALENSRDGRSALVGVLNLHPEPGVAKGYRASVYTTRELSPSAR
>gnl|bykdb|A0A0K0XYJ6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Wenzhouxiangella marina] (length=791 residues).
MSDQRIQDGRHLRPIDGQNLALAQYDPYQSKANEDDDAIDLLEIWRTILKRKWVVVSILAVFIATAALSSWLTIPVYRAT
AVVQINHETANILRIEDFEAAPRSWQGVEQFYQTQYEILRGRQLAENVVEKLEVWDHPELSGEITQRNLYRELRALPGRL
MQLIRSDPPSAQPGTAVQTPEAAREAAIRSAGGRLRARISVNPRENSRLVYVSVNSFDPAFAAQLANAVVEEYVRSTMQR
RYDAGQEAREFLEGQLADMRIALERADQNLIDFAQANGVADLEERINMSQSSVRTLNDRLSGARGDLVQLRAFNQLIEQG
RGDSIRPVVNDGQIAELRGRKAELETEISGLLQRFMEDYPAIAELRSQINEIDSQIRERADFIIGNVIAEYSNLEAEVAA
LEEAIAENEGRILALNQQGVQYNILRREFETNRELYDGMLQRLKEIGVAAGAQENNIAVIDSALRPGYPVLPDISRNLSI
ALLLGLVVGVGLALLLEFLDSTVHRTEDVEKLVGRPVLGLIPIVKLSEQRKKSGTTTRAEDRAVSHYSELHPKSAVSEAF
RSLRTSLMFSTPQGMPKTILMTSPGPGDGKTTNAINLATVLAQNGARVLLIDADLRKPRLHRDFSIQQSPGLTNRIAEVS
SQEVTTSSIIPTTTEGLFVMPSGNQAPNPAELLSSDRMRKIINLSARAFDHVIIDSAPILGLADALVLSRCVDGVILVTS
AGKTSKESIRTSTRRLVQVHAPLLGVVMNRIDMESPDYAYYSSYYYNYSHDEDERVEGGRNKAGKNLERTA
>gnl|bykdb|A0A0K1E9I7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Chondromyces crocatus] (length=734 residues).
MAWRTVRKHWVIALATAVGVFLLVAFYTLGQKKIYQATATIQFDPNPPRPLGRGVDAVVEMGTGSYWNNREYYETQYKII
QSMRVALAVVRDLSLHNDSAFLENLPPGRPGSGKTVTPEEAAEVLRERLAVDPVKESRLAIVRFTDADAQRAQRVLSVVV
NTYVEQNLEDVLASTDSAVEWLRTQLDKLKGDLEASEMALHEYKIDKHILSVAIDDQSNMLREEMKQLNEALTLVRTRRE
EFRARRDELAKVKASDPVDLPSSELLQSVTLQTLRERYEETVREQKALLGEGKGPRHPDMRAAEERVGATKAALLSEVKN
IQGALDRDLAVVSRQEGALAGLFGRAQKQAFDLNLLEIEYNRLRRSKDNTEKLYALVLERTKEADLTRMMRVNNIRVPDP
PLVQRKPIRPRVPMNLAAGLLAGVGLGVAAALGRAMLDRTLKTPDDVEQELGLPFLGLLPEISPEEKHAKGKRPRPRRGG
RGGGTSRELIVHEQPFSGAAEAARAVRTNLLFMAPDNPYRILLITSAGPSEGKTTVACCIATAMAQAEQRVIMVDCDLRR
PRLHRVFGKGTDVGVTTALLDGELPSDEVMRTEVPNLWVLPAGPLPPNPAELFHSARFRMLLDQLSARFDRVIIDSPPVV
AVTDAAILSTLSEGTVLVARAFKTQRELARHGVKSLLDVGGTAAGVVLNAVDLDRQEYRYYHYYSYKKEGYYGQVDGDPE
ARPDDRPGDSAAAS
>gnl|bykdb|A0A0K1PI53 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vulgatibacter incomptus] (length=735 residues).
MNPGAEQKWSAPAQEAGAELEIDLREHLKILRKRAWLIGGVTLAALLAGAGFLLVSPKVYRAQSSIIIESSSSRLLGDKT
EQVDFAGTDYWSNKDFLETQYKVLASREVLQRVVDKKGLDRDLDFLGVANIEDPDKRAQALEKIVPVEVLSDALRIEPVK
NSQLTQITVDDRDPARAAELANAVVEAYVESNLDRRMEGTRAASAWLADQMADLKSKLEASELKLYDFRKENDILSTSLE
DRQSILSKRLNTLSESLTQVMSRRAELESAIAEADRAKKESPSDPLWARKLRMVAANQMLSNLRNEYAKLEGEATAIEER
YLEKHPARLASQEKLSKLQARIVDEMGTTVASLRSEHRELLGTQASLEQLIEGLKAEAFEVNKREIDQRKLERDQSNNER
LYNLVLSRLKDADLAVMMKANNVRLLDAAVAPLKPVKPRPALVLALSLLLGLFGGVGAAYLAEMLDNTLKSEDEIEQVLQ
VPFLGMLPTLAPAGAKADDRTDDPARDMFVARNPKSAQAEAIRSVRTNVLFMSPDREQRRIMVTSTSPQEGKSSVALNLS
VAMAQNGAKVLLIDTDMRRPRLHRAVGVSNERGLSTLLVGEARLEDALKSTEVAGLSLLPCGPVPPNPAEMLHTARFKEL
LEELGTRFDRIILDSPPLIAAADAAVLSSQVDGVIFVARYKKTTKDLAARMLRSLRDVNAPLLGAVLNDVDLGSQEYGYY
SYKRYGYYGDSSSAA
>gnl|bykdb|A0A0K2D937 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Chelatococcus sp. CO-6] (length=704 residues).
MGLLRRQRLAIAVTVAAILGLVVLALSQVPSRYSATTLVMIDPREQRLVSLDNAAPAPPNIGAVDGEVEIMASPVIARRV
IARLNLQDDEEFNRPDLLAQIAAGLWPAAVDGAEGQLQPGQPLSPRVERRIIDRLARRVDISRRGVTSIIAVEASSRDPD
KAARIANAYAQAYIDDQIASRLRLVANAERVLASRVTDLGEELRRAEAELDRYTLEQMMERAGEDGRNRLLSLRTTLEED
IAARTDALTRLRALEALVQAGDAAGIARVLAGGESEQLTEERREIERQLSARLPAARAAALRTRLTAIDARIVALGSARA
EELQRTADVSEQRAQQVRRDLDMLVNASDLPADASVQLYKLREEVAATRALYQNYLGRLRQVSQQRGLVLADSRVVAEAM
AAVRPSFPPTVPILFASLFLAFGAGFGIAWVRDTYGRGFLRADEVEEATGLDVVASMPQVEAAKGGVPVQDKVVREPGSA
YAEAIRRLRLGLDILMSAGEGEAAGKVVLVTSTKPGEGKSVTAVALGRAAALAGRRTLVIDCDLRKPSVHRLLKAKVKTS
LVDILADRATTAHVNDMRVVDALSDMSAFVSGDAQYFPAESILDSARFRALLEGCRKAFDVIILDAPPLAVVSDPLLLAV
YADVVLYVVHWKTTTQREVLQSLKELRRVKGETVYVALNGVDASSGEESYYPYTTNGRKPGEAS
>gnl|bykdb|A0A0K2DKM2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Chelatococcus sp. CO-6] (length=707 residues).
MILALTILALVLIEPRYSATAVVLIDPRQQRVISAEAVLSGIGSDAAAVESQVEVIESPTLALRVIEREKLENDPEFARR
GFLARVAEQLSIGRHASGHDEAALRRAAVLEALRERTRVKRRGLTYVLEITVTSQSPQKAARLANAVADEYLAGQLAAKY
RATERASLWLGARLEELREQVRGAERAVEHYKAEHNLVSVGSGDNLLEQQIAEINQQMILARAKTAEARAKFAQIREAAG
TGGGAPGIAEALGSLVVTNLRTQFAEAARRVAELGARYGGQHPSVTAARAQVDDLQQQIDAELARILSGVRNEYEVAVGR
EASLEASLAELKKEAARWGESTVRLRELEREAKALRSVYEQFLARSKETLEQQSLQIADAEIISPAMVPMRPSYPRTLLV
LAVACAGSLLTGLSLAFAFEHLDPGFRSIEQVEAYLGLPCLGVLPLVEEQARPVQSEPRTAGPATSRSWLWAVDRPADAL
MRILVEQPLSAFAEAVRTVRVGLRFADRGRGVQVLVVVSALPGEGKSTIAANLALALKAAGERVVLVDGDLRNPALTRAL
TPHAEQGLIEVLRGEQPLETILVEDEATGLTFLPTVRAGAVANAAELIETGHFDTMLKRLRLAFDHVIVDAAPLLPVVDS
RAIVARADGALLVVEWGRTDRAAVQEAMRTLADNADRVTGAVLSKATTDAYQYHYGIGGYGGADGEA
>gnl|bykdb|A0A0K2E0X6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Piscirickettsia salmonis] (length=751 residues).
MATQSQQSQIDKVLDVDVIDIKQLIATLLDKKKTILITTAVFFIIAALYCSFRVPTYDANILLNSDLNSSGASLSSVIGG
ELPSILGGDQAAAKAQTEISLIQSRSVLEPVVKSLHLDVIAEPDYFPIIGKGLAHRYDAENYANEYASPFAWLSSFAWGG
ESIEIGQFEVSTPLKAKEFTLVNLGQGRYQLYGPQGDKLGVGAVGKPFAKEINSFTRVYLLVNSLKSPVGVKFRLKELHM
MDALQVISSKLSVSLTDKNTPLINLGYTGYSPEKTAEILDAIADQAVRQDVYRKSEQAAKTLAFLKQRIPSVQQSVYQAE
KALNDYRSQSGNISLDAETKLMMQSVTDLESKIYDLKVQKAQLLQQFTERSVQVEEVNTSIVALTVQLKSLNIRLKNLPQ
ADQVAVNLIRNAKVQNTIYTNLMQKVQQFELLKAGTVGDLSVIDYANIPYKISNKPTLLIIILVTFIGFFLSMIYVFIRK
ALFQGIEDPDVIESRHGLSVLGTLLTSPAQQQQVKDFQKNKVMQLKLLSELDPMDMTVEALRSLRTNLTFELAAAKNNII
NISGPCPNVGKTFVSVNLAHVLSETGQRVLVIDGDLRRGSMHDYFGLSREHGLIDVLEGKLTLEHAVHRTHIDNLDMMPT
GALIVKHAELLMGNKLGEVLEQLSSNYDAVIIDTAPILAITDASLVAQYAGTNIVVFADTMHDDKEIELTINRFEKAGVK
LAGFIFNNMQMATTTLSNKYKYAYRYEARKN
>gnl|bykdb|A0A0K2J123 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Stenotrophomonas maltophilia] (length=742 residues).
MNNKMESRNSSREDDFDLRELAGIFLDRKWWIVGTTGLFFLVGVSYALLAPPVFQAQAMVQVESKVPTIPGLADLASLGG
SGSTASTTEVALLTSRTVVGTAVDDLQLDVTVEPYRFPLIGGFMARRFSPELPNEVSSPWLGIARYGWGGEELRVSSLVV
PQSKVGSALTLIAGEEAGSFSLLDEDGTELLKGKAGTTAQVKDLKIDVAALRANPGTHFRITKMRRLDVVGEVRENLQAS
EDGKDSGILQLTYEDVDADRAQAVVQRVVESYVRQNVDRSSAEAASQLQFVKEQLPTIRLQVEQAQAAMSAYQSRSNAVD
ITMQTKGLLEQEVAVEASIQQLRLRQAEMDRSFTREHPAYRALLRQIGELESRKSGFQREVGTLPNTQQELLRLTRDLQV
SNELYTALLNQAQQLDVARAGAVGNVRIVDAAVVDTANPVRPRKGLVVIISTLLGAFLAAGVALLQRMLNPGIEDPADIE
ALGLPVYAAIPLSVSTTLPRLRKSRHGTRVIADGRQHLLALTAPADPTVEALRSLRTSLHFAMLEAKNNILAISGPRPGV
GKTFVSTNLAAVIAQAGQRVLVIDADMRKGTLHKILGVPAQSGLSDVISGKLAADDVIHPVPGLDNMHYMVRGDVPPNPA
ELLMHPRFAQLLQDMSSRYDLILVDTPPVLAVTDPALVAAHAGSSLLVTRFGVNQVKEIELTLQRFEQNGVQIKGAIFNA
VERRATGYYSYGYYEYQSDGKE
>gnl|bykdb|A0A0K2KZD9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Piscirickettsia salmonis] (length=751 residues).
MATQSQQSQIDKVLDVDVIDIKQLIATLLDKKKTILITTAVFFIIAVLYCSFRVPTYDANILLNSDLNSSGASLSSVIGG
ELPSILGGDQAAAKAQTEISLIQSRSVLEPVVKSLHLDVIAEPDYFPIIGKGLAHRYDAENYANEYASPFAWLSSFAWGG
ESIQIGQFEVSTPLKAKEFTLVNLGQGRYQLYGPQGDKLGVGAVGKPFVKEVNSFTRVYLLVNSLKSPVGVKFRLKELHM
MDALQAISSKLSVSLTDKDTPLINLDYTGYSPEKTAEILDAIADQAVRQDIYRKSEQAAKTLAFLKQRIPSVQQSVYQAE
KALNDYRSQSGNISLDAETKLMMQSVTDLESKIYDLKVQKAQLLQQFTERSVQVEEVNTSIVALTVQLKSLNIRLKNLPQ
ADQVAVNLIRNAKVQNTIYTNLMQKVQQFELLKAGTVGDLSVIDYANIPYKISNKPTLLIIILVTFIGFFLSIIYVFIRK
ALFQGIEDPDVIESRHGLSVLGTLLTSPAQQQQVKDFQKNKVMQLKLLSELDPMDMTVEALRSLRTNLTFELAAAKNNII
NISGPCPNVGKTFVSVNLAHVLSETGQRVLVIDGDLRRGSMHDYFGLSREHGLIDVLEGKLTLEHAVHRTHIDNLDMMPT
GALIVKHAELLMGNKLGEVLEQLSSNYDAVIIDTAPILAITDASLVAQYAGTNIVVFADTMHDDKEIELTINRFEKAGVK
LAGFIFNNMQMATTTLSNKYKYAYRYEARKN
>gnl|bykdb|A0A0K2P3P7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Cronobacter dublinensis subsp. dublinensis LMG 23823] (length=720 residues).
MTDKVRHSAAPVEGGDEIDIGRLVGTVVEARWWVLGITALFALGALIYVMFATPIYSADALVQIEQNQGNSLVQDISTAL
QNKPPASDAEIQLIQSRLVLGKTVDDLDLDIAVEKKTFPLFGSGWERLMGRANETIKVTSFDQPQGMAQDEFTVAVLGPK
QYQLTSSGGFSARGEVGKPLSKDGVKMTVAEIHAQEGSEFTVTKYSTLGMINQLQNNLTVTETGKDTGVLSLTYMGEDRD
QIRDILNSITRNYLEQNIERKSEEAAKSLAFLAKQLPEVRSHLDVAENKLNAYRQQQDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKAHPAYRTLLEKRQALEDEKAKLNKRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITE
ASTVGDVRIVDPAITQPGVVKPKKALIVLGSIILGLLLSIVIVLLRSLFNRGIESPMALEEAGINVYASIPLSEWQKSRD
SVKTVKGVKRFKQSQLLAVGNPTDLAIESIRSLRTSLHFAMMQAPNNVLMLTGVSPSIGKTFVCANLAAVISQTHKRVLL
IDCDMRKGYTHELLGTTNVNGLSDVLAGQGDISRCAQKTSVPGFDLVPRGQVPPNPSELLMSERFAELVKWASANYDMVL
IDTPPILAVTDAAVVGRHAGTTLMVARYAVNTLKEVQTSLSRFEQNGIQVKGVILNSIFRRATGYQDYGYYEYEYKSDHK
>gnl|bykdb|A0A0K2VYM6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Mesorhizobium plurifarium] (length=793 residues).
MNYANFPLDKRVPLPGADQEKGEDFIDVERLLGMAARQAKVVAACAVIGLFLGVIYLQTTPKQYMSVASVLVDEGLNKVV
DDISAASQTVQTDASFLSQVEILTSARLASVVVDKLKLDQNDAFMNPPQSALAKGIGFLRGVVGYFRGSSAGDIPGIENV
DEATRQAMIKTATHDYAVLKLQSEVLAQRNGRSYVISIGYQAPDPALATAITKAYADAYLADQLNASFDATERAALWLQG
RLTELRESSQRAAMAVEKFRAEHGLSANSDGQLLSDKQLADLNAQLIVAQADTARASARYQQYKAIVDSGSESAFNDSAI
GADQPSSSVIIGLKTRYLAIAKRLQDVETNFGKDHPQAVALAKEKADVLAQIFGQLKQLTESYRNDFQVAQAREQALRDK
ISTAAGKSSIDNQSQVKLKELDQQAQALTTLYQTFLSRYEEASQQQSFPVGKVRIISDATMPLAASSPRTLRVLALSLVL
GLMLGAGFGGLNEFNERFFRTGEDIRDRVGLKFLGYLPTIGGGKAKDSKADDLPADGKVASLSAAEKRARMRVSIDAPAS
MFAETLRNAKIAFDVVMEDRGSRVIGVISVLPGEGKSTVAANLAGLLAANGARTLLIDGDLRNPGLSRSLGMEAEQGLME
AVVNGQTWQSVGKVDRQTKLAIIPAVLRGQFSHTSELLGSAGMRRFIENAKETFEYIIVDLPPLGPVVDAKAFAPLVDGF
VLVTEWGRTPRNMVRSMLESEPYIANKVIGAVLNKVDLKKLAKYGALGGSERFFDRYSTYYLEKSEQRPKQAA
>gnl|bykdb|A0A0K3SEK9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQNSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDDK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHARPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEEEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGIKRYKQSQLLAMGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A0K3UY79 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=726 residues).
MTTKNMNTPPGSTQENEIDLLRLVGELWDHRKFIISVTALFTLIAVAYSLLSTPIYQADTLVQVEQKQGNAILSGLSDMI
PNSSPESAPEIQLLQSRMILGKTIAELNLRDMVEQKYFPIVGRGWARLTKEKPGELAISWMHIPQLNGQDQQLTLTVGEN
GHYTLEGEGFTVNGMVGQRLEKDGVALTITDIKAKPGTQFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDDPQ
LITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDNQL
NELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISK
SSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEHGISVYATIPMSEWLDKRT
RLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSD
QKVLFIDTDLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDH
YDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGY
SYSEKE
>gnl|bykdb|A0A0K3XZA2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=718 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITTVFALCAVVYTFFATPIYSADALVQIEQNSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDNK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHASPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYKSDAK
>gnl|bykdb|A0A0K4BVE7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQSSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDDK
NYTLSSDGGFSARGQAGQMLTKEGVTLMVEAIHASPGSEFTITKYSKLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEEEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTVAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A0K4C9P5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=726 residues).
MTTKNMNTPPGSTQENEIDLLRLVGELWDHRKFIISVTALFTLIAVAYSLLSTPIYQADTLVQVEQKQGNAILSGLSDMI
PNSSPESAPEIQLLQSRMILGKTIAELNLRDMVEQKYFPIVGRGWARLTKEKPGELAISWMHIPQLNGQDQQLTLTVGEN
GHYTLEGEEFTVNGMVGQRLEKDGVALTIADIKAKPGTQFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDDPQ
LITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDNQL
NELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISK
SSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEHGISVYATIPMSEWLDKRT
RLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTRLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSD
QKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDH
YDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGY
SYSEKE
>gnl|bykdb|A0A0K4KF81 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQSSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDDK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHARPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVSWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A0K4KW57 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=726 residues).
MTTKNMNTPPGSTQENEIDLLRLVGELWDHRKLIISVTTLFTLIAVAYSLLSTPIYQADTLVQVEQKQGNAILSGLSDMI
PNSSPESAPEIQLLQSRMILGKTIAELNLRDIVEQKYFPIVGRGWARLTKEKPGELAISWMHIPQLNGQDQKLTLTVGEN
GHYTLEGEDFTVNGTIGQRVEKDGIALTVADMKAEPGTKFILSQRTELEAINALQETFTVSERSKESGMLELTMTGDDPQ
LITHILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPQVRSELDQAEEKLNAYRQQRDSVDLNLEAKAVLEQIVNVDNQL
NELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISK
SSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEQGISVYATIPMSEWLDKRT
RLRKKSLFSNQQRHRTKNIPFLAVDNPADFAVEAVRALRTSLHFAMMESANNVLMITGATPDSGKTFVSSTLAAVIAQSD
QKVLFIDADLRRGYSHNLFNVSNEHGLSEYLTGKDEIGKVIQSFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANEH
YDMVIVDTPPMLAVSDAAVVGRYVGTSLLVARFALNTAKEVALSMQRLEQAGVNIKGAILNGVVKRASTAYGYGYNYYGY
SYSDKE
>gnl|bykdb|A0A0K4P201 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=726 residues).
MTTKNMNTPPGSTQENEIDLLRLVGELWDHRKFIISVTALFTLIAVAYSLLSTPIYQADTLVQVEQKQGNAILSGLSDMI
PNSSPESAPEIQLLQSRMILGKTIAELNLRDMVEQKYFPIVGRGWARLTKEKPGELAISWMHIPQLNGQDQQLTLTVGEN
GHYTLEGEEFTVNGMVGQRLEKDGVALTIADIKAKPGTQFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDDPQ
LITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDNQL
NELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISK
SSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEHGISVYATIPMSEWLDKRT
RLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPNSGKTFVSSTLAAVIAQSD
QKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLDWANDH
YDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGY
SYSEKE
>gnl|bykdb|A0A0K4T8M8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQNSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDNK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHASPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A0K5NAP3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQSSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWERLMGRQNETVKVTTFNRPKEMADQVFTLNVLDNK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHASPGSEFTVTKYSMLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGISPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A0K5Q518 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=726 residues).
MTTKNMNTPPGSTQENEIDLLRLVGELWDHRKFIISVTALFTLIAVAYSLLSTPIYQADTLVQVEQKQGNAILSGLSDMI
PNSSPESAPEIQLLQSRMILGKTIAELNLRDMVEQKYFPIVGRGWARLTKEKPGELAISWMHIPQLNGQDQQLTLTVGEN
GHYTLEGEEFTVNGMVGQRLEKDGVALTIADIKAKPGTQFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDDPQ
LITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDNQL
NELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISK
SSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEHGISVYATIPMSEWLDKRT
RLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDGGKTFVSSTLAAVIAQSD
QKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDH
YDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGY
SYSEKE
>gnl|bykdb|A0A0K5U2N1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQSSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFSLNVLDNK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHARPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGVKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTSKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVSWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A0K5ZP08 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=726 residues).
MTTKNMNTPPGSTQENEIDLLRLVGELWDHRKFIISVTALFTLIAVAYSLLSTPIYQADTLVQVEQKQGNAILSGLSDMI
PNSSPESAPEIQLLQSRMILGKTIAELNLRDIVEQKYFPIVGRGWARLTKEKPGELAISWMHIPQLNGQDQQLTLTVGEN
GHYTLEGEEFTVNGMVGQRLEKDGVALTIADIKAKPGTQFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDDPQ
LITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDNQL
NELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISK
SSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGLEAPEQLEEHGISVYATIPMSEWLDKRT
RLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSD
QKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDH
YDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGY
SYSEKE
>gnl|bykdb|A0A0K6ATT5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=726 residues).
MTTKNMNTPPGSTQENEIDLLRLVGELWDHRKFIISVTALFTLIAVAYSLLSTPIYQADTLVQVEQKQGNAILSGLSDMI
PNSSPESAPEIQLLQSRMILGKTIAELNLRDIVEQKYFPIVGRGWARLTKEKPGELAISWMHIPQLNGQDQQLTLTVGEN
GHYTLEGEEFTVNGMVGQRLEKDGVALTIADIKAKAGTQFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDDPQ
LITHILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPQVRSELDQAEEKLNAYRQQRDSVDLNLEAKAVLEQIVNVDNQL
NELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISK
SSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGAVLTRAMLRRGVEAPEQLEEHGISVYATIPMSEWLDKRT
RLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLASVIAQSD
QKVLFIDADLRRGYSHNLFNVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDH
YDLVIVDTPPMLAVSDAAVVGRYVGTSLLVARFSLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGY
SYSEKE
>gnl|bykdb|A0A0K6GZW5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Chelatococcus sambhunathii] (length=714 residues).
MNEFDLQSLTGLLRRQRFTIAVTVIAVLGLVILVLSQIPSRYSATTLVMIDPREQRLVSLDNVTPAPPNIGAVDGEVEIM
ASPVIARRVIARLNLQDDEEFNRPDLLTQIAAGLWPAAVDGSEGQAQPGQPLPPRVERRIIDRLARRVDIARRGVTSIIA
IEASSRDPDKAARIANAYAQAYIEDQIASRLRLVANAERVLASRVTDLGEELRRAEAELDRFTLEQAMERMGEDGRNRLV
SLRTALEEDIAARTDALARLRTLEPLVQDADTTGIARALAGGESDALTEERREIERQLSAGRLPPARVTALRTRIAAIDA
RIVALGRARTEELQRAADASEQRAQQVRRDLDMLVNTSDLPADASVQLYKLREEVAANRALYQNYLGRLRQVSQQRGLVL
ADSRIVAEAMAAVRPSFPPTLPILVASLFLAFGAGFGIAWVRDTFGRGFLKADEVEEATGLDVVASLPQVESARAAVPVQ
DKVVREPGSGYAEAIRRLRLGLDILMSAGEGEAGGKVVLVTSTKPGEGKSVTAVALGRAAALAGRRTLLIDCDLRKPSVH
RLLKVDVKTGLVDILADRATTAHVNDVRVIDPLSDMSAFISGDAQFFPAESILDSARFRALLEGCRKAFDVIILDAPPLA
VVSDPLLLAVYADVVLYVVHWKTTTQREVLQSLKELRRVKGETVYVALNGVAAASGEGSYYPYAAKGRKPGGSA
>gnl|bykdb|A0A0K6H6G7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Idiomarina woesei] (length=727 residues).
MQNSPSPAQQRNDDDEIDLGRLFGLLIDHKWLIAGITTSFAALGVVYALLATPIYQADALLQVEKKSSGMPALGEMAEMF
AQESEAATEIEIMKSRMVVGTVVDQLKLTNVVTPNYMPVIGDFLARRAKEQDRVLIENLNVSQAELGKALELEIKDKIFT
LYDSEGEEVLTGVVGAPAEKGEWFVHIADATTPNTNSFTLIKKTRLKAITDIQEELDISERGKQTGILSASIQNADGNYA
VDVLNAVTNEYMLQNIRRNAAEAENSLEFLQRQIPTIKENLNDAEEKLNQYRLESQSVDLTIETEGLLKQLVDLEKQINE
LSLKEAELSRLYTKQHPSYQALIEQKANLQADRKRLADQIQNLPETQQQVLRYTRDVEVNQEIYLQLLNRMQELNVLKAG
TVGNVRILDEAVVKPEPVAPKKPLIVVLATMLGGMLAVGIVFVRAMFNRGVETSEQLEQEGINVYASVPKSDTQENMNEK
LVKLAKRKQTDAVRAPLLAKEDPTDLAIESLRGLRTSLHFAMLEARNNIIMISGPSPGVGKSFVTGNLAAVLAQTGAKVL
LIDGDIRRGYLHNMMNAVNDKGLADFLAARDATGDLNYKAYTQSGYVDNLDFMPRGTSAPNPAELLMHSRMEQLMEQTAN
DYDYVLIDTPPILAVTDAAIVGRYAGTTLLIARFGMTPAKELVHTVKRFEQNGVEVKGAILNSIERKASSYYGYGYNYHY
GYAYKSQ
>gnl|bykdb|A0A0K6H7Y0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Chelatococcus sambhunathii] (length=753 residues).
MLTRRSSEGAGLPAVPAGEAHGPASGDILDLRGLWLVLRRRGGMVAATVCLVLAITVMTLALIEPRYSATAVVLIDPRQQ
RVISAEAVLSGIGSDAAAVESQVEVIESSTLALRVIAREKLEGDPEFAERGFLLRLLEQVSVGRHSPVHDEADFRRAAVL
DALRERMQVKRRGRTYVLEISVVSQSAQKAARLANAVADEYVAGQLAAKYRATERASQWLGGRLEALREQVYGAERAVEH
YKAEHNLVSVGSGDNLLEQQIAEISQQMILARARTAEARAKFAQIREAASAGVGEPGIAEALGSLVVTNLRTQFAEAARR
TAELGARYGSQHPSVTAARAQVDDLQRQIDAELARILAGVRNEYEVAVGREASLEASLAELKKEAARWGESTVRLRELER
EAMALRSVYEQFLTRSKETLEQESLQIADAEIVAPAIVPTRPSYPRTGLVLAVACAGSILAGLSLAFALEHLDVGFRSIG
QVEACLGVPCLGVLPVVQERPRPMPLAPQAAGRDASRSWLWSANRPADALMRILVEQPLSAFAEAVRKVRVGLRSAEGGG
VRVLVVVSALPGEGKSTIAANLALALKVAGERVVLVDGDLRNPALTRVLAPHAEQGLIEVLRGEQPLDAILMEDKATGLT
FLPTVRTGAVADAAELVETHHFDAVLERLRLAFDRVIVDAAPLLPVVDSRAIIGRVDGALLVVEWGRIDPAAAQAAIRTL
AADADRVIGAVLSKVTTEGYRYCCGIGSADGGA
>gnl|bykdb|A0A0K6I3C5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pannonibacter indicus] (length=712 residues).
MDDAEIDFRRLFGIVRRQLKLIIATIAIILAIASIALFSITPLYTGTALVLVDPSRKNLLDPSNSIGSSAADSARVESEV
EIVDSDAVLLSVIAEKGLVTDPEFGVKIGLRDKLLAFLRIRDITIPTGEEALGSVLAKLKNNVSVSRRGLTYLIAVSVRS
ENPARAAELANTITTTYIRLQIESKTSNTREARDIVQRQVADAENAVIAAEKAYDDFILSNVNAIAEQTGRTDLTSMRGR
IDQLIADRSLAESQAMALRQSVARSDWQSVADNLQTAAVTELNRQRMELERSLAQVEGGSARAINLREELDKINASLQQE
TTSALQQLQNSASQYEQEAATLRRDLSSAILNSNLPADMLAQIYRLQQISRNATSQYQMLLARSQTLETEAALQIADSRV
VSPAYPPNRPSSPKVPLILGVAVLFAIGAGLALAFIFENFVGGFTDEEQVQAVTRLPLATVVPRHNSNVAGMHSISDALV
DSPLSMYAESIRRLRATLDNALQSSWVQQPEEARKSGRVIMLSSAMPGEGKSTLALSLARTLALSGASTLIIDCDFRKPS
IQRHLNIEPSNGLVDFLIGDIGSDELLQNIVRSDPKTSLTAVVGARRADVPTDQLLTREKFSRLIQTARPRFDYIVLDSP
PIEPVVDGLYLAKYADVITFVIRWARTPQRMCVNAIQRLSQTKSEHCRILIALNQQEGKTTFYNTYSDYYTE
>gnl|bykdb|A0A0K8LZ94 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. actinidiae] (length=748 residues).
MTVMSRPTLDYYQDARIDLATVLRILFDQKALILWTVGLFFLIGLAYAVLSTPVYQANAMIQIEPRKIGIEGTPEVSGKP
LSVSQATTEIELIKSRALLGKVVDDLQLNVLQKPDLFPVIGPYLYRTFAPGQDGALAEPLWGLSHYAWGGEKIEVFQLEV
PEHLLGEKLTLTAGKPGQFVLYDSDHNRLLGGAVNRVIEGNGVKIQIAALLARPGTDFTVSRQRTLGTALIYQNRLKIAE
AGRDSGIIYLSIEDQDAQRANRILDQISRLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESEAALNAFQTSARSVDL
SIETKGLLDQVVHLDSMLSELKLKRVELERLYTREHPTYRSLMSQINQLEQQKQGLLKKIETLPMTQQELLRLTRDMQVT
SQTYTLMLNKSQEQDILRAGNIGNVRVIDNADSNIEKPVKPMKTLIVLIATLLGALTAMVITFVRQAFYRGVESAEVIEN
LGMPVYASLPYSRQQERLEKRGKSTPGEERHGKDNQAAQVSRLLSITAPSELAIESLRSLRTSLHFAMLEARNNVLMISS
PTPGAGKSFVSSNLAAIIAQTGKRVLLIDADMRKGYLHRLFGLQPKHGLSDTLAARLRSTEVINQTRIRHLDFISCGFAA
PNPSELLMHDNFHKMLAELSPLYDLILVDTPPILAVTDATLVGRQAGTCLVVARFGMTTVKEIEACKRRLGQNGILIKGA
IFNAVVRKATTSDYDCAAYGYNYHPAPR
>gnl|bykdb|A0A0K8NZ21 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Ideonella sakaiensis] (length=746 residues).
MNMQATPGAVIQAASPAPPPFLSLKDALSDEQRLELVEYWRSITKRKWVILLLGIAVAIAAGAVAFSLPAVFRSTATVLI
EPDKNKVVKIDEVYGGIGTGREYFQTQVEIIKSRDVALKTIEGLKLWEVPEFDPRKDKDDWKAKLKQAIGLTEPEVEWTD
EKLARETLGKFNEALDVAPVRLSNLVKVSFESQDPALAARVVSTVAEIYVNNDRESRFKLTQQANQWLQDRVVALRQKLD
ASERALQAYREGQGLVNLGGSAQAIDSQQIANITQQLVQARVRRAENEGVYKEVLAIRNAKRDDYSSVAAVMRHPAVVEA
KKQEAIAQQKVSELSQRYGFEHPRMVAATAELNAASQSVATQADAVATSLMRDYEISRATERQLEGELANSRGSVVAVNR
KEAQLGVLERAAQADRQLYELFIGRAKETSASNDLQTQVARVVDPPVLGGKVRPKEMQIIAVAFALGLFGGVLLSLLLDK
LDNTLKGQEDAESRLKQPLLTSLPILKGSDRKQVMRLAADRPDSMFAEGIRTARTSVMLSSIDSPKKIILVTSSVPGEGK
TVVSTNLALAHATTRRTLLIDADMRRPAVARGLALPPGLKGLSDLTSGDATLDDCIHVLEDSHLHVISSGATPPNPTELL
LSQRFKDTLRTLQERYDIILIDSPPVELVSDALVLAPLVTGTIYVVKAMDTPYQLARKGLVRLQRSHGTLLGVVLNYVDF
KKAQKYYGQYSAYGQYGYGGYGYKLK
>gnl|bykdb|A0A0K9JX08 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Candidatus Burkholderia humilis] (length=746 residues).
MESPTGGMTMKELRIKQQRQAHETAGDDEINLSEIFSVLRESRGLIAIATACTLVVGSLYEFLWTPSYRVDVLIQVDDDS
GTGSINDKLGDLASLFQNKASADAEIELMRSRMVIGDAVSRLHLDVDAQPHHFPVIGAPYARFMKGDGLTSAPLGLGGFA
WGGERISVTEFTVPTRLIGKSFTLIARDRDRYELKSPDGETVLRGQVGEKASARTNAGTVELTVTALLAHAGTRFDLKRS
STQQTIAELQQALKIAEKTKQSGIIGMSLNDADPEAVTRTVNTIATLYVQHNVDRKSAQAEQMLAFLGDQLPQLRADLDR
AEARYNDFRAKNGAVDLEEQSKLLLQTVIDNRTKIVALQQRADLVQRFTTVHLLVIALDAQIGELQRQSGDYEKQIGGLP
SVQQDAVRLLRDVKVSNDLYTNRLNSTQQLRVLKAGQLGNVHTVDYAVVPEKPVAPKKALALALSAILGLLGGCSLALAR
RMFNRGLETPTEIEAALDLPVYPIISNSERQASLESSRRRDSSKTTLLASAVPGDVAVEGLRSLRTALQFGALRHRKKII
MFTGPRPGIGKSFVSANFAVVLAVGGERVLLIDGDMRRGDLNGLFGLKRNPGFSDLIGGATLDQVIHRDVLPQLDVMTGG
RMTVQASELLMSARVAEVINELRNRYDYVIIDSPPVFAVTDAGLLGRHTDATLLVVRHGCHTAAELSQTLRQLAGAGVPV
DGALLTDTPSSSSSYGAFSQYANREA
>gnl|bykdb|A0A0K9T8C1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli M114] (length=726 residues).
MTTKNMNTPPGSTQENEIDLLRLVGELWDHRKFIISVTALFTLIAVAYSLLSTPIYQADTLVQVEQKQGNAILSGLSDMI
PNSSPESAPEIQLLQSRMILGKTIAELNLRDMVEQKYFPIVGRGWARLTKEKPGELAISWMHIPQLNGQDQQLTLTVGEN
GHYTLEGEGFIVNGMVGQRLEKDGVALTIADIKAKPGTQFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDDPL
LITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDNQL
NELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISK
YSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEHGISVYATIPMSEWLDKRT
RLRKKNLFSHQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSD
QKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKAIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDH
YDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRVSTAYSYGYNYYGY
SYSAKE
>gnl|bykdb|A0A0K9T9B8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli M114] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQNSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDNK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHARPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEEEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGVKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A0K9US03 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio cholerae 2740-80] (length=737 residues).
MTGKQFTQEEVIDIRQYFNVLLNYKWRILLFSVMVTAITLLFVLSMRSEYTARATILIESTQAKAVSIEEVYGLDTKSQE
YYLTQIEILKSDTIAQEVIERLDLASDPEFDLSPESDASPSLKERLVEWMPFLQGFKQEETVADPDLEAYRQNRLILYKF
KRGMEISPIRKTQLVNIYYTAGDPKLAAKIANEIARVYMDSHLEAKLEVELKANTWLNTRMEELRTQLRESEAKLQAFLQ
AEGLVDVQGVEGLATQELEELTSQMNKARDRRVAAETLYQVANSYSKNDSDLTALSSIPEISNHPTIRDLKVAEVDAERK
VSEFSKRYGPKHPKLKSASAQLEAVRKNLRAELRQLLNGINNELQAAKQSERSLQTEFNQRKSEFQTLTVKNAKYSELKR
EVQTNRELFDLFLARQKETSASGDFNTTIARFTDQASAPLTPSKPNKKLIVLLAFVVSFGFACVVAFIADAMTDTFADIK
QVEKQLALSLLGVVPVVRKQRGKLDAKAYFDEKLRELTEAVRTIRTSYLLAHVNQDQHVVMLTSCLPGEGKTTSSLNLAL
SLAQMEKTLLIDCDLRKPAIAHRFGISGSQPGVTNLLNGTQSLEDCVYHDEQSGLDILTAGVYASNPLELLSSSKFSELL
ADLRTRYQRIVIDTPPCLAVSDSFMLAQYVDSVILVIDANHTRTPVVRDVVGKLTQQGSRIDGVILNRLNAKKASRYSGY
YHYQAYYGEETKSGAAK
>gnl|bykdb|A0A0L0ACU9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas sp. RIT-PI-a] (length=738 residues).
MTAMNRSNLEYYKDTQIDLATILRTLFDHKKLIAGVVALFTLLGAFYAVVATPVYQANAMIQIEPKKVGLDATPQLNTKP
SSVSEAVTEIELIKSRTVLGQVVSDLKLDVVATPRYFPAIGRYMAREFTPTGNQTLAAPLFGLEAFAWGGEKIDVFNLDV
PANLLGERLTLIAGPNGTYRLVGTDGAPLLSGRVGEVSQGNGVTLQLAELTARPGTEFRLVKNRLLNTSLDYQQRLRVAE
SGKDSGIVYLSINDTDPVQANRVLDEVSRLYVRQNVERSSAEAAQRLDFLRSQLPVVRKELEKSEEALHAFQMRTKSVDI
TLETKALLDQMVAYDAQLSELRLKRTDLDRLYTRQHPASAALSQQISQIESQKTSLQAQIKGLPETQQELLRLTRDMQVT
TQTYTLVLNKSQEQDIIRAGNIGNVRIIDKADSNIEEPVKPMRAVIVLVAMLLGTLVAVAIIFIRQAFYRGVENPEVIES
LGMPVYASLPLSRQQERLQKKRGKGVTNRESRLLSVAAPSELAIESLRSLRTSLHFAMMEARNNVLMITSPMPGVGKSFV
SANLAVIIAQAGKRVLLIDGDMRKGYLHRSFGLQPKHGLSDALAARLGNTEVINATEVDNLHLIACGFAAPNPSELLMHD
NFSKLLRELSPHYDLVIIDTPPVIAVTDASLIGRQAGTTLLVARFGQSSVKEIEVSKRRLAQNGVLVKGAIFNGVIRKAS
TAEYDCAAYGYDYSPSKK
>gnl|bykdb|A0A0L0AQF3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. RIT-PI-d] (length=720 residues).
MTDKVQPSAAATAASDEIDIGRLAGTVIEAKWWVLGVTALFALIAIIYTLFATPIYSADALVRIEQNQGSALVQDINSAL
ANKPPASEAEIKLIQSRLVLGQTVDDLDLDIAVTKNTLPLLGDGWERLMGRQNETVNVSTFILPKGMGQDAFTLHVLDKQ
HYQLTSDGGISADGQVGKPLEQDGITLTVDAIHARPDTDFTLTKFSTLGMINTLQNNLTVTEDGKDTGVLTLTYTGEDRE
QIRDILNSITHNYVKQNVARKSEEASKSLAFLKQQLPEVRASLDVAENKLNTFRQTKDSVDLPLEAKSVLDSMVNIDAQL
NELMFKEAEISKLYTKRHPAYRTLMEKRQALEEEKAQLNKRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELRINE
ASTVGDVRIVDDAITQPGVLKPKKGLIILGSILFGLIASVVGVLLLSLLRRGVESPQALEERGINVYASIPLSEWQKARD
RVTASKGVKRYKQSQLLAVGNPADLAIEAIRSLRTSLHFAMMQASNNVVMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELMGTTNANGLSDILIEKDEIASCARPTSITNFDLVPRGQVPPNPSELLMSDRFGELISWASENYDLVL
IDTPPILAVTDAAVVARYAGTTLMVVRYAVNTLREVETSISRFEQNGIPVKGVILNSIFRRASGYQDYGYYEYEYKSDAT
>gnl|bykdb|A0A0L0ETK7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudoalteromonas rubra] (length=745 residues).
MNAQSNLLSGVQPKQTTQQAQEIDVMALLGALLDRKLFIIAITTLFMIIGVAVAMFSAPVYQATAMIQVEEKGGSVPGFD
ELGGMFESTSAAVTEIELLKSRSIIGEAVDSLKLDIVAKPKLYPIIGGRAFRKFTPTHEGDLAEPSFAATSYAWGGEEID
VFKFDVPSNAIGQGFTLVTLANNEFQLLGGDGEIILKGKVGEEVSNGAFSLTLRTLTARPDTEFTLARRDRLNTILDLQA
AIGASEKGKDSGIINLSFQGSDPEYAEAVLNKVANIYVRRNVERSSAEAQKSLDFLEYQLPQVKKQLEAAEQRFNDYQVK
QRSVDISLETEGVLKQLVKLETQLQELELRKLELSRKFKQSHPSYQAAVEQIEVVENQKRRLTAEVQVLPETQQELLRLT
RDVEVNNEIYTLLLAKTQELDIVRAGTVGNVRVIDLAEVNTSKPIKPKKALIVMMAIMLGGMLAVSIVLIQKVMHKGIED
PSEIEALGLPVYASVPYSEYQVKLTGFAKARKGKTAKAKSILAMDNPADLSIEALRSLRTSLHFAMMEAKNNVIAISGPS
PGVGKSFISVNLATVLAQSDKKVLIIDADMRKGYLQTQFGMQWDDGLSDYLSGRISLEQAIKQSQVAGLEVMTRGQIPPN
PSELLMHANFTKLIEEVSAKYDLVIIDTPPILAVTDPAIVSAHAGSTLLVTRFGQNHVKELEVTRNRFEQNGIDVKGVVF
NGVVKKASNAYGYYGYYNYEYKSDK
>gnl|bykdb|A0A0L0GZG7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Trabulsiella odontotermitis] (length=720 residues).
MTEKVKHSAPQASGNDEIDIGRLIGTVIEAKWWVLGTTALFGLAAVIYTLFATPIYSADALVQIEQNAGSSLVQDINSAL
NSKPPASEAEIQLIRSRLVLGKTVDDLNLDISVTKNTFPIFGAGWDRLMGRQNDTVHVETFTLPASMKEQVFTLEVLGPK
QYLLTSDGGFSARGEVGQPLSKDGVTLLVSGINAETGGEFTVTKFSTLGMINTLQNNLTVTETGKDTGVLSLTFTGENRD
QIRTILDNITRNYLEQNVERKSEEAGKSLAFLARQLPEVRSHLDVAENKLNAYRQEKDSVDLPLEAKSVLDSMVNIDAQL
NELTFKEAEISKLYTKRHPAYRTLLEKRQALEEEKANLNQRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKIQE
ASTVGDVRIVDHAITQPGVLKPKKALIILGGLILGLMLSIVGVLLRSLLNRGIESPQALEEQGISVYASIPLSEWQKSHD
SVKTIRGVKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAKNNVLMLTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTTNVNGLSEILVGKADIVNSAKKTAINNFDLVPRGQVPPNPSELLMSERFAELVQWASANYDLVL
IDTPPILAVTDAAVVGRLAGTTLMVARYAVNTLKEVETSLGRFEQNGIEVRGVILNSIFRRATGYQDYGYYEYEYKSDNK
>gnl|bykdb|A0A0L0H3H7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Trabulsiella odontotermitis] (length=726 residues).
MSTKNLHPQAMPAGDNEIDLVRLFFELLDHWKLIAGVTIVFTLGALAYALFTTPIYQADALVQVEQKQGNALLNSLTQDL
PGSSPDSAPEIELLQSRMILGKTIDDLRLCDVVAQRYFPLLGRGWARLTGDIPGRLALNGMVIPRRDGRAQRLVLTVEDN
GHYRVDGADFTVTGVVGEPLIHNDLALTVSDIQAVPGTEFMLTQLTELEAINALQQRFSVKERGKDSGMLGLTITGDDPE
NIVRILNSIASNYLQQNIARQAAQDSKSLEFLQEQLPQVRNELDQAENKLNAYRKQQDSVDLNLEAKSVLEQIVNVDNQL
NELTFREAEISQLYKKDHPTYRALLEKRHTLEQEKTRLNKRVSAMPQTQQEVLRLSRDVESGRIVYLQLLNRQQELSIAR
SSAIGHVRIIDPAMTQPEPVRPKKALIVVLGLMLGLFFSTGLVLLRTLLRRGIESPEQLEEQGINVYATVPLSEWLAKKA
QVRRQHFFSSRLRHHTRNIPFLPVDNPIDLSVEAIRGLRTSLHFAMMETANNILMISGATPDSGKTFVSTALAAVIAQSE
SRVLFIDGDMRRGYVHDMFGIENDVGLSDVLSGKSEMTEAVQRFHKGGFDVITRGQVPPNPAELLMRDRFRQLMAWANTH
YDMVIIDTPPILVVTDAAVIGRSVGTSLVVARFGLNSVKEISVCVQRLEQSGINIKGAILNGVIRRASDYYGYGYSQYGY
RYTDKG
>gnl|bykdb|A0A0L0J1R0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Enhydrobacter aerosaccus] (length=722 residues).
MDQKVNDDEIDLRALIATLLNHWKLILSMLLLGLLGGIYYAQSATPIYKTNSLIQVDKKSSGVSALGEDVVGLLNAQDGS
AQTEVEIINSRMILWPVINQLHLDLTVNQLKDSFLDKLLIKKSVLVSHTDNGVGNLKVGLWIAEFNVPLAYQNKNFVLTA
IDSQNFKLISPDGAEFTGKVATASRFKTSAGNIDIQVTSLAPGYSYNLSKLTPAKAIENLRANLAVAEKGKQTGILDASL
TGANQDEITHTLTRIVKMYEMQNLDKSSAETTKTLAFMQEQLPKLKTKLAEAEAKFNNFREQNATVDIDKEAELAVTQRA
TIETNLRELELKRAELSERYTDEYPVLKQLNMQIQELRDKEEALKQNITRIPEVQRQFLELSSDVKISNEIYLNMLKNYE
QLQIVKSGQLGNVRIIDLPINTYAPIAPKKAQIVLIATLLGLMLGIGLAFLKSLLFAGVKDLEELENNTDIPVIGVIPHS
PRLTRLLKSKSTKIPLVEQIEPEGVVSEGFKSIRTHLLFNATKTDGNTLLITSAGPSIGKSFISANLAVAMAMTGKRVLL
IDADTRLGHLQDRFNLPNINGLVDYLVDDTIDAANSSYMIQTTLYENLQFIPRGKGHSHASELLLNGKMKALLDFYRQFY
DYIIIDTSPVMGTSDALSIGQLVDSVLFVVRYDVSNIKQVNYAIEKLQRANVKVEGIIFNDAKQSLIGAYNYHYGYEYKS
KN
>gnl|bykdb|A0A0L0MDP3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Candidatus Burkholderia verschuerenii] (length=758 residues).
MRHNQSIRRMNEPEDLYYVQSSEREPDTMNLPSVFDVALDNKRMIAIVAACFVAVGALYSVLHAPVYRGDLVVQLEDSMS
PPVTGPLNSQTAVPGGDTKSKTDGEIQLLESRTVLSQAVDNTHLFVDAKPHYFPLIGRWIAAHSDGLSSPGIFGLGGYAW
GTESIDVPQFDVPQKMEDDKFYLRVLPGNKYQLDGKDLDKPVEGQVGKTLKFKTDAGEITLFVAKLEGRPGAEFDLKRQS
RLVTIQDLQDQIDVKERGKESDIIGASYDGTDPVLVAGVLNEVGRQYLAQNVRRKTEEAQRSIDFLQSQIPLRAESLRRA
EDDYNHTRAQLSSVSLGDEASMLLRQSVDADSQLAALRQKRLELSARYGPNHPDIQALNAQIADLGARSTMLNDRIKVRP
MIEQDILRKTRDVQVNQQLYMTLQDNLQEMQLVKAGMAGSARIVDWAPIPEKPIWPRMLIVLPLSALAGLFIGFGAALLR
SRLFRGVSDSRDIERTVGLDVYATVPNSVMQKRLEKRMDKTPGATTLLAACSPRDPAIESLRSFRAALQHMVGETVNNRV
MFTSSRASVGKSFVAANSAALLASPNRRVLLVDADIRNGMIHHRLGLKRQYGFADLLESGDVQRAIQHTSIEYLDFISAG
TEGMDADLLLQSPFLEKLLEELSSRYDIVVIDTPPTLEVADSASLAPNCASVFLVTLAGVTKMSELEESVKRLRQVGVTP
TGSIFNRVTPTFGKYGYGEYGANRSTPAKGARVTPELR
>gnl|bykdb|A0A0L1C5Q3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=726 residues).
MTTKNMNTPPGSTQENEIDLLRLVGELWDHRKFIISVTALFTLIAVAYSLLSTPIYQADTLVQVEQKQGNAILSGLSDMI
PNSSPESAPEIQLLQSRMILGKTIAELNLRDIVEQKYFPIVGRGWARLTKEKLGELAISWMHIPQLNGQDQQLTLTVGEN
GHYTLEGEEFTVNGMVGQRLEKDGVALTIADIKAKPGTQFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDDPQ
LITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDNQL
NELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISK
SSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEHGISVYATIPMSEWLDKRT
RLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSD
QKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDH
YDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGY
SYSEKE
>gnl|bykdb|A0A0L1L1E2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Candidatus Burkholderia brachyanthoides] (length=760 residues).
MKDIVRAGAGNADCDDQVDLRATADLLIQNRRSIVISTLATLLVAGLYLIVASPSYRANILVQVEDSNDDATAAVGNVIG
SLASLFDVKSTDEGEMQVLQSRLVTERAADDLRLYVEGCPKRFPLVGRWLSAWNHEPVMPGLLGWGGYAWGDESIAVSRF
DVPREWEDDRFYVTVLDDNCFVLTGSDLPGEVAGRVGEPLVIRTVEGLVTLRVTQLVGRAGVMFRLIRHSRREVIDELRK
DLDIVEEGKDQSGVIGVSYRDEDPVKVAAVMNEIASSYVQQNEDRRIETANKSLAFLQTQLPQTQRQLEAAEDRLTSYQN
RHRIVDLTEQAKALLEQSVQQQSALLQVRQKRTELLATLSERHPAVVAAERQITDARRTLAGLEQSLQKLPNNQQGLVRL
MRDVRVETGLYIELLDSIQQFKLAGAGRIGSVRVIDRAVVPEKPVWPRPLVVMAVALVAGPFFGVAFIFTRTALAGGLLT
DPVDVERKTLLDVIAAIPQSRSQRQLTRLHERGLRRSTLLTVEMPNDPTVEALRNLRTAVQLAQPDPRVNNVILITGPSP
GTGKSFVAANLAILLGAAGKRVLLVDADMRCGQLGRDFSATGPGLSDVLRGTATLDSAISGKVNANVDLLGSGELIDQAD
DLLINGSVGELIERAARDYDMVVIDSPPVLPVADTTILASYARTVLLVARAGMTTGGQILESAKRLHRSGALASRVVLNR
FTPGLRSNAYGNYRGYYRRDTSDTPAHGAPRAGETASGRA
>gnl|bykdb|A0A0L1LFY8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio lentus] (length=723 residues).
MTTQPSQQSHTDNSDEIDLGKLLGILLDAKWLIMVTTFAFAVFGIAFALLSTPIYKADALIQIEQKASGGISSMVGDMGE
LFSQESSATTEVEIIKSRMILGETVDKFNLTTVTAPSYAPIVGKGFARLTGDINHIVVSRFALPSYASDYGHAIQIVDAE
KGTYQLVRDDERVILKGKVGELATADDYSLFVAGFESSNGFEFTIGKRSRLEAIEWLKSSLSLSEQGKQTGILKLSFEGE
NKQQISEILNHISQIYFLQNVKRNSAEAEKSLSFLESHLPGIKSELTGYEDTLNNYRQENESIDLGLEAQSTLKVMVGLE
AQLNQLTFKESEVSQKFTKDHPTYRALLDKREILLQEKERLNKQIQKLPKTQREVLRMTRDVEVNQQIYIQLLNKVQELS
IIKAGTVGNVRILDDAQAYARAVKPKKPLIVVLATLLGGMLSVAFVLVKAAFHRGVESPDQIEQIGLPVYAAVPKSDLQI
ELSNRFKSKKQKTKGAQALLAESNPADLSVEALRGLRTSLHFAMLEAKNNILMISGPAPGIGKSFISTNFAAVAAKTGQK
VLLIDADMRKGYLQQSFGVNWDNGLSDVLSGKQEFAQSIKTTPVENLDIITRGQVPPNPSELLMHPRFAELMEWASKEYD
LVIVDTPPVLAVTDPSIVGAFAGTTLMVARYGQNTIKEIDVARHRFEQSGIEVKGVIFNAIEKKASSSYGYGYYNYSYSS
DKK
>gnl|bykdb|A0A0L1MEY2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae] (length=742 residues).
MQQAPVVNVRDDDNDEIDLLGLFGTLIDHKWLIAAVTGAFMVAGVAYAVLATPVYQANALLQVEAKKNDLLGFSDVSSML
GKESPSATEIELIKSRAVIGKTVDNLKLDIVIQPKYFPVVGEFLARRFQNKNPGEIAASLLGLNSFAWGGESLKIFKLDL
PDSQLGKKLTLTAGENGHYTLVDEDDNVLAASQAGQLFEQNGIAFQIEEMHANPGTRFTIIRNSRLTSILAYQEDLDVSE
RGKESGMIGLALESTDPDQAIKILNEIAAIYVRQNVERNSAEAAQSLAFLKEQLPVVKKDLEKAGKALNEYQTRSKSVDI
TLETKAILDQIVGLDTSISELKLQQAEMDRKFTRQHPAYRALLSQIGELSSKQKSLASKVESLPSTQQELLSLTRDVEVG
TAIYTQLLNKSQELDVMRAGTVGNVRLIDTADVNFLKPVKPKKALIVLVATILGGFLAVALVLVRKALNRGLESPEAIEQ
LGLPVYASIPYSILQKSEEDKVSRGRGRSGAGSTLLAVTHPTDLAVEALRSLRTSLHFAMHEADNNRLMISGPSPQVGKT
FVSVNLAVVIAQTGLRVLLIDVDMRKGYLHKVLGVSSDNGLSDILARRCDVATAIHKTQIDNFDFVSRGQIPPNPSELLM
HANFSALLEQASELYDLVILDTPPILAVTDAAIVGRLSGTNLIVTRYGLNPAKEIELTVRRFSQNGVSIKGAIFNGVEKK
ASNKYGYSDYGYYHYAYASDKN
>gnl|bykdb|A0A0L1MKG9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae] (length=748 residues).
MDNSPSLYVERPIQPHVPQHQPYSEEKDTIDLLKYWRVIWRAHWKIGWLVLLGCVLAMVTLSFIPRQYIGSTTLLIKEKT
PPLLVFQQATESSSGTVDYLQTQLALLQSRDLAERAVKKLNLTTHPVTDPRQQPQPWFAPRRWLASLELGQWLPVVGRLA
PVQVVPSEADVFNQVTQNLMRRTSVKFVGKSQLIKIEVELPDPGLAAATANAIAQGFIDSQLDNNLKSSLTNTSWMNSRL
IELRNNLRSAENKLQGYREAQGLVDVGGVATISANELELTGNRMIDARRNLAEAESQYRQVQALSNGNLSKLSSVPAVLS
NPLVQKFQAQQAKAQAKVEELSGRYGPKHPTLAAARAELRMATDSLRLQVQQVVAGIEREYQLSLANENSLRKSFNSNKA
QLQDISRKEFQLREFQREVDSSRALYETFITRLKETAATSDMDSTKARIVDPAIVPLEPSKPRKTLILAIVAVVAALIGV
ALALLSETLNKTFKTDEAIESTLDVPLLSVVPLVTKRSRRQLARLFDDNDHPRFCETIRNLRTWLMLHSSDMPSHVVLVA
STMADEGKSTIANNLAYSLAKLERVLLIDADMRRPSLSLNFDFPPDAPGLANVLAGTARLEDCIRSVGNLDMLPAGKLSP
PPLDLLSSSRLAPMLEALKSRYQRIIIDSPPAQMVSDALLLAKHSDAVIYVIKAESTPVSQVQKCLAILQQSHAPVFGVV
LNQVDLSKARKQGYSHSDTFQNYDYMSR
>gnl|bykdb|A0A0L3JBI8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Salmonella enterica subsp. enterica serovar Johannesburg] (length=719 residues).
MTEKVKQSAAVTGSDEIDIGRLVGTVIEARWWVLGTTAIFALCAVIYTFFATPIYSADALVQIEQNAGNSLVQDINSALA
NKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVTKNTFPLFGAGWERLMGRHNEMVKVTTFTRPETMSGQIFTLKVLGDKR
YQLVSDGGFSAQGVVGQPLNKDGVTMRVEAIDARPDTEFTVSKFSTLGMINNLQNNLTVTETGKDTGVLSLTFTGEDRDQ
IREILNSITRNYLQQDIARKSEEAGKSLAFLAKQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQLN
ELTFKEAEISKLFTKAHPAYRTLLEKRKALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITEA
STVGDVRIVDPAITQPGVLKPKKALIILGSIILGLMLSIVGVLLRSLFNRGIESPQALEEHGISVYASIPLSEWQKARDS
VKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMLTGVSPSIGKTFVCANLAAVISQTHKRVLLI
DCDMRKGYTHELLGTNNVDGLSDILAGKGEIASCAKPTAIANFDLIPRGQVPPNPSELLMSERFGELIAWASSRYDLVLI
DTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFDQNGIQVKGVILNSIFRRATGYHDYGYYEYEYQSDSK
>gnl|bykdb|A0A0L6I606 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Achromobacter piechaudii] (length=753 residues).
MSLPIESFEPSVPARQQETPLSSHVDAIISNRWMILAITLFAFLGALAYVMVTPSVYSADIIVQVEEEMPNGQARSLLGD
VSAMFDTKAETSGEMEVLRSRMVVGPAVDKFLLYIHAKPRYFPVVGEWLAQRYEALPYPSSLPRGGYAWGGERIAISQLD
VPNEWLGKPFRVTTQGEGRYTLTDKFTGATFSGAVGKPERFLLPGGGAMDVHIDALTGRPGTEFTISRSSRLAAIEDVQS
HLGIFERGRASGVIGVTLEGNDPALTTAVLNQIGQEYVQQNVNRKAAQAEKSLGFLEQQLPILKGELDAAETKYNALRNK
RGTIDLSEEAKLILAQSVDAQTKVMELRSKRQELITRFAPTHPSIVAIDRQIASLTGDVNRIGNNIKALPDLEQDVVRLV
RDVRVNTELYTGLLNNAQQLRLIRAGKVGNVRILDAAVQPDRPVRPKAAIIIGVATAIGLIFGMLCAFVRNALFGGLSEP
DDVERYTGLPVLAAIPYSDMQDKLWRRSRRKNATVPALLAQSQGNAPPIESLRSFRNVLQASLRQSANNMVMFTGPVAGV
GKSFLSANFAFIQGGVGKRVLLIDADFRKGQLNRYFGVPKEDGLFEVLSGTIPLERVRKHSVSEGVDFIATGAVTFDPSE
LLASPVFGATLRELSSQYDMVILDTAPVLSSPDAAVVGTHAAAVMVVVRSGMNTVGEIRETAKRLIQAGAPVDGVLFNGL
KLMPERFGFRSKYGNYRYSRAAYYGDFKQNGPK
>gnl|bykdb|A0A0L6K3H3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Agrobacterium sp. SUL3] (length=782 residues).
MHHKTFKSNIGFPDSGKDSDTFIDLDRLWAAVVRRANVIAASVIAAVVLAGLYLVLATPVYTAMTQVLLDESLSRYAEEE
SPVPAAQIVDNRIASAVEILKSKEMALTVVDKAKLDENDIIVNPPMSPVELVKSSVRGVLDLVLPGDPPASEAAIRAGRR
EKAAAILQQSLTVERVGRSSVIAISTRSTDRQLAAQIAKTYAQAYLTEQLNANFDASERASVWLQERMTDLNQRAQAAEL
AVQKFKSDNNIVSSRGELMSEGQLADLNGQLIAAQADAATASARYNQYKSIIDRGPDVAVDNAVVSARDTDNSVIQDLRK
RYITISDRQQGIVQQFGADHPQAIALDAEKKEVSRQIYQELQQLTGSLKNEFDVANSRVQSLRDNIEGVAGRNSQANITM
VQLRELEQRATALRTLYQSYLGRFEEASQKQSLPIAKARIISEAGLPTAPSSPKKTMTMALSVILGLMLGGGIAALLEFR
DRFFHTGNDVRDNLRMRFLGYLPFIGERGVETAKPGTSAATPGGENATLDESGQVSFQKMLRLAVDSPRSSFAETLRNVK
LTADVVIQERQCRVIGVISCLPNEGKSVVALNLAGLIASTGKRTLVVDADIRNPGLSRMLTTRQSAGLVEVVLDEIPWTQ
AVKVDTRTKMGILPVSTSNQFAHSSELLASSGMRKFIDQAREACDYIIVDLAPVVPVIDAKAFAPQVDGFVFVTEWGKTP
IQMVQNLMANEPQIANKTLGIVLNKTDMTELQRYAGPGGSEHYHESFSAYYGDAKPPVKENA
>gnl|bykdb|A0A0L6K561 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Agrobacterium sp. SUL3] (length=751 residues).
MADYDKSAFTADIIDIETALATIRRQWRIVLAAIAVAAAIGLTYIVTAVPIYSATATLLIDRNNSQIVEQLSTIGGVVED
EASILSQVEVLQSETIGLAVINSLNLAENQEFGAARASLLSSIIDTIRSLVNVSQWFSPEKETVIDDETLKRALSDQLLS
NLSVKRIGRTYALELTYNSTSPVLAAQIVNAVASAYLVDKLNSKYEATKRASDWLSDRIAELRQRALETDLAVQKFRAEH
NLISAGSNGLLSDQQLAESNSALILAQSETARARARVQRIDHILATDDVDAVVTDILDSSVANDLRKKYLESSKVEAEIT
GRLGGNHVQAVRLRNEMQEYRRLMFQEVSRIAQSYKSDLEVSEAREKSLAESVARATDVSNSASQTQVQLRELQREAETY
KNMYQTFLQRYQEAMQQQSFPVTEARVISKAMPPEGPSKPNKPLVLALFMFMGAVAGGGMAAFREFRDRFFRTGEQVRDV
LGLEFLGNTPLIQNKPATDNLPTGKESNPAATRPSSIGRHAVDHPLSSFAETLRSTRLAIDLGIAAKSGARVVGVVSALP
SEGKSTISINLAQLLAGQGARVLLLDADIRNPGATRALARHAGEGLLEVLLEGRNVRDVLLHDEKTRLAFLPTVVKQRVP
HSSELLTSAQMHKLLAEASNAFDYIVVDLPPLGPVIDARAMAGRIDGFIFITEWGKTARRAVRNTIENEVHIRKKCLGVI
LNKVDTEKLKLYRAYGSSEYYHSRYTRYYHD
>gnl|bykdb|A0A0L6Y4E5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=726 residues).
MTTKNMNTPPGSTQENEIDLLRLVGELWDHRKFIISVTALFTLIAVAYSLLSTPIYQADTLVQVEQKQGNAILSGLSDMI
PNSSPESAPEIQLLQSRMILGKTIAELNLRDMVEQKYFPIVGRGWARLTKEKPGELAISWMHIPQLNGQDQQLTLTVGEN
GHYTLEGEEFTANGMVGQRLEKDGVALTIADIKAKPGTQFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDDPQ
LITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDNQL
NELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISK
SSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEHGISVYATIPMSEWLDKRT
RLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSD
QKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDH
YDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGY
SYSEKE
>gnl|bykdb|A0A0L7AJF6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=726 residues).
MTTKNMNTPPGSTQENEIDLLRLVGELWDHRKFIISVTALFTLIAVAYSLLSTPIYQADTLVQVEQKQGNAILSGLSDMI
PNSSPESAPEIQLLQSRMILGKTIAELNLRDIVEQKYFPIVGRGWARLTKEKPGELAISWMHIPQLNGQDQQLTLTVGEN
GHYTLEGEGFTVNGMVGQRLEKDGVALTITDIKAKPGTQFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDDPQ
LITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDNQL
NELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISK
SSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEHGISVYATIPMSEWLDKRT
RLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSD
QKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDH
YDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGY
SYSEKE
>gnl|bykdb|A0A0L7AM65 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQSSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMVDQVFTLNVLDNK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHASPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEEEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGVKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGEVPPNPSELLMSERFAELVSWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A0L7T9V4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Erwinia iniecta] (length=725 residues).
MVDKKSDSTQKVADAKDEIDVARIYGSLVDHRWLILGVTALFTLVGVIYSMLATPIYRADALVQVEQSQGSLVLSQLSSI
MPDSKPRSDAEIGLLMSRMVLGKTVEDLNLQTIVKENHTPIIGAGWARLTGEKPKRINVSRFNIAPELIGQGLELKIGDN
KSFTLSSSDGEVLSGKIGVLAKKDNNSILISDTDAEAGDSFTIVKNGYLQTYNNLVSRLTVIDQGKDTGVLSLTLNGTDP
DETQAILRSITENYLLQNVERKSAEAEKSLNFITNQLPEVRQTLDEAENKLNQFRQANDSVDLSLEAKSMLDTMVNVDNQ
LNELTFREAEISKLYTKSHPAYRTLLEKRQTLADEKKNLEKKISGLPGTQQEIIRLTRDVDAGQAVFMQLLNKQQELSIN
KASTVGNVRIVDPALALASPIAPRSVIIIAVSLILGLIISSIYVIMKTILIRGIESPEQLESSGINVYASIPISEWQQQK
DRKLSDLGKFKGKKELRAGELLAIANPADLSIEAIRSLRTTMHFAMMDAKNNVIMISGTSPDIGKTFISSNLAAVMAQSG
QRILFIDGDLRKGYSHDLFQSDNKHGLSDVLSNQANVEQAIRNTNVEGLDFIPRGQLPPNPSELLMSQKFVDLMDDVQKR
YDIVIIDTPPILAVTDAAIIGLQAGTSMLVAGFEKTTVKEVEVSMRRFEQSGIEIRGAILNLVMKKAASYYGYGYYHYSY
ESTKP
>gnl|bykdb|A0A0L7YYJ8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio alginolyticus] (length=733 residues).
MENSINNRQLNSDEVIDIRQYFNILLNYKWRILLFSIMVTAIAVLIVLSIPSQYTARASLLIESKQAKAVSIEDVYGLDT
KSQEYYLTQIEILKSDRIAEEVINRLNLSQHPEFDPSAQKKPTLSLASIFEWFPALKAFKKEPVEASEEEQNYRNSRLVL
AKFKRGLEISPIRKTQLVTIFYTSKDPKLSAQIANEIGRVFMDSHIEAKLEVELKANSWLNSRMGELREKLRVSEAQLQD
FLKAEGLVDIQGVEGLASQELEELTSQLNKTRDRRVAAETLYLVAQTYSRKDDLSSLASIPEISNHPTIRDVKLAEVQAE
RKVSELSKRYGPKHPKLKSAQAELNSVKRNLNSELKQLLNGISNELQAAKQAERSLHKELEKRKLDFQTLTVKNAKYSEL
KREVQTNRELFDLFLSRQKETSASSDFNATIARFTDFANPPLAPSKPNRKLIVILAFIASFGFACVVAFIADAVNDTFVD
IKQVEKLLSLSLLGIVPAIKTRGQLKPRAYFDSNHRELTEAIRTIRTGYLLANTNKDHHVVMVTSSLPEEGKTTSSINLA
FSLSQMEKTLLIDCDLRKPSVAHRFGVSGSQPGITNLLTGTHTLDDCIHTDEESGLDILTAGVLTDNPLELISSSRFVSL
LEELKTSYTRIVIDTPPCLAVSDAFMLSQYVDSTILVINAAQTRTKIVRDVVGRLTQQGARIDGVVLNKLNIKKASHYSG
YQQYHSYYGAEKP
>gnl|bykdb|A0A0L7Z5Y3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio parahaemolyticus] (length=726 residues).
MNGTHPNNFQMNKVELIRFGHHFKTLKKNWLSIAAFTLIFSLTCTWYIYSKTSIYQATATLLIQEEQKSALSIEEVYGVD
TTKKEYFQTQIAILKSNHIADKVINELNLTQHPEFTSSGGLKQKIDDIKAVPLVQDLLNVSPSPKETSQFSESYYQALQA
FKRKLDIEPVRNTQLVRISFRSADPKLATRVANAVGQAYIDANFEAKLVVTQNAATWLTNNSQKLEERLKKSEHALQEFL
LKEGLIDINGIDDIYANELEELNRKLNTAVNKRIEAQTLIQLLKRKSSQNLDSLLSIDEFANQAQIRDLKLSEAQAAKNV
SELAQRYGPKHDRMVQAKAQLASIQERTQQLIREISFSKQQDLLAAKAQEDMLREELDRKKSDFQSLGSQKARYEQLKRE
VESNKDLYEAFLNREKETSATSDYKNVTARFTDKAIIPLFPVAPQRMKLVLIATFFGFAIACALVIILETLREVIRTSND
VQDKLGVTCLGVIPMVKKRTLRKNGVSYTAYLDKDEKLFSEACRSVRTSLLLRLTNTKQKILPFTSAIPEEGKTSTSINM
AVSFSTMEKVLIIDCDLRRPSLAKRFNIPESQPGLTNILTMDTAIKDCIVRIDDANLDVLPAGLIPPNPQELLASNRFKK
LLDHFQDKYDRIIIDTPPLLSVSDALILGQYANGLITVIRSESTKASLVNVALSKQIQHSIPSLGVLITQAKAKEGETLY
VQKYAY
>gnl|bykdb|A0A0L8ABS5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][[Pseudomonas] geniculata N1] (length=742 residues).
MTKETSARPTREDDEIDLRDLLGVLIDRKWWILGTTFLFAMVGAAYAILTPPVYRAEATVQVESKMPTIPGLADLTSLGG
GGSTASTTEVALLTSRTIVGTAVDKMQLETVIEPRRFPFVGGLIARRFSGETEGEVAAPVLGLSSYGWGGDELKIHRLDV
PARLLDEPMMLVAGDKAGEYSLLDDEGETILAGKVGMPAEARGIKIEVASLNANPGMRFTLTKQRRLDVIAGLQEDIRAS
EQGKDSGILRVSYEDTDADRAQALVQNIAEAYVRQNVDRGSAEAATQLAFVKDQLPTVRKQVEDAQAAMAAYQSRSNSVD
ITMQTKGLLEQEVAVEASIQQLRLKQAEMDRSFTREHPAYRAMLNQIGELEARKSGFRREVSALPDTQQELLRHTRDLQV
SNELYTALLNQAQQLDVARAGTVGNVRIVDDAIVDISKPVKPRKPLIVLVSFLLGAFLSTAAVFLLRMLNPGVEDPAQIE
ELGLPVYAAIPLSNSRNLLKVQKGKGGKKRVVADGRSHLLAAAEPADLAVEALRSLRTSLHFAMLEAKNNILAISGPRPG
VGKTFISANLAAVVAQAGQKVLVVDVDMRKGTLHKVLGVSHSGGLSDVLAGKVTLQDAIHAVPGLESMHYITRGDIPPNP
SELLMHPRFLQLLEGLAKEYDLVIVDTPPILAVTDAAIVANHAGSTLMVTRFGVNQPKEIELSMKRFEQNGVKVKGAIFN
AVEKRATGYYSYGYYEYASSEK
>gnl|bykdb|A0A0L8ES76 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Achromobacter sp. DMS1] (length=753 residues).
MSLPIESFEPPVPARQQETPLTSHVDAIFTNRWLIIAFTMLAFLGAAIYIMVTPPVYSADIIVQVEEEQPNGQARSLLGD
VSAIFDTKAETSGEMEVLRSRMVVGPAVDKFLLYIHAKPRYFPVVGEWLARRHESLPFLASLPHGGYAWGGESISVSQLD
VPNEWLGKPFRITTLGEGRYTLNDKITGATFKGTVGKPEHFLLPGGGALDVHVDAISGRPGTEFVVSRTSRLAAIEDVQS
HLGIFERGRASGVIGVTLEGNDPALTTAILNEIGQEYVQQNVNRKAAQAEKSLGFLEQQLPKLKSELDAAETKYNALRNK
RGTIDLSEEAKLILAQSVDAQTKVMELRAKRQELITRFSPSHPSIVAIDRQIASLTGDVNRIGGNIKQLPDLEQDVVRLV
RDVRVNTELYTALLNNAQQLRLIRAGKIGNVRIVDAAVEPDKPVRPKAAIIIAVATAIGLIFGVLCAFVRNALFGGLSEP
EDVERHTGLPVLAAIPYSDVQDRLWKRSRRKNASVPALLAQSEGSSPPIESLRSFRNVLQASLRHSANNMVMFTGPVAGV
GKSFLSANFAFIQGGVGKRVLLIDADFRKGQLHKYFGVPKEDGLFEVLTGTVPLAQVRRHSVAEGVDFISTGAVTFDPSE
LMASPVFGETLRELSTQYDMVILDTAPVLSSPDAAVVGTHAAAVMVVVRSGMNTVGEIRETAKRLIQAGAPVDGVLFNGL
KLLPERFNFRSKYGGYRYSRAAYYGDFKQTGSK
>gnl|bykdb|A0A0L8SU38 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio parahaemolyticus] (length=726 residues).
MNGTHPNNFQMNKVELIRFGHHFKTLKKNWLSIAAFTLIFSLTCTWYIYSKTSIYQATATLLIQEEQKSALSIEEVYGVD
TTKKEYFQTQIAILKSNHIADKVINELNLTQHPEFTSSGGLKQKIDDIKAVPLVQDLLNVSPSPKETSQYSESYYQALQA
FKRKLEIEPVRNTQLVRISFRSADPKLATRVANAVGQAYIDANFEAKLVVTQNAATWLTNNSQKLEERLKKSEHALQEFL
LKEGLIDINGIDDIYANELEELNRKLNTAVNKRIEAQTLIQLLKRKSSQNLDSLLSIDEFANQAQIRDLKLSEAQAAKNV
SELAQRYGPKHDRMVQAKAQLASIQERTQQLIREISFSKQQDLLAAKAQEDMLREELDRKKSDFQSLGSQKARYEQLKRE
VESNKDLYEAFLNREKETSATSDYKNVTARFTDKAIIPLFPVAPQRMKLVLIATFFGFAIACALVIILETLREVIRTSND
VQDKLGVTCLGVIPMVKKRTLRKNGVSYTAYLDKDEKLFSEACRSVRTSLLLRLTNTKQKILPFTSAIPEEGKTSTSINM
AVSFSTMEKVLIIDCDLRRPSLAKRFNIPESQPGLTNILTMDTAIKDCIVRIDDANLDVLPAGLIPPNPQELLASNRFKK
LLDHFQDKYDRIIIDTPPLLSVSDALILGQYANGLITVIRSESTKASLVNVALSKQIQHSIPSLGVLITQAKAKEGETLY
VQKYAY
>gnl|bykdb|A0A0L8SUA4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio parahaemolyticus] (length=719 residues).
MANQTIQSSALADDEIDLGKLFGILIDAKWFIISITLFFATLGIAVALLSTPIYKADALIQIEKKSSGGISAMVGDMGEL
FSAESSATTEIEIIKSRMILGDTVDKFNLTTIATPDYLPFVGKGLARINGTQNYISLTTFEVPQTARGLSHKLIATDIEK
GQFSLMLEDQMVLSGSVGQLIEMNGYRVKVNQLNAQNEDTFTISKISKLDAINKLASQLSISERGSQTGIVSLSIEGEYP
DHNQLVLNDVVQNYFLQNVRRNSAEAEQSLNFLKGHLPEIKDKLTISEDTLNSFRQENESIDLNLEAQSTLKVMVALEAQ
LNELTFKESEISQKFTQDHPAYKSLLDKRQTLLQEKERLNKQVQKLPKTQREVLRMTRDVEVNQQIYIQLLNKVQELNII
KAGTVGNVRIIDNAQSYAVPIKPKKPLIVVLATLLGGMVAVAFVLVKTAFHRGVTSPDVIEQTGISVYASVPKSAQQLEV
ANKLKRKNNKDLLLLANANPADLSIEALRGLRTSLHFAMLEAKNNVLMISGPAPSIGKTFVSTNFAAVAAKTGQKVLLVD
ADMRKGYLQQCFGLTAEQGLSDLLSGKTDRATAIKPSQVENLDVVTRGQVPPNPSELLMHPRFVEFVEQVSKEYDLVIID
TPPVLAVTDPSIVGALAGTTLMVARFDQTTLKEIEVARGRFEQSGVEVKGVILNAVEKKASNSYGYGYGYYNYAYKSES
>gnl|bykdb|A0A0M0ELB2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Komagataeibacter europaeus] (length=736 residues).
MNYVSIQGRATSMSWTAQDVGLVIRQTMRAFLRHRMLFALTALGVLVAGGAVMLTLKPRYTATTTVVVSGRAQQDPLAPN
GQQQNLAPPDDELVSTEAAMIHSRDVAAAVLAQLPPPPVPPHVGMRDRLCHMGLGFLCHASTPVDPEVQREHEEDAFLNN
LTITPEPRTQILDINVVDGNPQRAAALANAVVTNYQRIALARQTADINHVATWLDNRTAALRQRWLDAVEKANAFDNANG
LTNTTEGSTSTPLIERQIADTSANLSQAEGRLAAAQARADALRDAAARGDARAAVALSQEPILVATANALMQLQSTRQEE
AATYGPQHPRLRALDQQIAATRASLEAETQAALSTIREDQISARAEVQRLNENLELLRQKAGGQSAPQAEYRTLDQEAQS
ARAVYETFLEHAKEVVDRAALLQPPIAVVSHASAPDMPSFPNRKKIGLGLMAVALAAGAGAVLLRDYFAAGFTEIERLRA
AVPLPLLAVVPKVGGRSEQTVRRHVIDHPYSRATEAVRSLVMQLSMRVHEGGQPLCLAITSAGPEEGKSTLALWMATVAR
RGGQKVLVIDADHRRGMLDQYLTDGTTGRPSLGMSDLVTTGVPVADVIRTDPDTGFDYIPAGRTMQHAFSPVEIRRLRAI
LAELKRSYELVIIDCPPLLGLSDALVHANMADQVIFVCRWKSTAQRAVMACLERLEACGAPLAGVVATMVEDNAMDVMGY
SYGNRDIKILSRFDDK
>gnl|bykdb|A0A0M0FSW2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Azoarcus sp. PA01] (length=762 residues).
MIDNTEKPDAGDERHQEVPRRNALVERRESTPLAHPTEWRSHVEEDDDDTIDLRAIWDTIVKRKWTVITFFAIVMVSVLT
ATFLMTPIYRASLTLQIERQEAKVLEYQGVTPNEMQGDTKDFYETQYELLKSRTLAQRVIDQLNLGDHPLFAEPEASPLA
SLKAFLTGGEEELVEGDAEQIRKLKLTKAFLEDLTIEPVRNSRLVKIHFDSPDPVLASRIVNAISEAFINVNLERRMDAS
SFAKVFLEERLQQLKVKLGETEKELVAFAREEQIVRGGEQEASVDTQVMQEFTTALAKAQQERIRAEALYQQLESGSVEG
IPQVLENKVIQEFKGHKAKLETEYQENLKIYKPGYPKMVQLQSQIDEMQAKIAEELAHVRSGIRSAYQAARSQEAMLQVK
MDESKRTVLGVQDRSIQYNILKREVDTNRQLYDGLLQRYKEVGVAGGVGVNNVSVVDKAEVPLQPFKPKTLLNALIAALL
GLFGGIGLALLFEHLDDTIKDGESMERLLGLPVLGMVPLIKRAGDAARELVLEQLDDSRSGFSEAYRSLRTAMQFSTQDG
IPKVLMVTSASMGEGKSTTALALAINLSQLGLKVLLVDADLRKASMHRKLGLANTAGLTNYLAGDSRPVDITQPTPYNKL
FVITSGPLPPNPAELLGSAKMVALLDVAKDRFDCVIVDGPPVLGLADAPLLGSITDATVVVVEAGGTRKDFLAGALKRLR
STRTHVIGGVLTKIASRSGAQGYYYNSYYQYGGEAEGSRSAA
>gnl|bykdb|A0A0M0HJP8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio nereis] (length=724 residues).
MTNQVARQSIDNTSDEIELGKLIGILLDAKWLIAIVTFVFSIVGITVALLSTPIYKADALIQIEPKSSGGISAMVGDMGE
LFSQESSATTEIEIIKSRMILGDTVDKFNLTTVTSPTYFPIVGKGLARLSDEQASIQVSRFTLPPYAETMQHTLVIEGPD
AQTYQLIREDERVVLEGQVGELSQGDGYTLFVSQIIASAGEEFAIGQRSKLEAIEWLKQNLSISERGKQTGILSLSFTGE
NKAQISAILDHISQTYFLQNVERNSAEAEKSLTFLEDHLPEIKTKLTSSEDILNQYRQDNESVDLGLEAQSTLKVMVELE
AQLNELTFKESDISQRFTKDHPAYRSLLDKRQTLLSEKERLNQQVQKLPKTQREILRMTRDVEVNQQIYVQLLNKVQELN
IIKAGTVGNVRILDNAQSYAVPVKPKKPLIVVLATLLGGMLSVTFVLVRSALHRGIENPDEIEKIGLSVYASVPKSDMQA
DLLSKMKRKGKRNTEIQLLAEANPADLSVEALRGLRTSLHFAMMEAENNVLMISGPAPGIGKSFVSTNFAAVAAKTGQKV
LLIDADMRKGYLQSIFGLKWDKGLSGVLAGTIEANEAVQSTSIENLDIIARGQVPPNPSELLMHPRFKSLLDKASQDYDL
VIIDTPPVLAVTDPSIVGAIAGTTLMVARFGQNTLKEIDVARDRFEKAGIEVKGVILNAVEKKASSSYGYGYYNYAYKSD
KQAS
>gnl|bykdb|A0A0M0I0S7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio hepatarius] (length=737 residues).
MLTQSNADLPNQDRTIDLGYYYHLVKSRWLSIAAFTTLCTAIAVLFALSITPTYTATATLLIEASQKKAISIEEVVGIDT
RAKEYYQTQFEILKSNHVAQRVIDKLNLTQVAEFNPAMSIEEPSAVEELKQSVKQWPLIRTLFPEEDVAEVDLKAEQEAL
NRSVLKTFKSKLTISPIRKTQLVNISFESEDPALAAKIANEVGQSFIENNLESKLLATEQATSWINQRLAELKSKLDSSE
QALLQFLEAQKLIDDSGIVALTSSELSNLTDRIAQATEKRIETQALFNALKNNKSTDVATLSSISLISHHPQIRDIRLAE
SQAEKVVSELSKRYGPKHDKMIQARAQLESIQRRADSIVKKLVNGIEKELSSAVNQEQLLKAELLEKKEEFQSLSVVKRE
YDALKREVDTNAKLYDLFLTRQKETSATSDFSAANARFSDYAMVPQNPSKPNKKLIVAMAFVASMGMAVVICICLDAFNN
TIESSRDFENKLGLLPTGTIPAVKDKRFKKAPLDFRVFGEEKFAVFQESLDSIRTSLMLSHAQRKVLAISSSVPGEGKTT
TSVNLALSFAKLENVLLIDCDLRKPSIAQRFLLPNSHPGLVNHLVMDMPIKDCITRIEGTKLDVLTAGMVAANPQELLSG
EAFKNLIKRLSEQYDRIIIDTPPVLPVKDSFLVGQLTHGIILVVKANSTTRSVYRHTMTLFTKHKVVADGVILNQVQVPK
KGKHSYTEYAAYSHATS
>gnl|bykdb|A0A0M0M5E4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rheinheimera sp. KL1] (length=724 residues).
MVSPAPQQDVIDLRKYLSVINIHKWRIFGLAILVTLITVLVVLNIRSQYSATATLLIESQQAKAVSIEEVYGMNSSQQEY
YLTQFEILKSRSIAQTVVEKMDLTNHPDFEVKPGLMTRLRDLLPFLPTPESELTEAELAHKAREDLITEFQSRLTISPIR
KTQLVNISFQTYSPQLAADVANAIADAYIESQLEAKLGITQKAASWLGGRLGELRAQLDDSEARLQAYREKEGLIDVEGV
RGLGAKELERLSEALTEARSRKAQVDGFMRVIQQYGTDKIERLESLPEITAHKGVQDVKAQQVLTERRVSELSKIYGAKH
PKLIAAQSELTAVQDNLRNQIKKLIAGIENEAQTIQETVNSLEAEIAKAKDLYQDVSLKETTYQRLEREVETNKQLFDTF
LSRQKETEVTSDFNSAIARFTDRAVAATEPVAPKRKLIVILAFVATLGFGVMLAFVLDALNDTIKSPQEVEGLLAQRSLG
FIPSIPHKKTVDLPIHTFFSDQHKQYAESVRSIRTSLTLLALDRSLKTIEVTSSVPGEGKSTVAANIAFAFGQMEKVLLI
DADMRRPTLAKRFGLPAYQPGLANIIAGREQIDDCLVVDEASGITLLAAGNVPPNPLELLASDKFNEVIAELALRFDRII
VDTPPVQAVSDPLVIAKQMDAVVYVVSADHTRGGAVRSGVAKLLQAENNLYGVVLNKVDMKKVAQAYGDYGQYGYYHYYS
SSES
>gnl|bykdb|A0A0M1I405 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter sp. C15] (length=730 residues).
MSQNSNTNEDTIDLKELLFSLIAQWKLIAVCTLFCLICALLYLRVSPSIYATDAMIQVEDSKSAASQALLGELGNIAGGA
GQKSPADAEIEILKSRLVLGNVIQNLNLNIQITDTQDTLLHRLFNRDNTQIDYSHKGVEYKDPTHAFFIQRLDVPEYYLD
KPLNLEFKPQTQQFSLSYKDMPVFEGTLNKENILKDAKGTWQVRIDSQVPFNRTFILRRLSVPTAVKELTQNYAVAEKGK
LTGVVGLTYQGQDPVHITQVLNNILTVYHAQNIERKSLEAQQTLSFLDKQLPELKKQLEESELKFNKFREQYNTVDVTQE
SELFLKQNIALETTKIELKQKQAELAAKYTSDHPLMAEINAQLDAVNKKSAELNATIKRLPELQRQYLQYYRDVKVNTEL
YTNLLNNYQQLKVANAGEIGNVRVIDTAIEPVKPIKPKKLIVLILSLFVGGFIGVLIALMRKMLRTGIKDSAQIENELDL
PVYATVPRSPIQESRIKLLKKNKSIPILSIKNSDDIAIESLRSMRTAIHFALANAKNNLIMIAGPAPEVGKSFISVNLAT
ILAQSNKRVLLIDADLRRGYLNKYFNVEIKPGLSEYLSDQASFDSIIHHSEVTGLDMITRGKSPANPSEMLGSAKFKAFL
DEIMQHYDHVLIDTPPVLAVTDSIIISQYAGVNLITARHNKTQMKELELTVSRFEQAGVKVNGFILNDIQKSSGGYGYNY
AYNYAAAKDD
>gnl|bykdb|A0A0M1JB65 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Achromatium sp. WMS1] (length=759 residues).
MTTKTLTITKSLPTTSGTGLQIEKSNLLQNVDEDKVNILELFRIISRYKVGILSLAFLVTILSVLVALSMIPTYKSTATL
MVEVRKPNVVAIQQIGITDLSADSQYYQTQVRIITSRKLLDEVIAQLQLDKKLGQNTTQNNQPPQFPLVNWQSFVPDWRA
WLPEDLFPGIKAMEIQQTPEVMANIVRSRLNNGLTVTYVKNTKLIEVSFESPNRKLAATISNAIAKTYIENDIKAQQEMA
ANATSWLRKHVEELRIRLKQSEQELQRFREKERLLDVGGVKTIGAEQLSGFSAQLIEAQQQLAEVSASYKQIATARRRNR
LESIPAVLSDSLVTSLQQAKATAQRKVASFIKRYGPRHPKMVAAQADLEEARARIHARIQEVLAGVEKKYRAAKAKVESL
QQIVQQNKSEMQQINRKGYRLGALEREVESNRQIYKTFLDRFKETSTTSNLYYASARLVEEAIPAITPHSPNIKVVTSIA
ATIGLFIGLLWVSILVRLDQTFKGPEDVEERLDLSTLGILPLLRKVKKKNVLNQVSKEPNGLFAESLRTVRTGLLLSDLN
KPHKVILITSSVQKEGKSSTAATTAYFLAEIHKTLLIDCDLRKPIQKNLFGIAKNHPGLSDLMLGNVNIDDCLVKIDDRN
LSVLCAGSRTPNPLDVLSSNRFSEIIQQVIETFDYVVLDCAPVMSVSDGLLLSTMVDGVVFVVQADQTTYAVAMEAVKRL
RHVNAHIIGVVLNKLPQSKIGGYYGKYGYGKYGYYADVY
>gnl|bykdb|A0A0M2F385 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pectobacterium carotovorum subsp. brasiliense] (length=721 residues).
MTEKTSAKVSETNSDEIDLGRLLGTLLDNRWLIIGVTALFTIIGIMYVTLKTPIYKADALIQVEQSSGNSLLNDLSSMLP
EAKPQSAAEIELIKSRMVIGKTIKDLSLDTVVQQKYFPIVGKGLARIFEQEPGKIAVSRLEVPASWLDESFELTVLSDNT
YEVSSETVNFSGNVGRLESNNGISLLVSDIKAPAGTVFFIRKQSDLSAINDLLGRFSVEDKGKSTGVLQLSLEGEDPATT
NKILNSISQNYFKQNVERKSEEAGKSLAFLEEQLPSVRESLNEAENKLNKFRQQNDSVDLSLEAKAVLDTTVSVESQLNE
LTFKEAEISKLYTREHPAYKALLEKRITLEQERDKLNRRIGSMPKTQQEILRLTRDVQAGQDVYMQLLNKQQELSINKAS
TVGYVRIIDTAVTQPKPVKPRKTLLILLSFILGGVVSVAFVAIKTLLHKGIESPEQLEELGVNVYASVPLSEWQQKKDRA
LISRGKKGNTRSTELLAVGNPADLAIEAIRSLRTSLHFAMMEAKNNVLMISGASPAIGKTFVSANLGAVVAQAGQRVLIV
DCDMRKGYAHELMGCQGNDGLSDILSGQMPIEKGVRKTAIENMDFISRGQIPPNPSELLMHVRFNEFIKWASANYDLVLL
DTPPILAVTDAAIISRHAGTSLLVARFEVNTLKEIEVSIRRFEQNGAEIKGVILNAIVKRAASYYGYGNYNYYAYEYKSE
K
>gnl|bykdb|A0A0M2KCW3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Erwinia tracheiphila] (length=727 residues).
MNIKSKASSASQEESTGWDLTHIVGQLVDHRWIIVAVTALFMLLGTLYSLFATPIYSADAMVQIENKNVNAVLNDLQSLM
PNAQPMSATEVEIVTSRMVIGKTVKDLGLDAFVQQNYFPVIGKGFSLLSGNKPGQLIVTQLAIPQDWENPELSLEVTGAD
SYVVSKDGSTLFKGKVGQLENHAGVTMKVNSIEAVKPGTQFTVTKLTDLQAISMVTNNLTVEDKGKDTGVLGLEYLGEDP
VQISKVLNQIVTNYVDQNIERKSAEAQKSLEFLKTQLPSVRAKLDDAEDKLNTFRRQNDSVDMSLEAKSALDSSVNIQTQ
LNELTFREAEVSQLFTKDHPTYRTLLEKRHTLEDQQKSLNKKIGQMPQIQQEIVRLTRDVQSGQEIYMQLLNRQQELDIS
KASTVGDVRIVDPAETAATPVAPKQLLVILASMILGMVVSVGITLVKALFHHGIERPDELEERGINVYASVPLSDWQRKH
DSEVIARRGAHSKTDPANSLLALGNPADISIEAIRNLRTSLHFAMMEAKNNILMITGASPGIGKTFICSNLAALVGKANQ
KVLLIDADMRRGYTHELLGASNKIGLSDVLSGKAALGENMIQRGAYCFDFIPRGQVPPNPSELLMHSRMNELLHWASTNY
DLVLIDTPPILAVTDASIIGKLVGTSLMVVRFETNTLKEVEFSYRRFMQNGIEIKGVILNAVVRKAVNVFSYGYDYYDYS
YKQDAKS
>gnl|bykdb|A0A0M2LSE3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. Ag1] (length=722 residues).
MTGAAFSKQPVPEPASMPMLRQYLRMVMRWRYVILSIIAACILLGLIITLLMTPKYTATASIEVLRESSKVTDIQGVERE
ASLADQEFYQTQYGLLKSRSLSERVAQQLKLVDDPKFFDQFGAAADTPAFNVVNGRYPAGGRLERQRVAGKVLRDNLSIT
PTRLSRLVDISFTSPDPTFSAQVANAWAENFIQTNLERKVQATSYGRNLLQRQLAQAKERLDASQRQLVNYASAQQIINL
PAQSGDGRATAERSIVADDLATLNAALSQAVAERIQAEARFRQAGAAGASTEALRNTAINNLRQRRAELAADYQRLMVQF
QPDYPAAKAVQSQIDQLDRSIAREEGRVSGSLEADFREARERERGLQNKVDALKMSYLDLRRRSIQYNIYQQEVDTNRAL
YDGLLQRFKEIGVAGGVGINNISVVDIADSPQKPSSPRLLLNLLLSLLVGIGLGAVTAFALEQIDEAIADPAEVERRLGL
PLLGSVPKVDGSTPKEALLDRKSDLFDAYLAVQTSLAFTTENGIPRTFAVTSTRPAEGKSTTALALATTLSRGQRKILLV
DGDMRSPSIHQMGGVDHDRGLSNFLAGDDDIATMLFPMQDLGFMAMSAGPIPPNAAELLTGNRLAVLVERLLEQYDHVII
DSPPVMGLADAPLIASRVEGVIYAVESHGIRSSLVKTALNRLVSANARIFGGVLTKFEARKAHYGYGYEYGYGYGRERDE
KA
>gnl|bykdb|A0A0M2RJ51 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas stutzeri] (length=738 residues).
MTTMPRPIYETKEDKDIDLAHLFDTFINNRLLILGITGFFAALGIAYALLATPVYLASAMIQIEPKNGLPSLTDVVNTNP
PVSPAQTEIALLKSRSVVGGAVASLNLDIQITPHHFPIIGGFMARRFEPSEEGELGWHPAGLGAYAWGGETLKVTQLEVP
DKVHGKELTLEAAENNGFILRDEDGEVVVQGVVGEPVETEDYRVTVAELNARPGTTFTVVKNRTYNTTESYQQRLSAAER
GKQSGIVNVTLEDPNPEHAIRVLEEVASRYVDQNVARNAAEATQSLEFLNEQVPAVRKKLEAAQTALNKYQTGSGSVDIT
AETQSVLDRIVDLEKQISEQNLKRTEMERRFTRQHPNFQALMNQINQLQMQKEELEKQIGTLPSTQQELLRLTRDVEVSS
ETYSMLLNKTQELDIIRAGTVGNVRIIDHAAADLENPVKPNKPLVVIVATLLGALLATAFVYVREALKRGVENPEDIERT
GTPVYASIPFTDKQAALEKRLANFKRDKSTASYLLTINDPADLATEAMRSLRTSLHFAMIEAKNNVLMITGPSPAVGKSF
VTTNLAAVVAQSGKRVLLIDADMRKGYLHKVMRCDGDKGLSDILSGRITLFDAIQKTQLNNLHVITHGQLPPNPSELLMH
ENFSRFVKEISHMYDLVIFDTPPILAVTDAALVGSQAGTTLMVTRYALNGVKEIEAAKRRLEQNGLIVKGVIFNAVVRKA
STYGEYGYYQYEYASTSK
>gnl|bykdb|A0A0M2RKE3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas stutzeri] (length=736 residues).
MTALTRSSLEYDADNRIDLAGIMRTAYDHKALIITITGFFAALGVLYALIATPIYQATAMIQIEPKKAAITGVPEISARP
DSVSQAVTEISLLKSRAVLGRAVEELKLYIVAKPHHFPVFGAFMARKHDPATDGALATPLFGLTGYAWGGEKLEVFQLDV
PEAYLGVELTLIAGTAGSFTLHDDEQQLILRGQVNEAVENQGFKVQIAQLEARPGTEFQLVRNRPQTTALDYQNRLKVGE
AGKDSGIIYMSLEDPDPQLASHVLDEISRLYVSQNIQRSSAEAAQRLDFLRSQLPQVRKELEKAEAALNAYQTSSKSVDI
SIETKGVLDQIVALETQISELSLKRVEYDRLYTREHPTYRTLITQMNELQTQKAQLLKKVDALPMTQQELLRLQRDMEVT
TQTYTLLMNQAQEQDILRAGTIGNVRIIDNAYSMIEKPSKPVKPLVVAIAIFVGLLVSAAVILLRQAFYRGVESPDVIEK
LGLPVYAGLPYSASQDQLNRSRKSRDGKTRLLSLTEPTDLAVESLRSLRTSLKFAMLEARNKVLMITSPTPSVGKSFVSS
NLAAVIAQTGQRVLLIDADMRRGYLHTLFGMAPRHGLSDALASGLNLAEITNRTEQKNLHFISAGFSAPNPSELLMHDNF
SRLLREAEKLYDFIIIDTPPVLAVTDAVLVAQQSGTNLLVARFGLSTSSQIDASKRRLAQNGVLLKGVILNAVKRKASTS
PYDSGAYGYYTYTQQA
>gnl|bykdb|A0A0M2V8R3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Arsukibacterium ikkense] (length=728 residues).
MQVDITRVDSASQAIQVIDLKKTINVIYRAKWRIMAFTLLCGALATFVLLNMAPVYRATSTLLLEANQARAIKIEEVYGF
NSSQQEYYLTQFEVLKSRSIAEQVFKQLNVASHFEYQPKPGWKQQLVALLPFLPQKAPVADPDYAAFLLHKRQLDAFVRN
VQITPVRRTQLVRLSFSSEDPRLAQAVADALGEAYINSQLDARLGMTQKASSWLGGRVTELRDKLEQSEFKLEQFRATHN
LVDVAGVTALDQRELERLNEQLSVARARKAETEGFLNLVQRFGRDDIRRLESLPEITSHISIQNVKREVLVTERKVSELA
KVYGPKHPRMISAQAELQSVQQNLTQQILRLIDGVEKEAQATAERLTALEQRFALARSRFSGLGSLESDYRRLEREVEAN
RLLFDNFMARQKETEVTGGFDAPIARFTDLATLPTVPEKPNKRLILLLVLIAASGVAIVMALVLDALNDTIKHLPDVEKM
LNQRALGFLPRSTKKATELVRARAYFDRSQRQHIEAVSNIRTSLSLLAIDKSLQIIEVTSSYPEEGKTSVSLNLAYAYAA
LERVLVIDADMRKPTLGSKLGLPSYQSGLANVLSGTEKLADCIVRDEQSGVDVLAAGAVPLNPLELLAGGAFEALLNTLR
ADYDKIIIDTPPVQLVSDSLLLAPMSDAVLLVVKADHTRSPALKNSIAKINQAHGNLYGVVLNQMDTEKAASYYGQYGQY
GYYGAEQA
>gnl|bykdb|A0A0M3A5Z9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter sp. Ag2] (length=731 residues).
MNQNSKTNDDTIDLKELFFSLIAQWKVIALCVILSLICALLYLRVTSPVYSTDAMVQVEDGKSAASAALMGELKDVAGGL
GQKSPADAEIEILNSRLVLGKVIKDLNLDIQIQDNADTFLHRLISKGKTKFTYTAQTVDFQKNQSSFSILKFNIPQYYDD
KQLVLKFLDKNQFSLIYQDQIVFKGNLNQLNQTQDNKGLWSVQINSSTPFQQDFTITKLALPTAVKFLQENYSVAEKGKM
TGVIGLNYNGNDQQHITQVLNHILGVYHEQNIARKTLESKQTLSFLDQQLPELKQQLEASEIKFNKFREQYNTVDVTQES
ELMLKQNVELEKMRIELKQKQAEYSAKYTPDHPLMTEINAQLAAIQKKMTDLNQAIKRLPETQRLYLQLYRDVKVNTELY
TSLLNSYQQLKIVKAGEIGNVRIIDTAVEPVKPIKPKKLIVLILSIFVGGFIGVLIALLRNMFSSGIKDASRIENELDLP
VYATVPRSPIQESRVQLLKKKKSIPILAVKNGEDIAIESLRSIRTTIHFALNNAKNNIIAISGPAPEIGKSFISTNLAAI
FAQGNKKVLLIDADIRRGYLHKYFDHDTAPGLTEYLTNQSTLEQCIVHSSSVNHLDFLPRGKNQGNAAEMLSSPRFSELL
SQLSQQYDHIIIDTPPILAVTDGIIISQFAGVNLVVARYAKTQMKELELTVNRFEQAGSKVNGIILNDVQATAGGNYGYN
YAYAYTSTKDD
>gnl|bykdb|A0A0M3AJ85 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter sp. AG1] (length=729 residues).
MSQNTNTEDTIDLKELFFSLIAQWKLIALFIILSLVCALLYLRATPDTYSVDALVQVEDSKGASAALLGDLSQMIDQKSP
AQSEIEILKSRLVLGSVIQALHLDLNISSTEDNLRNRLLKKPHYTTEYNPQSIIFKDNTKQFEVRDFLIPSQFLDKGLTL
NFKDQKFFLIDPKNDQVIFTGILNQPNSTQNKYGSWKISVFTKDTLTSSYRIHKKSLPAAVNSLSSNYTVAERGKLTGIL
GLNYQGQDKQHITKVLNAILSAYSAQNVARRSAETAQTLKFLDEQLPELKKQLDNAEREFNRFRQKYNTVDVTKESELYL
TQSITLETKRIELQQQQADLAAKYTNEHPAMREINAQITAINKQIGDLNSTLKQLPDIQRQYLQLYREVEVKTQLYTALL
NSYQQLRIAKAGEIGNVRIVDTAVEPVEPIKPKKLQVLILAIFFGGFLGTLIALLRNMLRTGIKDTGQIENEFNLPVYAT
VPRSPIQETRISILKKKKTIPILAVKHNDDIAIESLRSIRTAIHFALASAKNNVIVIAGPSPEVGKSFISTNLATIFAQS
NKKVLLIDADMRRGYMHKYFNLDVKPGLSEFLSHQADLNQVINATEVDGLSIITRGKSPTNPSEMLGSEQFELLLNQLSQ
EYDHIIIDTPPVLAVTDGIIISQYAGVNLLVARYAKSQMKELELSLSRFEQANVKVNGFILNDIQRAGAGAGYGYGYNYS
YAYKANKDD
>gnl|bykdb|A0A0M3AQI5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingobium chungbukense] (length=720 residues).
MAGDAKATPSVDRDTFSLAQLLTRYWQAVVRWRLLIAGLVAGAVIIGLVVTLLMAPLYTARSQIEVSRERKNVTNVEGLD
SAGEGRDVEFYATQYALLKAESLSERVVRELGLAETSEFFEAHGKKPAELIGFPDNSPETKKARVRQAVALLQQNLDISP
IRGSRLIDIKYTSRKPEISARIANEWAQQFISSTMDRQFAATADARKFLETRLAQLRHKLEQSERDVVSYANNKGIVTLD
ATRDPEGRTFTQRTLASANLEALNQALTQAEAERIAAESRANGSAENSPEVLTNQAIVDLRARRAQAAAEYAKLILQYEP
KYPAARALKAQMATLDAAIAREVERISGSRKLAFTEALKREQDLRAKVEALKQVLNDQRQASIQQNIYQRDADTNRQLYD
ALLQRYKEIGVAGTVGASNIVIVDAAKVPQSPSAPNLMLNIALATLAGIALSAAAVFGLEQIDEGIREPGEVRTALGTAL
LGHVPLGEEATIAEISDPKSELAEAYFSIRSSLAFATNHGLPRTIAVTSTKRGEGKSTSSLALATVIGRTGKRVLLIDGD
MRSPTLHRHFGTDHKEGLSNLLAGEPLLDQVKATGERGLSVLTAGPIPPSPAELLSSDMFREIIARFLESYDHIIVDTPP
VLGLADAPLIGRQVEGVIYVVESASTSRRAAQAALQRLEAVNAHLFGAIVNKVDYSKHGYGYGYGYGYAYGRTAEVGEAG
>gnl|bykdb|A0A0M3AWD8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingobium chungbukense] (length=704 residues).
MAGPGLLIDADGASATMEGRAARFAAAANGAWVAVRRHRIILFVTMALCVLAGVVFILLSTPDYRATASVEVEDIPAGAA
GAAAAQRQATPSDNEALMQTELEVLRSRALAEDVARELALVGSRTFFDGMDVRRPDRGAGSLSQRQVETEMVVNLLRDNL
HVELPGKSRVIRISFTSADPILSARVANSYADSLIRADLKRGFESGVQARRFLLGELDGARKDLERAERDLAVYAANAGA
MAPLGTQEGEGGDSPPEGTTATRLAQLNAFRAQATADRIAAQKRWESARLSSVETLPEVLNNGAMQQIMTERAQARAQVV
QERQFRKDAHPEMREARARLAALDDQAEGMANTIRASLKEQFDVAVHGEKQIRSEIAKVERQAQAERGRGVQMSILERQV
DTYRLLHDSLLQRYRDMASQAGFQAGRIQPLDRAAVPSRPSSPNIGVTMLLASLGGLVLGLLAVAGRHIFDDAVTSADTL
AERVNLPLLGAVPAGEKPATEIFAPIASSLLLGSAAGLPRSILVTSAQEGEGKSSTLHALAKALAKLDKRVLVIDADMRR
PKQHSLFGIAPHRGISELMTGQAKMDEVIVDSGVPGVSLLPCGAIPPSPAELLITPAMDSLLAAVRERYDTVLIDAPPIL
GLSDASLLAAKAQVTLLVVEWGRNHHGGLRVAADRLRRAGGAIIGAILTKQQGRAFEYDYHRGG
>gnl|bykdb|A0A0M3BGW5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhizobium sp. LC145] (length=778 residues).
MDQVNFRSRAVFPSEPRENDTFIDLDKLWAAAVRRAGVIAACVGAAVVLAGLYLFMAQPMYSAMTQILVDDDLSRYAEEE
QNAQTSQQIDNRMSSAVEILKSKALALRVVDDAGLAENELLVNPPQSPAALVKGSIKSIVSLLTPGKPPVSEEAARAGRR
EMVAAVLQQSLTVERVGRSSVIAVSIRSPDPQLSAMMARTYASSYLEEQLNANFDATERASVWLQERLNDLNTRSQEAAM
AVEKYKIEKGLISPRGELLSSQQLSDLNSQLIVAQADAATASARYNQYRAIIDQGPESAVNNAVVSSRDADNSVLQDLRK
RYTAITEREQGIIQQFGADHPQAVALKGEKNDVSNQIYRELQNLTGSFRNEYEVASSRERSLRESIDRVAGHNSEANVEM
VQLRELEQKAAALKTLYESYLGRFEEASQRQSFPIAKARVISDAGVPTAPSSPRKTMTMALSLVLGLMAGGALATLLEFR
ERFFRTGQDVQDKLGVRFLGYLPLIGGQQTAETPGTSAKEETDEARLPEGDPISLRKMMRISVDAPRSSFAETLRNTKLA
SDIVLQGRTCRVIGVVSSLPGEGKSTVAANFAGLVAASGLRTLVIDGDLRNPGLSRMLATEPQVGLVEVILGETPWTSAA
RVDRRTRLTIMPMTSRSKKLAHTSELLASQGMSKFLETVSEKFDVIVVDLAPLVPVIDAKAFAHHVDGFVFVTEWGVTPA
KTVQNVLNSEPQIASKLIGVILNKTDMEDLHRYADPGAPERFRERYLSYYGEEASLKG
>gnl|bykdb|A0A0M3BZK9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter pittii] (length=727 residues).
MNQNTNTEDTIDLKELFFSLIAQWKLIALCVILSLVCALLYLRVTPNTYSVDALVQVEDSKGASTALLGDLSNMIEQKSP
AQAEIEILKSRLVLGSVIKDLHLNIQVSSTENTFTHRLLSDSDYKTEYTKSSVTFKDGSKSFEIRQFEVPASYNDKNLLL
NFDKQSLRLIDPATEEVVVSVPLNQLNQVAGPQGTWKVAIFTKDQFDTTYNIKNLSLPAAVNAVSSNYTVAEQGKLTGVL
GLTYQGQDKEQITKVLNAILATYSAQNIERRSAESAQTLKFLDEQLPDLKKQLDDAERQFNKFRQQYNTVDVNKESELYL
TQSISLETKKAELEQKQAEMAAKYTAEHPAMREINGQLAAINKQIGELNSTLKQLPDVQRQYLQLYREVEVKTQLYTALL
NSYQQLRIAKAGEIGNVRIVDTAVEPITPIKPKKFQILILSIFLGGFIGTLIALLRNMLRTGIKDSSQIENELDLPVYAT
VPRSPIQESRVKILKKKKSIPILAVKNSDDIAIESLRSIRTAIHFALTNAKNNIIMIAGPSPEVGKSFISTNLATIFAQG
DKRVLLIDADMRRGYMHKYFDIDVKLGLSELLSGQADFQQVLHKTQVANLDVITRGKSPTNPSEILSSTQFKDLLETVQS
QYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSQMKELELTLNRFEQAGVKVNGFILNDIQRASAGYGYGYNYAYA
YKAQKED
>gnl|bykdb|A0A0M3DXH3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Afipia massiliensis] (length=770 residues).
MLQRSSDYELQALDGPAGAATGRWQQPTVDLREMARILRRRWRMVAAAPLSLIVLALMYLTAVSTLYTATSTVLVDPRRA
NVVDTSQTVLSNFGTDDATIESQALLIQSVAILQRVVDKLKLTADPEFRPKPGLLDPVRRLFSSSGPASGASPEDAAKAR
SVEILQRRMKVTRQGTTFLVDISVSSEEPRKSAAIANAIAESYFEEQVRAKYDATKIAASWLNGQIEGLKTRVVASEQAV
EDFRAANNLSVAQGVTVNDQQITDLNNKLIAARAQTAEARAKYDQVQRLAKSGSDPGGINAAITSEMITKLRTQYADIAK
NEADLSSKYGTRHPLVANVRAQLKDTQRLIDEEIRRILDSTQHDYDVAKSREASLQQSLDQVRGVSSSSGQALVRLHELQ
REAEANRTLYESYLARYKETSAQESLEMPDSRVVTKASIPIRPSSPKSMLILGLALMIGVGGGCIVAFLADYLDGRIKTL
EQAESVSGVPALAAVPLIGTRELAARAKRGRDELGRYDPRTVRLLPPALQPPLMRYAIDEPGTFFAEAIRAVRLAIQRTM
RIQPLKVVLVTSALDNEGKTTLAANLALSLATLGIKTLLIDGDLRNPQLTRALSPHANAGLMEVATGEVSLDRAILLDRS
SGLSILPSPAVKDVDVITELMFSERIVDILDHLRQHYELIIIDSPPLVPLVDGRALAEISDRIILAMGWDQTPQEVITHT
VNLLSPVYDKILGTVLTRVDLSRLRFYDYYRSSAYLKPYGSVALKPGPAE
>gnl|bykdb|A0A0M3E5A5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio parahaemolyticus] (length=720 residues).
MTEKVKQSAAPVTGNDEIDIGRLVGTVIEARWWVLGITAVFALCAVIFTLFATPIYSADALVQIEQNTGNSLVQDIGSAL
SNKPPASEAEIQLIQSRLVLGKTVDDLDLDISVTKNTFPLFGAGWERLMGRQNESAKVTTFTLPKGMNEQTFTLTVLSDK
DYQLTSDGGFSARGQVGQTLSKDGVTIVVSEIHARPDTEFTVTKFSTLGMINNLQNNLTVVENGKDTGVLSLSFTGEDRD
QIRDILNSITRNYLEQNVERKSAEAAKSLAFLAKQLPEVRQHLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLFTKAHPAYRTLLEKRQALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITE
ASTVGDVRIVDPAIAQPGVLKPKKALIILGSIILGLMLSIVGVLLRSLLNRGIESPQVLEENGISVYASIPLSEWQKARD
SVKTIKGVKRYKQSQLLAVGNPTDLAIEAVRSLRTSLHFAMMQAQNNVLMLTGVSPSIGKTFVCANLAVVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILVGKGDIASCAKPTSIPNFDLVPRGQVPPNPSELLMSERFAELLRWASSHYDLVL
IDTPPILAVTDAAIVGRHAGTTLMVARYAVNTLKEVETSLSRFEQNGIQVKGVILNSIFRRATGYQDYGYYEYEYKSDTK
>gnl|bykdb|A0A0M3F7I1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Enterobacter cloacae] (length=733 residues).
MSSKTVNQSGYGMETQELDLARLLSELIDHRVCILSFTLLCATCGLLYALFASPVYIADAIIQIEQKQQNNLLKSITQLS
GDASPDSTAEIQLLKSRMILGKTVDDLRLRDEIVPVRFPLIGNGLARLTGQETPVLKLDWLMLPSRHSPLTLTAGKNGEF
LLEGIDINVHGTPGKLVQKAGVALRVRELRAPVGTRFKISQKTQLEAINVLSKRFSVVEKGKESGVLELSLTGPERGAIA
ATLNQIANNYLQQNIDRQAAQDSQSLAFLKRQLPKVRGELDEAEGRLNNYRKKRDSVDLSLEAKSVLEQIVNVDNQLNEL
TFREAEVSQHFKKDHPTYRALRDKRATLEKERERLNKRVGTMPSTQQEILRLSRDVDSGRAIYLQLLTRQQELDISRSST
IGNVRIIDSAVAQPDPVQPRKGLIVVLATLLGLLISSGGILARSAIRQGIISPEQLENQGITVYATLPRSEWLSSKTHLR
SFDFWRNRTRHKIVNVPFLPVDKPLDIFVEAIRGLRTSLHFAMMDADNNILMFSGPSQDCGKTLVSTSLAALVAQIGGRV
LFVDADMRKGYVHNIFALQNERGLSELLSGKIAFDEAVQTYEDGHFDVVTCGYYPPNPSELLMHSRFKAFMHWASENYDM
VIVDTPPILAVTDAAMVGRMAASTLLVARHNITSVKEMVTSVRRLEQMGVNIKGAILNDVVKSLVNHYSTGYDAYAYTAS
KSKDPQHSKTAHP
>gnl|bykdb|A0A0M3F8Y7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Enterobacter cloacae] (length=720 residues).
MTEKVKASSASTAGSDEIDIGRLIGTVVEARWWVLGTTAVFALAAVVYTLFATPIYSADALVQIEQNTGNSLVQDIGSAL
ANKPPASEAEIQLLQSRLVLGKTVRDLGLDIAVSKNTFPVFGAGWDRLMGRQNDTVKVTDFSLPKGAADQVFTLEVLGPK
QYQLTSDAGFSARGEVGQLLSKDGVSIKVNAIQAAEGSEFTVTKFSTLGMINNLQNNLTVTETGKDTGVLSMTFTGEDKD
KIRDILNSITRNYLEQNVERKSEEAAKSLAFLAKQLPEVRASLDEAENKLNAYRQDKDSVDLPLEAKSVLDSMVNIDAQL
NELTFKEAEISKLYTKRHPAYRTLLEKRKALEDEKAKLNNRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITE
ASTVGDVRIVDPAITQPGVLKPKKALIILGSIILGLMLSIVGVLLRSLFNRGIESPQVLEENGISVYASIPLSEWQKSRD
SVKTVKGVKRYKQSQLLAVGNPTDLAIEAVRSLRTSLHFAMMQAKNNVLMLTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEVLLGKGDIENCAKPTSITNFDLVPRGQVPPNPSELLMSERFTQLIAWASKHYDLVL
IDTPPILAVTDAAIVGRHAGTTLMVARYAVNTLKEVETSLSRFEQNGIEVKGVILNSIFRRATGYQDYGYYEYEYKSDSK
>gnl|bykdb|A0A0M3GJL6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhizobium phaseoli Ch24-10] (length=757 residues).
MLSPDKLTPRIDPSRDTGNEADFIDFDKLIAIARRQWRIVAACAFAFAILGIVYVLTAVPVYTADTSVLIDRSDNQVINQ
LAAFGQLDDDEGTVLSQVELLKSDTIAYAVVDKLKLVDNPVFNAPKNSLFSVATLKSLVNFRSWFADDAAVAPDPQAKRR
AAAETVAGNIDVERVGKSYVLDVSYTSQSPDLARDIAAAIADVYMVDKLNSKYEATRRAGEWLQERIEELRQQALDTDLA
VQKFRSEHGLVESGSGTLLSEQQLSELNSQLITAQAATAQAEAKYARIKSIIQAKQTDAIVTDVLDSSISNDLRKKYLEA
SKLEAEIEARLGPDHVQAVRLRAEMAEYERLMFDELNRIAESYQSELQVAQSREKSLRDSVDQATGVAATAGETQVQLRE
LERTRDTYKNLYQNFLTRYQEAIQQQSFPITAARIITIAETPTKPSAPKRSLVVAFAMFLGCAFGSGIGAFREFRDRFFR
TGDDVKDMLDVESLGVMPLIENNVEDPTLVDPGNPRSIARGGKTTTYVEEHPLSAFAETLRSAKIAIDISAADQRCKVIG
VVSSLPGEGKSTTAINFAKLLAMQGARCLLIDGDMRNPGATRAIGRHAEAGLLEAIVDNRPLKDLILLDPKTKLAFLPTV
ARYRVPHSSELLASRGMDQLLEMARQSFDYIIVDLPPLAPVVDARAINPKLDAVVFVIEWGKTSRKVVQSTLLSEPDLYT
KCVGAILTKVDPSQMKLYRTFGSSEYYYKRYSRYYTE
>gnl|bykdb|A0A0M3H320 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella aerogenes] (length=719 residues).
MSSVRNKTAVTDSDEIDLGRLVGELIDHRKLIISVTSLFTLLALVYALFATPIYQADALVQVEQKQGNALLNSLSQVLPD
SQPQSAPEIALLRSRMILGKTVDDLNLQAKIEENHFPIFGRGLARLLGNKANNIAISRLYLSIPGEDVPEVEVQVLDKNK
FSVTGEGIELTGTVGQLLEAKGISLLVSEIDAEPGTTFTVSYISRLKAITNLQDNLTIADEGKDTGILTLSLTGDDQTQI
KNIIDSISTNYLAQNIARQAAQDAKSLEFLSEQLPKVRSDLDLAEDKLNGYRQQKDSVDLSLEAKAVLDQIVNVDNQLNE
LTIRESEVSQLFTKEHPTYKALMEKRKTLQEEKNKLNKRVSAMPETQQEVLRLSRDVDSGRAVYMQLLNRQQELSIAKSS
AIGNVRIIDNAITQPKPVKPNKVLVILLGIVIGLLISVGLVLARVVLRKGIESPEQLEELGINVYASVPVSEEFAKRVER
SSKWKNKNRDEAAVFLAIENPADLAIESIRGLRTSLHFAMMEARNNVLMITGASPNAGKTFISSNLAEVIAQTGKKVLFI
DADLRKGYTHKLFNTENNNGLSDILSGKSSIEKAVQKISKIGFDYISRGMVPPNPAELLMHKRFGELIAWANEHYDLVVM
DTPPILAVTDAAVIGNYAGTTLLVARFEQNTAKEIAVSIKRFEQSGVNIKGCILNGVVKKASNYYGYGYNHYGYTYTDK
>gnl|bykdb|A0A0M3RLA1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter sp. TTH0-4] (length=727 residues).
MSQNSNTEDTIDLKQLFFSLIAQWKLIALCMILSLVCALLYLRTTPNTYSVDALVQVEESKGTSAALLGDLSSMIEQKSP
AQAEIELLKSRLVLGSVIKTLNLDLKISGTENGFFDRLFSPHNYQTSYNPKFVAFKDDAKSFDIRQFEIPSYYLDKNLLL
EFKDKQFTLTNSTTDQIVLTAPINQASQLNSEYGTWKVAIYTQSALKDTYHIQKMSLPAAMNSITSNYSVAEKGKLTGIL
GLNYQGEDKQHITKVLNAILVAYSQQNIERRSAETAQTLKFLDEQLPELKQQLDVAEREFNKFRQQFNTVDVTKESELYL
TQSVTLETSKIEIEQKLAEAAAKYTGEHPVMQQMNAQLTAINKKIGELNSTLKQLPDLQRRYLQLYREVEVKTQLYTALL
NSYQQLRIAKAGEIGNVRIVDTAVLPIEPIKPKKLQILILALFLGAFLGTLFALMRNMLRSGIKDSSQIENELDLPVYAT
VPRSPIQENRISILKKKKSIPILAVKNSDDIAIESLRSMRTAIHFALSTAKNNIIMISGPAPELGKSFISINLATILAQS
DKRVLLIDADMRRGYMHKYFNHDAQPGLSEYLSNQQGLDQIIRSTHVKNLSSMSRGKSPVNPSELLGTSKFAEMLQHLSS
QYDHILIDTPPILAVTDGIIVSQYAGVNLVIARHAQTQIKELELTVNRFEQAGVKVTGVILNDIQRTAGSSYGYNYAYAY
TANKDND
>gnl|bykdb|A0A0M3T9R6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Altererythrobacter epoxidivorans] (length=736 residues).
MNEAKHIGPGGGKSEFWLDRFLPNSNADGGQNRALTLPALKGFLYRQRYVMAVTFALVILAALFATLLMTPIYKAASTVR
IEPYGNNIVEGQDLAPVVPANEIGRYFITLGNVVESRNLAYRVADSLKLTERAGFLPEGMDGAKPNGADERAWERQKRET
VVDMLQGGVTAIVPFDSRIMSIEYRSPDPVLAAEIANAYADNFVLDDMRRSLDANAYAQDYLQEQIADVRGKLQDAELAA
NAYARKSGIVKPLATGGIDEAESEAATITASNLISINQNYTDARARRIAAEQRWRTVSGLPAAQLPGVQQSQVVQALVEQ
RSTKAAELVDLQQRYDDNYPTVVEARAQIAELDRQIARTGSEIKASVRNEYDIARRQEQALAAEMKNVTGESLAEQDRRV
QYNLLDREARALRGQLASLLARFNEISTAANVKEGSITKLDAAIVPTVPVTPNLWRNMLAAIAIGLASAFGLAILREIFD
DRLRTLEEVEERLGLPLLGHTPFIENENLREEIAQPFSALSESYASIVSSIEHALPADSRVLQFTSSQASEGKSTTSMVV
ANQFAQLGYRTLLVDADLRRPGLSKLIADKRPEKGFADVLKGEAALADVQLQGTAERLTVLPGGKAPDNPVELLSSDLLT
KFLDEQGEHFDRIIFDSSPVMGIADAPLLSRHVDATVFVLEANAIDQSQARTAIRRLLHAGAYIPGIVMTKYRALLAGQY
YGYEYQYYTYREAAPA
>gnl|bykdb|A0A0M3TVH7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia sp. HB1] (length=732 residues).
MTGPIRTEEEDVVLGQLVQVILDDIWWLIAIAAAVVAIAGAYCVLAKPIYSADAHVRVEQADNTSQALTQTQTGAAITSG
SSSLPTDAEIEIIKSRGVVAPVVEQMKLNFSVTPKTLPLLGSIAARVATPGEPAKPWLGLSSYAWGGEVVDVDSIDVLPA
LEGQKLTMKALDGGRYELRAENGALLLRGQVGQQAQGGGVTMLVSKLVARPGEEFTVMRANDLDAISAFQSAISVQEQGK
QTGVIQISLEDKNPEHAALVANALAQSYVRQHIANKQSDASKMLDFLKSEEPRLKSDLERAEAALTAYQRQSGSINASEE
AKVYLEGSVQYEQQIAGLRLQMAQLTERYGDDHPMLKAAREQMAELQAQRTKYADRFRDLPATEVKAVQLQRDAKVAEDI
YVLLLNRVQELSVQKAGTGGNVHIVDAALRPGSPVKPKKALILSAATILGLIAGTGFVFLRRNMFKGIDDPEHIERAFRL
PVFGLVPMSAEQTLLENGFARGGERLRSVLANARPKDVTVESLRSLRTSMQFTIMDAKNRIVMLTGPMAGVGKSFLTVNL
AVLLAHSGKRVLMIDGDMRRGVLERYLGGTQENGLSELLSGQISLEESIRASEIENLSFISCGRRPPNPSELLMSPRLPQ
YLDALAKRYDVILIDTPPVLAVTDASIIGAYAGSTFFVMRSGMHSEGEIIDSLKRLRGAGVHVQGGIFNGMPARARGGYD
RSYAAVQEYLST
>gnl|bykdb|A0A0M3TY66 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia sp. HB1] (length=750 residues).
MNEFSPKSQAAGSGQNDVNLVRYVDVVLANRWLVLAITSMVLAIGVAYSFLAPPVYQSDILLQVEQESPTNTKSLLGDVS
SLFDVKTETTAQIEVLRSRMVVGNAVDNLRLYISAEPKRFPLIGNWIARWNKSLSQPGLLGVGGFAWGNESIDVGTFDVP
EDLEGDDFKLTSLGGDRYVVDQKQLDAPIYGRVGETIVSNESTGKITLRVQTLNANPGTEFVLVRNARLKTLENLQDKLF
IVEKGKQSGIIGASLTGTDRQLTAKILNNIGDEYVAANIARKAAEAEKSLAFLSDLLPQLKSELEESERNYNALRIKRGT
FDISEEGKTYLRESVELQASALALKQKRSELTALFTSEHPSVRAVDQQLASLSAKEAAVSQRMTSLPELEQESLRLMRDV
RVNNDLYVGMLNNMQQLKLVRAGKVGTVRLLDRSLVPKEPIKPNKPLLIAASAVLGLFLGIAATFMRHILRGGVTNPQDI
EQETGLTVYATVPVSRTQATLEHDSPERSEGLLLLASHSPGDPSVESLRSLRIVLQLSMLEAGNNRVLLTGPSEQIGKSF
LCANLAAVMTGSGKRVLLIDADLRRGHLNDYFGKESQPGLADVLTSNATLDEALQRNVAPGLDFLPNGTTPSDPAELLMG
DAMARLLESVGDSYDMVLIDTPPVLAVSDAAVVAHRCGTVFLATRFGTTSVDEVRESVKQLRHANVEVKGVIFNAFHPAA
YRYSLGSHAGRNRYLSYQYATASSDSKSSN
>gnl|bykdb|A0A0M3UE18 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas versuta] (length=742 residues).
MQQAPVTKPHDQEDDSDDIDLMGLLGTLLDHKWLIAGVTGAFMAAGVAYALLATPVYQANALIQVEAKKNDPLGFSDIGS
MLGKESPSATEIELIKSRTNIGAAIDNLQLDIEVEPNYFPLIGEFIARRFTPSAENNVASPLLGMNSFAWGGEQLKLAQL
ELPKELLGEELSLVTGEAGSFSLFDEDNNLLIKGQVGQSYSQNGISIQVEVLKANPGTTFSVTRYPRLTTILRYQKVLDV
SERGKESGMIGIALESEEPDIAINTLNEIARLYVQQNIERTSAEAAQSLGFLKDQIPQVRKDLEKAENALNQFQIRSKSI
DISLEAKAILDQIVALDTSISTLKLQQAEMDRKFTPQHPAYRALMGQLAELTGKQQRLAKQVEGLPTTQQELLSLTRDLK
VSTEIYTQLLNKSQELDVMRAGAVGNVRLIDTADVDLRNPVKPKKALIVLMATLLGAFLAIGYVLFRKALNRGVQNPDDI
EKLGLPVYASIPFSSLQKVEDEKSPGGRGTRITPLLASSHPTDLAIEGLRSLRTSLHFAMLEANNNRLMISGPSPKVGKS
FVSANLAAVIAQSGQRVLLVDVDMRKGYIHKMFGIPVDNGLSDLLAKRCDLDTATHKTDIENLDVIGRGQVPPNPSELLM
HKNFSEFLDQISARYDQVILDTPPFLAVTDAAIVGRQSGTNLIVTRFELNPAREVELTMRRFAQNGIELKGAIFNGVEKR
ASAKYGYGAYGYYNYEYKSDSV
>gnl|bykdb|A0A0M4CY69 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingopyxis sp.] (length=733 residues).
MIGIDRQMNEIVRGPVVSVDPAAVHREDGERQYATSLPEIERIFAAIISHRNWVMAVIIGTLLLGLLATFLTTPEYTSTA
RIEVLPDAPVDTSVEEQRDRSAINEIAFYNTQYSLLKSESLAERVVRAGNLTADKAFIDAFDLEVSDGGMTSAERRSLTD
KAVTALLDHLDVSPVRTSSLVDISFSTPSPTLSAKLADLWVTQFVQATIDRRFAATSDARKYLEARLETLRKNLESSERA
LINYSVSKGIVTVASETDTSGRTRTQTLVGSDIIQISQALAKAREARIAAEAELANTMTGVAQVNAPTISALRQKRAEAE
AELARMQTVFADDYPAVASLRSEIANLDQSIRAEVGRSSEGNREAYNAAVKRERELEAELDGLTSRYNSQQRESIEMAIL
QREVDSNRQLYEGLLQRYKEIGVAGVGTNNVSLVDRAKPAERPSSPRLLVNIAVSLLIGMALAAGLVFVLEKMDSSIRDP
QDVLPRFDLPLLGAIPEVLSTPIVDAIADKKSAIYEAYFSLMTNLTFLTEHGAPRAIMLTSSRPKEGKSNSSLCLATVLA
ATGKSVILVDADVRNPSLNRYLDIPNQRGLSHYLSGDDDLDGMIAELPNFGFSIITAGKMPPNAAELLGSERLGTLITEL
LNRYDHVLVDAPPLLGLADAPLIARRVEGVLFTIEANGTKNRAIATALNRLRMSGAKLFGAIVTEVGARNQVYGYGYGYG
YGFSYGAARSGDE
>gnl|bykdb|A0A0M4M6K3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Altererythrobacter epoxidivorans] (length=720 residues).
MESAKDNAPNGTAEYTPYREGIGGFHFDPERLWAEAVNLRYWILGIIALGLLGGLIATLLSTNLYRATSRIEIQRTTVSA
TDTDPLDPDATGSERQYFNTQYELLRSRSLAGRVVDAGNLARDRNFLEAYGLDEGINPNSRALESILLTGVNPEPVRQSG
LVDISFSSPSPQVAQKVANLWAQEFLAANYEKRFGANIEARDFLQEQIGELREKLAESERELINYANDNGIVIVSGGGSG
EESGYETAGQSLVGSELETLNTALAEATSKRIEAEAALRAGVNSGKGTNTTSLRQQLATAEADLSELRSRFGPGYPAIQA
KVAEIESLRSSLANEGGLENRDARAAYNAALMQEQKLRDLMQQAKNSYLGQQGQSIQYGILKREVETNRQIYDALLQRFK
SLEAAGAGKNNMTLIDAAEAPRSPYSPSLAFNLFVGLGIAIFASGLLVFLREALDQTVRDPADVRDRLGLATLGLIPKIE
TDEAGLVEELAQRSSEVGEAYASARTNMAFLTTHGAPRSVMLTSTRPNEGKSLSTMALARSFAQLGKKVLVIDADLRHSG
LHDFVGISTEGSVGLTGLLTGGGTISSAVIHSEENGFDLIPVGHRPPNPVELLASGALREVVELAKQQYDHVLIDGAPVL
GLADALEVSKAVEGVVFVIEANGVSIRGIDNAIGRLRTAGAHIFGALVTKLEKRNAIYGYGYGYGYGYGYGDTPPEQPQT
>gnl|bykdb|A0A0M4NQ60 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia sp. HB1] (length=754 residues).
MNQSRALHEPANAEKDFDLAAILDVFLLYRHMMLWIFGTLCVLGLAAVLLSDPQYEADMVTQVDESSSASTASSLLGQDL
SSMLEVKSSADTEMQVLRSRLVVAAVVDELGLYIEAEPVRFPLVGRAIARASKGLSRPGLLGMGGYTWGEERAYVERFDT
PSGLIGSAYSLTVADAGAYRLSGPGLKQDVVGRLSATETFMTDDGPLTLCVGALHAAVGARFKLTRQSRLETIGKLQDSL
SISEQGKDSNVLRVKLRGADPLRITEVLNHLAQHYLEQNEARKAEQAARSLAFLRGQVPGLRDRLDSAEKAYAVIRSKFG
SVDLEGEAKKVLQLAADNEIQVATLQQKKAEALTRFAPTNPTVMALDRQLAVLQSQSSGLNQQIDGLPEMQRQVVKAERD
VKISNDLYVGLLNNIEQLQILQVGRVGNVRVLDEALLPDRPVRFWRFLLCLAVIAVALLAAVGAAFIRDLLFHGISDSRE
LAERTGLDVLSVVPVARRGGFHWSGYFGRETRPRRPLAFIDPADPAIESLRSLRTALQFSLSDGGGNVVMFTGPSPNVGK
SFIASNVAAVVARTGKRVLLVDGDVRRCGLTRAYGCISAVGLSEVIADMGKLDASIRKLERSTLDFLPAGAMPPNAADHL
GSERTGDLFKALSARYDLVVVDTAPLLPVPDAAILAPYSNGNIFLVARASVTKAAEMEECMRRLQHVGVAVKGVVLNGID
RHAGRFRNGTTYGMYRYGRSRGEDARPMMDGAQE
>gnl|bykdb|A0A0M4PBE3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia sp. HB1] (length=744 residues).
MAINFENRYTDVSAADELHLSDYLRTIVRGWRTIATVTLIALALGCAYAFLAPPTYRADVLFHVEDKTANANANGKDSLP
PLTGMFDTKPSTAAEIELLKSRLVTEETVKKLHLDITATPRYMPVIGGLIAGLVNGQWGFKLPQFINLSGYAWGNESISV
SRFDTSKEMYDTTFTLVAGNDRSYVLRDRNGIAILSGHVGETVQTDTADGPIALRVDALTGAAGSQFELSRASTLSTVDR
LQKALVVQETTLQSGVIRASLEGGDSALTAAIVNSMAREFVRQDVASRSTEAEHMLAFLDQQLPGLRKELDEAEQRYNKF
RNTHGTVDLGEESRLLLQQIVDNKTKLLDLQTQRAEMSQRFTANHPAVASLDAQIAALQGAQVNMNRSVSVMPDTEQTAL
RLLRDVHVDTELYTNLLNSAQQLRVAKAGQVGNVRVVDFAEAPDEPVRPKRVIAILIALGGGLVLGIMLTFFKRAMYGGV
ERPDELEAVLGVPVFAVVPRSQTQLRLQEDVMLRRRGLHVLAQQAPEDIAVEGVRNLRTSLQLSLDHAANNVVMITGSRP
DAGKSFLSVNLAALVASANKRVLIIDGDMRRGDVHSHFGIGHQPGLSDVLSGGDLTSMIQRDVLPGLDVLAKGTLPSHPS
ELLMSSRFQTMLDELKSRYDLVIIDTPPVLAVTDSTLIGKHAGTTLLVVRHGRHPLNEIAETAKRLRNGGVGLRGVLLTD
VPQEGAFLGSGYQGGYYGYDSIAG
>gnl|bykdb|A0A0M4PU91 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia sp. HB1] (length=772 residues).
MDYYPLNSLPGTASTERGQLSASAMLRLMRDHIWEIVLTTVVVFSLAAAYLLIASPIYSADVLIRVDPPEPNALGLALQN
QENMPPPAPSPVTEMGVIRSRSVLEPVIQRFRFDVSVTPRKLPLLGDIAEKFATPGEPSRPWLGLKSYAWGGEQVKIGAL
DVPKDLEEEKMTLVARDDNTYELRGPQDQVFLQGTVGKAVSSNGISMRVDALVARPGTEFTVVRWNAVDAIKRFDALIKV
GDKVKDSGLVQIEYTDKSAAKAAEVANALGQQYLATAIASRQLNDTTTLAFINGELPRLLGDLRKAEEALKSFRANSQSM
QPTAEAQAYLQGGLDIDRQIATLQLQRTQLLERYTPQSRWVQSVDTQLAQLNSAKANFSGHFNGMPASERQSVDLLRAQK
VAETIYLGMVQKAEQLQVRRASTTGGAHIVDQAITPHRPVKPQPILVLPGGLALGIVSGIVLVFMRRHVLTGVTDPRYVE
RRMSVPVFGEILFSQQQSLLDRTSPGAKSLPGAAARAGLPQPVAGGASEIQVAAGGNRVLAERFPNDNSVEALRAVRTSL
ARDLAHARNNILMVIGPTPSAGKSFVAANIATLQAEIGARVLLIDADMRRGHLASLFNQSNRGGLSEVLSDRMPLRNALR
HTGIEGLSFLSCGSRPDNPAALLARPRFKEVLERLSAQFDLVIFDTPPFLAVTDASIIASEAGASLLVLRSGMQSEEEIE
DTIKKMERAEGRIAGAVFNGIPLRRSTRTYGYATNYASDYGDADPTSAPLRT
>gnl|bykdb|A0A0M4TDZ4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Psychrobacter urativorans] (length=741 residues).
MNTESNKFSKPIAENDNDEIDLLALLLGLLRGWKTLLLFAFLGLVIGVLYSRYLNPVFKSDALIQIDNKFQGVSALGSNI
SDLVSPDVSPAQTEAELIKSRMILKPVVDLLHLDIRLNDPTINKLDRIKNNRTDTQVNSPESVILDTEDGPVQIRQFNVS
QAYLNQSFTLVKSKTGFILSNGFDDFKGQLNQLNRFIGSDGIIQITVTDLPNDNHPITITKQSLQNTTDAINGALIVKEL
GNKTGIIQLSLTGSNQQQVSLILNQIILSYVGQNQSRGSEETTKTLTFMETQIPALKQKLEASEKVFNEFREKYGTIDIG
QEAGLLLSENSKIDSQINDLKLKKADLITYYTEDHPLVIQINEQLKVLNNKKQEIDDRVTRLPNIQREFLKLSEDTGINR
EIYLTMLKNYEQLKIVKAGQIGYARIIDSPISTYRAIAPNKKLIILLATILGTFLGATLVLLKNLLKSTVKDSERLETKT
GVPVIATIPSSPLLSRLSKNKKAPNRLLAYVDSNSLSYEAIKSLRTHLMFGMPKEGKAGQRAKVILISGESPGVGKSFIS
ANLAEVFGQLNTKVLVIDADMRLGELHKIFNMDQDNGLADYLSQKNDELQVDDNLADFIHSTSMDHIDFMPRGKHPHNPV
SLLAGDSFRGLMTQLNAYYDYIVIDSPPILAASDAIILSQYADKVLMVTRYEKSIEGQLVYAIKQLNKANVRVDGIILND
VKQGLMSKYSYNYSYAYGSNK
>gnl|bykdb|A0A0M6XRQ5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Jannaschia rubra] (length=740 residues).
MIQPAGGETGPETRSQDVVLDFGRILAIIRRSWWLIGGLGLAGAIVAAIAVLQVTPTYQSGAELLLGQKARLDDAMGALF
QDLRLDDAAISGEVAIITSGRLLSEATERLDLQSHPEFNPDLRPPEDEPGLLSRIADGAVNLLKRAMGLGTGDEPDGLTG
PGGSPVRDAAMTGKTALGEQADYVDQLRQGLSVRQVGRSNLVSIHYLSTDRMLAAAVPNALIDIYLEDQIDRRFAVLSRA
TSGLESRLNTMRDRVESSERATIDYRTRNLSDGFGSRVQLDQQLSDLSVRLSAASAEYAELASELRGLNTLIDDQGAIAT
AGLFASPTIDTLRVELSDLRRREDRLREQFGSDIPQLADTVREIERLEAALSEEVLTLRDDKAKLVDIAGARRQALANEL
SELEQRAIALADREVRLAQLEREQSAAQLVYETFLDRFNQTRDVGDLQESDAQVIDYASPPPAPVAPNKKLAVALGGFAG
AFLGLALAFGHAVVDTRLRTLDGVQRLMRGADTILMPRVSSFWRRGDPLHTALRNPQSAVAESLRTLRSSLMMAAPASGG
FVVTFVSTRPGAGKTTTAVNLGRLFAKMGKSCVLVDADQRRGNIAALLKLPLDPDLIDVIEGEATLDEALHEDSQTGMHI
LTTRLDAPDPAGILLSRKMTDLIGTLKQRFDVVIVDTAPLLPVADALPVVRLADQVVMMVPYGSKADDVATGRRMLDRAG
RPPSCAVMSFAPANTISSYY
>gnl|bykdb|A0A0M7BKI0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Alcaligenes xylosoxydans xylosoxydans] (length=753 residues).
MSLPIESFEPSVPARQQETPLSSHVDAIFSNRWLIIAITLIALLGAVTYVMVTPSVYSADIIVQVEEEMPQGQSRSLLGD
VSAIFDTKAETSGEMEVLRSRMVVGPAVDKFMLYIHAKPRYFPVVGEWLARRYESLPYPSGLPRGGYAWGGETIQVSQLD
VPNEWLGKPFRITTLGDGAYTLSDKITGATFKGTVGKPEHFLLPGGSALDVHIDALSGRPGTEFTVSRTSRLAAIEDVQS
RLGIFERGRTSGVIGVTLEGNDPALTTAVLNQIGQEYVQQNVNRKSAQAEKSLAFLDEQLPQLKRELDAAETKYNSLRNK
RGTIDLSEEAKLILAQSVDAQTKVMELRARRQDMITRFAPTHPSIIAIDRQIASLTGDVNRIGNNIKQLPDLEQDVVRLV
RDVRVNTELYTGLLNNAQQLRLIRAGKVGNVRILDAAVQPDKPVRPKAAIIIAVATAIGLIFGLLCAFVRNALFGGLSEP
DDVERYTGLPVLAAIPHSDLQDKLWRRSRRKNATVPALLAQSQSTAPPIESLRSFRNVLQASLQQSTNNMVMFTGPVAGV
GKSFLSANFAFIQGGVGKRVLLIDADFRKGQLNRYFGVPKEDGLFEVLSGTLPLERVRKHSVSEGVDFIATGAVSFDPSE
LLASPIFGQTLRELASQYDMVILDTAPVLSSPDAAVVGTHAAAVMVVVRSGMNTVGEIRETAKRLIQAGAPVDGVLFNGL
KLMPERFGFRSKYGGYRYSRAAYYGDFKQNGPK
>gnl|bykdb|A0A0M7FUU9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Achromobacter sp] (length=753 residues).
MPLPIESFEPSVPARQQETPLSSHVDAIFSNRWLIIAITLIALLGAVAYVMVTPSVYSADIIVQVEEELPQGQNRSLLGD
VSAIFDTKAETSGEMEVLRSRMVVGPAVDKFMLYIHAKPRYFPVVGEWLAQRHESLPYPSGLPRGGYAWGGESISISQLD
VPNEWLGKPFRITNLGEGAYTLNDKLTGATFNGTVGKPEHFLLPGGGALDVHVDALNGRPGTEYTVSRTSRLAAIEDVQS
RLGIFERGRTSGVIGVTLEGNDPALTTAVLNQIGQEYVQQNVNRKSAQAEKSLAFLDQQLPQLKRELDAAETKYNSLRNK
RGTIDLSEEAKLILAQSVDAQTKVMELRAKRQELITRFAPTHPSIVAIDRQIASLTGDVNRIGNNIKQLPDLEQDVVRLV
RDVRVNTELYTGLLNNAQQLRLIRAGKVGNVRILDAAVQPDKPVRPKAAIIIAVATAIGLIFGVLCAFVRNALFGGLSEP
DDVERYTGLPVLAAIPHSDLQDKLWRRSRRKNATVPALLAQSQSTAPPIESLRSFRNVLQASLRQSANNMVMFTGPVAGV
GKSFLSANFAFIQGGVGKRVLLIDADFRKGQLNRYFGVPKEDGLFEVLSGTLPLERVRKHSVSEGVDFISTGAVSFDPSE
LLASPIFGQTLRELASQYDMVILDTAPVLSSPDAAVVGTHAAAVMVVVRSGMNTVGEIRETAKRLIQAGAPVDGVLFNGL
KLMPERFGFRSKYGGYRYSRAAYYGDFKQNGPK
>gnl|bykdb|A0A0M7GE86 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Achromobacter sp] (length=753 residues).
MSLPIESFEPSVPARQQETPLSSHVDAIFSNRWLIIAITLIALLGAVVYVMVTPSVYSADIIVQVEEELPQGQSRSLLGD
VSAIFDTKAETSGEMEVLRSRMVVGPAVDKFMLYIHAKPRYFPVVGEWLARHYESLPYPSGLPRGGYAWGGESISISQLD
VPNEWLGKPFRITTLGEGAYTLNDKITGATFKGTVGKPEHFVLPGGGALDVHIDALSGRPGTEFTVSRTSRLAAIEDVQS
RLGIFERGRTSGVIGVTLEGNDPALTTAVLNQIGQEYVQQNVNRKSAQAEKSLAFLDEQLPQLKRELDAAETKYNSLRNK
RGTIDLSEEAKLILAQSVDAQTKVMELRAKRQELITRFAPTHPSIVAIDRQIASLTGDVNRIGNNIKQLPDLEQDVVRLV
RDVRVNTELYTGLLNNAQQLRLIRAGKVGNVRILDAAVQPDKPVRPKAAIIIAVVTAIGLIIGVLCAFVRNALFGGLSEP
DDVERYTGLPVLAAIPHSDLQDKLWRRSRRKNATVPALLAQSQSNAPPIESLRSFRNVLQASLRQSANNMVMFTGPVAGV
GKSFLSANFAFIQGGVGKRVLLIDADFRKGQLNRYFGLPKEDGLFEVLSGTLPLERVRKHSVSEGVDFIATGAVSFDPSE
LLASPIFGQTLRELASQYDMVILDTAPVLSSPDAAVVGTHAAAVMVVVRSGMNTVGEIRETAKRLIQAGAPVDGVLFNGL
KLMPERFGFRSKYGGYRYSRAAYYGDFKQNGPK
>gnl|bykdb|A0A0M7GJF5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Achromobacter sp] (length=753 residues).
MSLPIESFEPSVPARQQETPLSSHVDAIFSNRWMIIAITLLALLGALTYVMITPKVYSADIIVQVEEEMPQGQSRSLLGD
VSSMFDTKAETSGEMEVLRSRMVVGPAVDKFLLYIQAKPRYFPVIGEWLAQRYESLPYPSSLPRGGYAWGGEAIAISQLD
VPNEWLGKPFRVTTLGEGRYTLSDKFTGATFNGTVGKPEHFRLPGGGAMDVHIDALTGRPGTEFTVSRSSRLAAIEDVQA
RLGIFERGRTSGVIGVTLEGNDPALTTAVLNQIGQEYVQQNVNRKSAQAEKSLVFLEQQLPVLKGELDAAETKYNSLRNK
RGTIDLSEEAKLILAQSVDAQTKVMELRSKRQEMITRFAPTHPSIVALDRQIAGLTGDVNRIGNNIRQLPDLEQDVVRLV
RDVRVNTELYTALLNNAQQLRLIRAGKVGNVRILDSAVQPDKPVRPKAAIIIGVATAFGLIFGMLCAFVRNALFGGLSEP
DDVERHTGLPVLAAIPYSDMQDKLWRRSRRKNASVPALLAQSQGNAPPIESLRSFRNVLQASLRQSANNMVMFTGPVAGV
GKSFLSANFAFIQGGVGKRVLLIDADFRKGQLNRYFGVPKEDGLFEVLSGTIPLTQVRKHSVSEGVDFIATGAVTFDPSE
LLASPVFGETLRELASQYDMVILDTAPVLSSPDAAVVGTHAAAVMVVVRSGMNTVGEIRETAKRLIQAGAPVDGVLFNGL
KLLPERFGFRSKYGSYRYSRAAYYGDFKQNGPK
>gnl|bykdb|A0A0M7HZY4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Enterobacter cloacae] (length=732 residues).
MSSYTTDSYGAAAPENHEIDLISLLGEVIDHRAVILSITFLFTLLAGLYAFLATPVYRADALIQVEGKQDNSLLKNLRQF
GSEMSPDVEPEILLLKSRMILGATVDELGLTQHVTQRTFPVVGRLWARLQGRKPATVALGWLQLPPVEGKPRTLVLTVLE
KGAYRLEGDNFYAEGREGKPLEKAGVSLLVVKMNAPTGTQFTVQNSTRLEAINTLSTQFSVVESAKQSGVLTLTLTGNNP
ERIAHVLDRIANNYLQQNIARQEAQDARSLAFLQKQLPKIRSELDLAEERLNQYRKQRDSVDLSLEAKSVLEQIVNIENQ
LNELTFREAEISQLFKKEHPNYRALREKRQTLEQEKVRLNQRVAAMPSTQQDILRLSRDVESGRTIYLQLLTRQQELNIS
RSSAIGNVRIIDSAVTQPDPIKPRKLVVIVLGILLGLICSMGLVLVRMALRRGINTSEQLEGLGVQVMATLPRSQWLWKK
TNLRKKRVFGSRWRHKIVDVPFLPVDRPADVFVEAVRGLRTSLHFTLQDAANRIVMISGPTQDCGKTLVSTSLAAIEAQA
GLRVLFIDADMREGYVHNIFDLKNHTGLSDVLDGKCHFQAAIQRYEKGNIDVLTCGPVPLRPSELLMSERFRALMTWADE
HYDLVILDTPPVLAVTDASVAAPVAATSLLVARYGKTSLKEMENSIKRLQQTGAHINGTVLNDVVKSAALYYRAGYGHYE
YGQRPTRQPRKD
>gnl|bykdb|A0A0M7K7Z2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Achromobacter sp] (length=753 residues).
MSLPIESFEPNVPARQQETPLSSHVDAIVSNRWMIFAITLLAFLGALAYVMVTPSVYSADIIVQVEEEMPNGQARSLLGD
VSAMFDTKAETSGEMEVLRSRMVVGPAVDKFLLYIHAKPRYFPVVGEWLAQRYEALPYPSSLPRGGYAWGGESIAISQLD
VPNEWLGKPFRVTTLGEGRYTLTDKFTGATFNGTVGKAEHFLLPGGGAMDVHIDALAGRPGTEFTVSRSSRLAAIEDVQS
HLGIFERGRTSGVIGVTLEGNDPALTTAVLNQIGQEYVQQNVNRKSAQAEKSLGFLEQQLPILKGELDAAETKYNALRNK
RGTIDLSEEAKLILAQSVDAQTKVMELRSKRQELITRFAPTHPSIVAIDRQIASLSGDVSRIGNNIKQLPDLEQDVVRLV
RDVRVNTELYTGLLNNAQQLRLIRAGKVGNVRILDAAVQPDRPVRPKAAIILGVATAIGLIFGMLCAFVRNALFGGLSEP
EDVERYTGLPVLAAIPYSDMQDKLWRRSRRKNATVPALLAQSQGNSPPIESLRSFRNVLQASLRQSANNMVMFTGPVAGV
GKSFLSANFAFIQGGVGKRVLLIDADFRKGQLNRYFGVPKEDGLFEVLSGTIPLARVKKHSVSEGVDFIATGAVTFDPSE
LLASPVFGATLRELSSQYDMVILDTAPVLSSPDAAVVGTHAAAVMVVVRSGQNTVGEIRETAKRLIQAGAPVDGVLFNGL
KLMPERFGFRSKYGSYRYSRAAYYGDFKQNGPK
>gnl|bykdb|A0A0M7KFY7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Achromobacter sp] (length=753 residues).
MPLPIESFEPSVPARQQETPLSSHVDAIFSNRWLIIAITLIALLGAVAYVMVTPSVYSADIIVQVEEELPQGQSRSLLGD
VSAIFDTKAETSGEMEVLRSRMVVGPAVDKFMLYIHAKPRYFPVVGEWLAQRHESLPYPSGLPRGGYAWGGESISISQLD
VPNEWLGKPFRITNLGEGAYTLNDKLTGATFNGTVGKPEHFLLPGGGALDVHVDALNGRPGTEYTVSRTSRLAAIEDVQS
RLGIFERGRTSGVIGVTLEGNDPVLTTAVLNQIGQEYVQQNVNRKSAQAEKSLAFLDQQLPQLKRELDAAETKYNSLRNK
RGTIDLSEEAKLILAQSVDAQTKVMELRAKRQELITRFAPTHPSIVAIDRQIASLTGDVNRIGDNIKQLPDLEQDVVRLV
RDVRVNTELYTGLLNNAQQLRLIRAGKVGNVRILDAAVQPDKPVRPKAAIIIAVVTAIGLIIGVLCAFVRNALFGGLSEP
DDVERYTGLPVLAAIPHSDLQDKLWRRSRRKNATVPALLAQSQGNAPPIESLRSFRNVLQASLRQSANNMVMFTGPVAGV
GKSFLSANFAFIQGGVGKRVLLIDADFRKGQLNRYFGVPKEDGLFEVLSGTLPLERVRKHSVSEGVDFISTGAVSFDPSE
LLASPIFGQTLRELASQYDMVILDTAPVLSSPDAAVVGTHAAAVMVVVRSGMNTVGEIRETAKRLIQAGAPVDGVLFNGL
KLMPERFGFRSKYGGYRYSRAAYYGDFKQNGPK
>gnl|bykdb|A0A0M7NAN1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Achromobacter sp] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITTVFALCAVVYTFFATPIYSADALVQIEQNSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDNK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHASPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A0M8KJ82 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudoalteromonas sp. SW0106-04] (length=737 residues).
MKTATRNTGAAEVVTLGYYLKVINKFKWRIALLAILVTTLAMVWALQLTPSYRASATLLIEAQQRKAVSFEEVYGLDASK
KEYYQTQYEILRSRAIARDVIEQLNLLEHRDFQPKPSMLNWVMNDIKQWVKQYIPQKPQTLPSTADAQQAYEKRMQKIIT
AFSRRLSIHPIRKTQLVVIAYESSDPALAADVANAVGEAYITHAMQAKMGIAKQASGWLNDRLSILRERLDKSEQKLQSY
REREDLVDIEGVVGLVRRELEQTAQQLVEAKRNQSELNAIMRVVDEYGRDDIARLESINEITTHKVIQDVKREVVTAQRK
VSELRQVYGPKHPKMIAARAELATVQENLSAQIRSLVMGLEKEMRTANSTVSALQQDVEQLRQRFQMLTRKETEYHQLKR
EVETNRNIYDTFLSRSKETEVTSDFNSPIARFTDYAYQPTNPAKPNRKLIVVLAFVATLGFGIVLAFLTDALNDTLNNAE
EVENKLGQRLLGVLPSLPSSKRKPLPTHTFFDKGKLAFAEAVRTFRTSLVLSQMDRDNQVIEVTSSVPGEGKSTTSINLA
FSLGQMEKVLLIDADMRRPSLAGRFSLPAYQPGLANVLANTQQLEECIHVDEQSNIHVLCAGQIPSNPLELLSSENFKAL
LAHLRQQYDYIVLDTAPLEAVSDALVVSQHSDSVIYVVKSGSTRQGLVKAGLHRLIDAKANVCGVLLNQVNGKQKQGHNA
HYGYYDSHGYTQANAPT
>gnl|bykdb|A0A0M9AUE3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas sp. 655] (length=739 residues).
MQLPSVVGTRENERDDIDLLGIFGSLIDQKWLIGALTGAFMLTGVAYAILATPVYLANAVVQVEPKKNDMLGFSDLNSML
NGQSPSVTEIGIIKSRAVIGKTVDDLHLDIDVTPNTFPVIGGFLARRYKGDAVASPRFGLSSYAWGGERLDIAQLNLPEE
LLGKKLTLVAGEQQRFQLFDDNDTLLVDGVVGEAFAQNGIEGRIADLAANPGTRFQVVRSPRIVTILDYQDDLDVSEQGK
ESGIIRLALASADYAQAVKILNKVASLYVQQNVERTSAEAAQSLDFLQAQLPQVKNDLIKASDALNGYQTRGKTVNISLE
TQSVLEQIVTLDTRISELKLQQAELDRKFTKQHPVYRALMAQIGELTRQQKSLESKVQDLPATQQELLNLTRDVEVASQI
YTQLLNKSQELDIVRAGAVGNARLIDAADVDKTTPVKPRKALIVLIATFLGAFVGVALVLVRKSLSRGLEGPEAIEQLGL
PVYASIPYSALQQEEDSKKLRLSDESRRQAFLLALRNPTDLSIESIRSLRTCLHFAGLDSTNNRIMISGPSPQVGKTFVS
SNLAAVMAQSGQKVVLIDADMRKGHLHKTLNTPITNGLSDLLVKRCSLEQGIHETEVENLHFISRGQVPPNPSELLMHAN
FRELLAQLSELYDVVIIDTPPLLAVTDAAIVGREAAISLIVTRFGVNPAKEIELTIRRFAQNGIQLKGAVFNGVEKRASS
YYGNGGYGNYNYEYASDKA
>gnl|bykdb|A0A0M9CVX8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Photorhabdus heterorhabditis] (length=713 residues).
MTTSDKSSHTHTDSDEIDLGRLLSALFDYRWIIGGVTLLFTVIGLCYALIATPVYKANALLQVEKKSSALSLVGDMTDML
SGRPSDTAAELELLVSRMIIGKTVRDLDLDVQVEADYFPVVGKGIARLRGMPKPNIVIKNFTVSSHNINKAVKIYVDDSE
HYRLEFDGQVFNGQVNKVFDADGINLLISNISAPPGQSFTLVKKAQLNVIRGLQQSLRVTEKGNNTGIISLEIEGDDRAR
IKLILDSISKNYLRQNVTRKTEEAESSLNFLKNHLPKVKMALNRSEELLNQYRQANESIDLSLEAKSALETLVQIEKQLN
ELTFKEAELQQLYTKQHPAYVALLDKRKTLADTKKELNQSIKRLPKTQQEILRLTRDVQVGQEIYVQLLNKQQELNILKA
GTVGNVRIIDEAVVESSAIKPKKSLIIAVMMMLGLILSIGLVLVRVLFRKGIESPEQLEEIGISVYATIPLSETQAKLEQ
QQKKRPYHQRLRLLAIHDPTDLAIEALRSLRTTLHFSMMESANKIILLSGPAPELGKSFISVNLAAVLALGNKKVLLIDA
DMRRGHLHKVLESPQSPGLSEYLAGQNQIKETITRTYLTELDFVSRGTIPPNPSELLMHSRFKELLSWAEEHYDYVLVDT
PPILAVTDAAIIGRYAGTSLLIARYYKTRVKEVGVAIRRFEQNGTHIKGVLLNAVEKNSSLYYGGHYQYSYKD
>gnl|bykdb|A0A0M9FC23 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Photobacterium leiognathi subsp. mandapamensis] (length=724 residues).
MSLTQNLANKATPNTSDEIDLGKLFGILVDSRWSIIVTTLLFTFIGIAYALLATPVYKADALIQVEQKSTGMPALGGDMA
ELFSSESTATTEIEIIKSRMVLGETVDKLNLSVVATPNYIPVIGKGLARLSGESASIAISRFILPEHMQTNGYVLTVTNS
EKGKYTLANSEGREILQGRVGELVEQNGISLFVTDIHAKDEATFTLSKISRLDAIQNLQRDLSISERGKQTGILQLSMTG
KNRSEIKDILNDISQNYFLQNVERNSAEAEKSLVFLKKHLPEIKAQLNNAEERLNQYRQLNESVDLNLEAKSALEVMVNV
EAQLNELTFKESDISQRFTKEHPAYIALLDKRKTLLAEKARLNKRVEKLPKTQQEILRLTRSVEVNQQIYVELLNKVQEL
SIVKASTVGNVRILDSAQTYSQAVKPKKALIVVLATLLGGMLSVAIALLRAAFHKGVETPDQIEELGLPVYASIPLSDSQ
TELLKMQKGKKDNLTVEQTLLSVYNPADLSIEALRSLRTSLHFAMMEAKNNVLMISGPSPGIGKSFVSANLSSVIAKAGQ
RVLVIDADMRKGRMETQLCTDSKPGLSDYLCGKQEFGNVVRETGVGGLDFIPRGDTPPNPSELLMHPRFKALIDWAQQNY
DMVIVDTPPILAVTDAAIVGAHVGTTLLVGRFEQNTVKEIDVAKNRFEQNGIEVKGFILNAIVRKASSTYGGNYGYYNYS
YDNK
>gnl|bykdb|A0A0M9JBC9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Achromobacter sp] (length=726 residues).
MTTKNMNTPPGSTQENEIDLLRLVGELWDHRKFIISVTALFTLIAVAYSLLSTPIYQADTLVQVEQKQGNAILSGLSDMI
PNSSPESAPEIQLLQSRMILGKTIAELNLRDIVEQKYFPIVGRGWARLTKEKPGELAISWMHIPQLNGQDQQLTLTVGEN
GHYTLEGEEFTVNGMVGQRLEKDGVALTIADIKAKPGTQFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDDPQ
LITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDNQL
NELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISK
SSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEHGISVYATIPMSEWLDKRT
RLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSD
QKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDH
YDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGY
SYSEKE
>gnl|bykdb|A0A0M9TXK0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingopyxis sp. C-1] (length=718 residues).
MPRSRQADPQVDRGALIDLRRVGGVLRRRWMVLCAAMAAAIVIAAAAYIAAEPRYLATAQVALERTAERVINVDSVVPTS
DPDSAAVDTEVQALRSPELIGRVVDRLRLARDPAFNNAAGEGQPTAQPDLIGRQRAIGTLLGGLTVKRDGLSYAISVSYE
GSTPVQAAQIANALVDDYVSGQVGSKTDATQRASKFLEQRLEELRTQLLRAEREVADYRAAHNLFAVSEASTITQQELSG
LSTQLAQAKAENAAAQARLSAARAQLAGGRNGEELGDSLDSPVVSQLRAQRAEAGREVAALEKRYGPRHPALMQAQNQLR
TADAAIAAEVQRIVANVSIQASIANQRAGSLAGSVAQSQGKLASDNEASVRLGELERNAESSRTLYQAFLDRYRQTVAQA
GLEQSDSYIVSRARVPGAPSSPNMLIYAAMAIVGGLGIGVLLVVLLQLLERGIETSDAIEDMLGLSTLASIPDANTLPGY
RKLGPPAPPAELLLKRPQSTYAEAFRTLRTSIQFAEAASPIRVVAITSAVPGEGKTTTAMGLARAVAAAGGKVLLIDADA
RRRASSRQFTDGVTLGLDEVLAGQATLDQAIVKDSLSGAFLLPQRIDSKGVGLTESPRLAELIEQVRERYDLVILDTPPV
LPVDEARVIASMADGVVLLVRWRKTPSKAVSVALRRLYDVHAEMLGAVLTLVDVREQERAGYEDGGTFMKAYRSYYAD
>gnl|bykdb|A0A0N0CBW1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio parahaemolyticus] (length=721 residues).
MTTQTIKQSRQADDEIDLGKLFGIILDAKWLILCTVVLFSIIGVGVAILSTPIYKADALIQIESKSSGGISAMVGDMGEL
FSAESSATTEIEIIKSRMILGGTVDKFNLTTVVSPNYMPIIGKGLARLQGEQISLSVSRFNTPSYAVGIPLTLEVIDSEK
QTFKLIEDNNNVILEGKVGELIEKNGYQFLATEMIAQEGASFTVSKISKLDAINALQQNLSISERGKQTGIISLSFSGED
RAKIQAILNDISQNYFLQNVQRNSAEAEQSLEFLKGHLPDIKTKLTASEDVLNRFRQENESIDLGLEAQSTLKVMVELEA
QLNELTFKESEISQRFTQDHPAYKSLLDKRETLLKEKERLNKQVQKLPKTQREVLRMTRDVEVNQQIYIQLLNKVQELNI
IKAGTVGNVRILDNAQSFSKPIKPKKTLIVVLATLLGGMAGVAFVLIRAAFHRGVETPDQIEQIGMPVYASVPKSIQQLE
FANKLKRNKGSNDELVLLAEANPADLSIEALRSLRTSLHFAMMEAKNNVLMISGPAPSIGKTFVSTNFAAVAAKTGQKVL
LIDADMRKGYLQQCFGLRWDNGLSDYLSGKTSHSNIIKSTSIDNLDVVTRGQVPPNPSELLMHPRFKSFVDEMSAQYDLV
IIDTPPVLAVTDPSIVGAIAGTTLMVARFDQTTLKEIEVAQGRFEQSGVEVKGVILNAVEKKASNSYGYGYGYYNYAYKS
E
>gnl|bykdb|A0A0N0FFC9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas amygdali pv. mellea] (length=735 residues).
MTVMNRPSLDFHQDSRIDLAAVLRMLFDHKALILWTVSLFFLIGLGYAILATPVYQATAMIQIEPRKIGIEGTPEVSAKP
LSVSQATTEIELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEV
PEHLLGEKLTLIAGKPGQFSLYDNEHNLLLGGTINRIVEGNGVKIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAE
AGRDSGIIYLSIEDQDAQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNNFQTSARSVDL
SIETKGVLDQVVSLDSMLSELKLRRVELERLYTREHPTYRSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVI
SQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPVKPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIES
LGMPVYASLPHSRQQERLEKRDQDSKDSRLLSIAAPGELAIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSN
LATIIAQTGRRVLLIDADMRKGYLHRLFGLQPKHGLSDTLAARLRCTEVIHQTRVRRLDFMSCGFAAPNPSELLMHDNFN
KMLAELSPLYDLILIDTPPILAVTDATLVGRQAGTCLLVARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSD
YDYAAYGYNYHPAPR
>gnl|bykdb|A0A0N0IIB1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia sp. ST111] (length=734 residues).
MNTIDVVPEQGDHLGVFLDVLYQNRRMIALITACFLFMGAAYALLAAPVYQADILIQVQENPNAAKDALGDVKSMFAVKT
AASAEIEVLRSRLVIAGAVTSAQLSLSATPRYFPVVGRWIAGHLSDLAHSGMGGYAWGNERINVSKFDVPDALQGVKFIL
TLHKNGNYLLKYKDIELRGRVGELLHAETAEGPVDLIVDQIVGKPGVGFELVRTSELSAIQTVQSGLLISEKGKESDVIG
VALEGTDPKKISAILDAIGTAYVRQNVLRTQEEAQKSITFLDAQLPELKSKLEVAESEFNAFRAKNGTVDLSAEAAALLQ
RSTQAKSKVADLEQQRALLLARYTSENPAVIAVNDQLSEAQREVGSIASVTKQLPPMEQSLLRLQREVQVDTSIYTNLLN
TREQLRLLKAGKVSNVRLVDTAIVPDSPIRPKRVLAIIGALMAGLFASVVLVLLKRRLFDGVTIQNEIEAGTGLSVYATI
PRSRVQETLTRSLPRNTDTNLVLAHAAAGDAAIESLRSFRSALEFALVDAPNRIVLLAGPTPIVGKSFVSVNLAALIGAS
GQRVLLVDADLRRGTLHQYLGVPCSPGITNIVTRGRTFEEAVHRDILPGVDFVANGGYIQNASEILKHRNFLAFAQQVDS
EYDVVLIDAPPILPVADSGIVASIAGMVFVIARHGVTTVEELRESTRRFEQIGVPIRGVIFNDAMSRPGRYGKAYAAYGY
SSYASGVPGKGTEA
>gnl|bykdb|A0A0N0K036 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Blastomonas sp. AAP25] (length=732 residues).
MQNTENFGALEPQRGYPTTGAIGPSVPPMLLQYWYTVMRWRWLMLGIILGCIVLSVVVTLFMSPQYTAQVQIQIDRQQKQ
ITMVEGIEAQTTPQDQEFYATQYTLLTARPLAERVAASLALYNNETFLAAHGIDGDVLTEKSPGLSAQQIKDKNRRLIIN
LLLDNVDIAPIRNSKLVNVTYTSRDANLSARIANEWAAAFIATSMDRQYASTADARKFLEERLVTLRQRLDESEKLAVNY
ASRNGIVSLGETRDSEGRTTSNQTLAGAQLAEMASALNEATAARIAAEARSGSAGESTSESVTSNSLSSLRGQRATIAAE
YAKKRVQLEDGHPTVQELKQQLATTDNAISQETQRISRARQSEYREAARREAELRAKVETLKQGLDVQNKANIQYAAFLR
DADTNRQIYDALLQRYKEIGVAGQVGVNNISVVEPANAPDRPSSPNLLLNLLIATFLGVALAGATAFGLEQIDEGVRDPT
QVDALLGLPLLGITPKVERNATEEMADLKSALYDAYFSIHSNLSFSTSHGFPKSLAVTSTRPSEGKSSTSMALAIVLGRT
GKNVLLIDGDLRSPSIHGMLGMTNEKGLSNYLAGEDDWQSFIQPTELKNVSIISTGRSPPSAAELLSGDRLASLIAQALT
QYDNVVIDAPPVLGMTDAPLIAKAVESVVYVVESVGPAVRGIRSSIQRLVMANARLSGVVLTKVGEGSMNYGYGYGYGYG
YGYGSDRKDLDQ
>gnl|bykdb|A0A0N0K9S8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Novosphingobium sp. AAP83] (length=726 residues).
MEDRFDLAAAFLEPWQAVVRWRVLVGAIVFGAIVIGLVATLLIAPKFTARTQLEISREQKNITSVEGLEASSSTRDVEFY
ATQYALLRARSLAERVAKRLDVAKTDAFFDAHGAKPIAVDDVQVPDSERRAARERSAIGLLLANVEVLPVRGSSLVEITY
TSRSPELSAQVANLWIDEFISATMQRQYVSTADARRFLETRLADLRTRLEQSERDAVTFASSNDIITLDASQDANGRTVS
QKTLASVDLEALNAALATARADRISAQSRASVAAGDNSPEALTNPVISQLRAKRADFAAQYADVMVRFKPSYPEALAIKQ
QMDTLDTALANELGRIVGGRRSTFNEARAREQQLEAKVVELKGELDRQKRASIQYGIYQRDADTNRQLYDALLQRYKEIG
VAGAVGTSNIAIVDKAEVPVSPSSPKLLLNLAIALLLGLGAAAVVVFALERVDEGIHKPEDVRQFLRMPLLGNVPLTEEN
TFEALDDPKTFVSEAYFSIHSTLSFATDHGLPRSLVVTSTKSGEGKSTSSFALAQIIGRTGKRVLLIDGDMRSPSLHKVM
SVPNKAGFANALAGDDPLQLALQTAHRGVSIITSGPLPPSPPELLATDRLAEVITACLTEFDYVVIDAPPVLGLADSPIM
GRAVEGVLFVVEAEKTTIRSARSSLQRLAGVGNRLFGVVVTKIDVRSHGYGYGYGYGYGYGYDRSYGDGPKPAKSGSTLK
KIFGRV
>gnl|bykdb|A0A0N0RC34 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingopyxis sp. C-1] (length=705 residues).
MPQASDDNAPPLVLQYWNIALRWKYVIAGILIVALAVGVLATFIATPQYSSEVQVEITRDQKNPTHAEGIESAQSSQEAE
FYQTQYTLLESRSLAERVARQLNLGGNKEFYDAHSLDFAPSDDVRARVQAASKILLANIEISPIARSRLVNIRYTSASPE
LSAKIANAWADNFIQASMDRRFGATQDARAFLERRLLEYTKKLEDAERRAALFAANSGIVVLSSSTDADGNSGIQKTLVS
NDLENMSNELAKATADRIAKQAAATEARALASQNQTVGLLRQRRAEANAEYSELLAHYEPGYPAAQALKQKVAALDAAIA
SEEGRSVRSVRGEYDEAVKREANIRANVEKLKDDIELQNRDSIQYNIYRRDADATRQLYDSLLQRTKEIGVASVAANNIA
VVDRADVATSPTSPSLITNLMIALIIGLALALLAVMALEQIDEGLREPADVRRLLELPLLGAIPDQLNDEPLDLLLDPKS
NISEAYLSVRTNLAFTTDHGVPRSVVVTSTSPGEGKSTTSFSLALVLARTGKRTLLIDADMRSPSVHGFAGIENEKGLSN
LLAGEDNWQAMVQRADLGVERLEFLTAGPNPPSAAELLSSDRMSLLIRDLLEQYDHVVVDAPPLLGLADVPLLSRAVEGS
VFVVAAGQVAVRALRGSLSRLHQAHARIFGVVLTKLAPQNSLSGYGYGYGYGYRYGGEPAEQTNS
>gnl|bykdb|A0A0N0UKS5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio parahaemolyticus] (length=726 residues).
MNGTHPNNLQMNKVELIRFGHHFKAIKKNWLSIAAFTLLFSLTCTWYIYSKASIYQATATLLIQEEQKSALSIEEVYGVD
TTKKEYFQTQIAILKSNHIADKVIRELNLTQLPEFTRSGGLNQKIDQIKSIPFVQDLLNVAPSPKETAQFSESYYQALQA
FRSKLDIEPVRNTQLVRIRFRSTDPKLATTIANAVGQAYIDANFEAKLVVTQNAATWLTNNSQKLEERLRNSEQALQEFL
LKEGLIDINGIDEIYANELEELTRKLNVAVNKRIEAQTLIQLLRRKSSQSLDSLLSIDEFANQAQIRDLKLSEAQAAKNL
SELAQRYGPKHDRMIQAKAQLAEIQARTQQLIRDISFSKQQDLLAAKAQEDMLRAELDNKKADFQSLGSQKARYEQLKRE
VESNKALYEAFLNREKETNATSDYKNVTARFTDKAIIPLFPVAPQRIKLVLIATFFGFAIACALVIILETLREVIRNTAD
VQEKLGVTCLGVIPMVKKRNLRKNGVSYTAYLDDEEKLFSEACRSVRTSLLLRLTNTKQKILPFTSAIPEEGKTSTSINM
AVSFSKMEKVLIIDCDLRRPSIAKRFGIAESSPGLTHILTMDTPIKDCVTHIEEANLDVLPAGLIPPNPQELLASDRFKK
LLEHFQNKYDRIIIDTPPLLSVSDALILGQYANGLITVIRSESTKSSLVNLALSKQIQHSVPSLGVLITQAKTKEGETLY
VQKYAY
>gnl|bykdb|A0A0N0WVI6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. maculicola] (length=753 residues).
MTVMSRPTLDYYQDARIDLATVLRILFDQKALILWTVGLFFLIGLAYAVLSTPVYQANAMIQIEPRKIGIEGTPEVSGKP
LSVSQATTEIELIKSRALLGKVVDDLQLNVLQKPDLFPVIGPYLYRTFAPPQDGALAEPLWGLSHYAWGGEKIEVFQLEV
PEHLLGEKLTLTAGKPGQFALYDSDHNRLLGGAVNRVIEGNGVKIQIAALLARPGTDFTVSRQRTLGTALVYQNRLKIAE
AGRDSGIIYLSIEDQDAQRANRILDQISRLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESEAALNAFQTSARSVDL
SIETKGLLDQVVHLDSMLSELKLKRVELERLYTREHPTYRSLMSQINQLEQQKQGLLKKIETLPMTQQELLRLTRDMQVT
SQTYTLMLNKSQEQDILRAGNIGNVRVIDNADSNIEKPVKPMKTLIVLIATLLGALAATVIIFVRQAFYRGVESAEVIEN
LGMPVYASLPYSRQQERLEKRGKNTQGKNMPGEERHGKDSQSVQVSRLLSIAAPSELAIESLRSLRTSLHFAMLEARNNV
LMISSPTPGAGKSFVSSNLAAIIAQTGKRVLLIDADMRKGYLHRLFGLQPKHGLSDTLAARLRCTEVINPTRIRHLDFIS
CGFAAPNPSELLMHDNFHKMLAELSPLYDLILVDTPPILAVTDATLVGRQAGTCLLVARFGMTTVKEIEACKRRLGQNGI
LIKGAIFNAVVRKATTSDYDCAAYGYNYHPAPR
>gnl|bykdb|A0A0N0ZB62 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Moellerella wisconsensis ATCC 35017] (length=692 residues).
MNTTKSPSTAADEIDLLALFKVLKSHYLIIGFVTLVFLLLGAAYSFLATPIYQANATLQFDKQSQVSFFDQMGDLSPFSG
GGNQVDSEIEVIKSRMVLGKTVTDLNLDTQVSTDGFFNKLWGNNPQINITHYSIPDALVGEPATLTYLGDNQFSLKLDTI
VLKGKIGELVQHDDISLLISSIEAETGEEFTLTKNGRYSTIDELRNTLNLSEVGKGTGIISLTIKGADKTENIRILDSII
QNYVAQNTDRKKEVTNNTLIFLDDYLPKVKAKLDNYENQLNTFRKKNESIDLSLEAKSALESALQVEDKLNELTFKEIEI
QQLYTRNHPAYQSLIDKRQKLLNEKALISKNIQKLPNTQQQIVRLTRDVESEQAIYNQLVGKQQELSVMNSGITADVRVI
DSAESQPQPVAPKKSLILALSLILGFIIGCAYVIARELFNNKIKGTEDIDALGVNVYATIPFSSHEKKLIMNGNMQPLAL
ENPADTAVEAIRSLRTSVYFSVMNQGNNLVMVTSASPGAGKSFITSNMGVVLANAGKKVLLIDTDLRKGRIHKAFGLDNK
LGLSEYLSQMDSNKPVIHHNVIENLDVICRGKNVTHSSELLMSERFKDMLDNLKSQYDIVVIDTAPILAITDAAVIGKYV
GTSLLIAYYGVNTVKDIELSLKRFKQNDIEITGVILNGIDARSDDYNYVYEY
>gnl|bykdb|A0A0N1ARZ5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Novosphingobium sp. AAP1] (length=734 residues).
MVNTAIDFYRAPAGIVPATPAEPRANSAAATDRIDLRRLMAMFRRRIGVFLGVLLGVLAIGMVITALQPRTYQARAEVTL
NSKLQPVAPTSTNDRTDQPAIPSESFVDTQVSVITSETNTAAVADALGLARDPRFAPSPDEGKAANTKSAGAHQSAREAA
IAYLAKNVAAQRIGTTYGIAITFESSDPQEAARIANAFAEQYTLGALENKRSGARETTGVIANRLEQLRQQALADSATVQ
RYRIAHNLLSTTQGTLTEQEISSYNQEVTAARAQASEDAARLEAAQRQLQAGGSGGVGEASLSPVIGQMRAQQASLAAEF
AAMSSRYGPQHPEVLRSKAQLDAVNRQIAAETQRVMASLEAKARVSQQRLASLAGSLDASRGALAQNNAAQVGLDDLQKR
AETSNALYESYLNRFKELTAREGTEQADADLLHRADVPRNPNSPHIMINAVLALALGTGLGIAAAFLAEMTFTGLTTGED
IEERMGVRYLCAIPTLQSVARRGERVPASALLEDPRSVFAESFRSLRASIAMNTTEARIIAITSALPEEGKTTTSICLAR
SMAAAGDRILLIDGDLRHQGVSRFLRGGEGRPGLMEVLHGTASLDDALVVDPGTGLSILPLCAEAGDRAELMTGVEMDRL
LATARERFDAVIIDTAPVLPIADARLLLGKADASVFVVRWRKTPEQALRAALRLLPIDRVQLAGVALTRVDMRKQPRFDY
GETAFYRSYESYYA
>gnl|bykdb|A0A0N1BHQ7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Novosphingobium sp. AAP93] (length=716 residues).
MDPYADGKPLFDIREIIATIRANLIVISAIVAASLALAVIVTMLQTLRYTAQTTLQINDQSAQILGKQDDTLQDPVVAAS
DTERFLQTQVDILKSRALTERVAQRLRLVGNARFYDAMGVRQPTGDLSRAEVKDLTIRTIEAARDVDLPRNTRLATVSFV
STQPELAAQIANAFAAEFIQTNLQRRFDSSAYAREFISGQLAEARAKLERSERELNAYARDAGLIRDRDASTGAQSSRVG
SSVTTTSLLEVNSTANQAQANRIAMEGRWTLISRGNPLDSPDVLANPAVSQLLAERARNMSELEKQRANHLEDYPAVQQL
KAQVGVIDAQIQNVARSIRASVKQQYDAAVDAEKSLKRQVAELKSSSLAEQDQLVQYRLLEREADTNRTVYEGLLQRYKE
LNAAAGISASNIAIIDTAVAPIRPSSPNLLRNLLLALVLGIISSAIVIYLRTLLDDSVKVPEDVEGKLQLPLLGVIPLAQ
ELEINLAMEDPKSPISEGYNSLRSALLYSTAAGLPKTLLVTSSQPSEGKSTTSLAIAKGIARLGRSVVLLDVDLRRPALH
RTIPMLNGENELGVTSILTAQSTVEEALRDTDVDHLKIITSGPIPPSPTELISSKRMTQLIEELSEKFDLVLLDSPPVLG
LADSPLMAALVDGVVIVIQSDRSRRGSLKASLRRLRSMRTNILGAALTKFDPNDAGNRYSEYYGYNYYHYSNSAAN
>gnl|bykdb|A0A0N1C074 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Novosphingobium sp. AAP93] (length=706 residues).
MAPAVAFETRVPPPAADRVDLRLLLAVFRRRLGVFLAVLFAVLAAGLLLTALQPRTYTARAEVTLNSRPQAVAPTSTSDG
PQQAAIPSEGYVDTQVAVVTSEANLAAVADSLGLAKDARFAKSPAGAQAAALAWLRKGVVAIRIGTTYGIAITFEDTDPA
LAARVANMFAQQYTAGALEAKRKTARATTTAIAERLEQLRQQALGDTAAVQRYRITNNLLSTTMGSLTEQEISSYNQAVT
TARAAASEDGARLDAARRQLALGTSAGGVGEVSASPAIGSLRAQQATAATELASLTARYGPRHPDVLRAKAALGAIDDRI
ADETQRVISSLEARARVSQQRLASLTGSLQQSRGTLAQNNAAMVGLQDLEKRAETSNALYESYLNRFKELTAREGTEQAD
ADLLHPAAVPLRPTSPNVALNLVLSVALGLGLGVAAAFAAEMTFSGLTTGDDIEQRLGVRYLGSIPTLGSVWRGDEKVPM
AALLEDPRSAFAESFRSLRASIAMNTTQARIIALTSALPDEGKTTTSICLARSMALSGDKVLLIDGDLRRQGVSRFLRGD
AGRPGLLDVLGGKASLEAALVVDPATGLNILPLAEGSDKAPELLTGTEMDRMLDAAREMFDAIIIDTAPVLPIADARLML
RKADASVFVVRWRKTPEAALRSALRLLPDDRVQLAGVALTRVDMRKQARFGYGDDAFYHSYKRYYA
>gnl|bykdb|A0A0N1C9H8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhodopseudomonas sp. AAP120] (length=748 residues).
MLQQNKSTQEINRGPAELEGGETRSLGSYLEIVRRQFPTILAIMSSVVILALLFLFTAAPRYTSTASMVIDTRKVQLFQQ
QMLGDVAVDPATVLTQIEMLKSENVSQAVIRNFHLTEDPEFIGSGIVGRLLSFIGLSSGRKSASELELNRRALQRFERSR
EIKRVGLTYVMGISFTSRDPAKAARIANAIADAYIVDQLEAKYEATRRASVWLQDRIKELRIQASAARRAVVDFKTANNI
VDTGKGLMTDQQIAEVNSQLVLAHASTAEANARLERMTEILKQGVPDASVADALKNDTIVKLRGQYVDMASKESIWTAKY
GADHLAVLNLRTQMAEIRKNIVDELKRIRESYKSDYDIAVTREESIKASLANAVSESQSSNQAQIQLRDLDSSAQSYQAM
YDNFLQRYMESVQQQSFPITEARVISSASTPLGKSYPNTMVILALAVLGGLILGLAAAIAREFSDRVFRTSGQVEEQLGT
NCLAILPLLGNDAAKPVLPWKAKAKTGSRKSKEFLRYVVDNPLSRFSEALRSIKVAIDLNSFVRENRVLATTSTMPSEGK
STVSSNLAQLMAHGGAKVILVDADLRNPSLSASLAPDAAAGLVDVVAQRANLEDVIQIDPATQLAILPAGSTSQLLHTNE
ILSSKAMQALVSDLRSKYDYVVLDLPPLAPVVDARVTSNYVDSYVFVVEWGKTKPDVIQHTLRSAPGIVDKILGVVLNKA
DTRMLARYESYQGRHYYQKYYARYGYAE
>gnl|bykdb|A0A0N1DGJ7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhizobium acidisoli] (length=734 residues).
MTISTLPPDRNLPISPMRYDPRFQVETKADTFDLASILGLIRRRMIVIITITVLLMVPAVTTISGLKPTYQGLARLIVHQ
PLATSLGGDDTSRGDALDVKSETERLLSRSIAERVVREMRLNMQPEFNPALRKVSFIQRIRAKLRSLFDTKKPALPVGDG
IDATIPEYYQALGVWHDDKSEVIQINFTASDAELAAAVPNRLVSIYLDERKGSVSGRLVLAEEWIRQRITEQQVRADIAR
DAARNYQQSMDIVSKEDAQDERIKTLLELTGREGKIEESRVEVKATISALEATDNASVAVQNTIVPDSITSKQRDLHGQE
QDLARLLETYDGNAEAVVDLRKKIEQSRIDLDLATKQYLQAMRAKLAALEHEANAVQSILAGAQEKRTRDALAQNELTRL
QRIAEKEQAALDKLEDQRRDLAAKAMLPGAELEVFSPASVPLVSQGRGRLSYLIGALLAAVSAAVTAAFVIEMWDRSVRS
FDQLAGIARTIPAGLIPRLARSENSKTIFAHMPVPMFDEAIRTVVLSLKQSNGGKLPNSIVVTSAHSGDGKSLVARSLAM
ELAAAAIPVLLVDGDLRRGKLDAFFRSGVMCGLNEFLNGQADFRDIVYHHPSGIDFIPSGKFSLQRRVRPNGLAEIIEMA
VAAGQIVIFDSAPVLASADTVHLTALAERTLAIVRWGKTSRRAFEFSLQQMKSSRNSEIIVAINNVNPEKHALYNFSDSE
LFSKSLMKYYKFKA
>gnl|bykdb|A0A0N1DW98 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhizobium acidisoli] (length=758 residues).
MLSPDKLTPRIDPSRDTGNEADFIDFDKLIAIARRQWRMVAACAFAFAILGIVYVLTSVPVYTADTSVLIDRSDNQVINQ
LAAFGQMDDDEGTVLSQVELLKSDTIAYAVVDKLKLVDDPVFNAQRNSLFSVATLKSLFSFKSWFADDAAVAPDPEMQRR
YAAETVAGNIDVERVGKSYVLDVSYTSQSPDMARQIAAAIADVYLVDKLNSKYEATRRAGEWLQERIEELRQQALDTDLA
VQKFRSEHGLVEAGSGTLISEQQLSEINTQLINAQAETAKAEAKYARVKSIIDAKQTDAIVTDVLDSSISNDLRKKYLEA
SKLETEIEARLGPDHVQAVRLRAEMEEYKRLMFDELNRIAESYQSELQVAQSRENSLRDSVTKATGVAATAGETQVQVRE
LERTRDTYKNLYQSFLTRYQEAIQQQSFPITAARIITMAETPTKPSAPKRALVVAFAMFLGCAVGSGIGAFREFRDRFFR
TGDDVKEVLDVESLGVMPLVDDNIDDPTLVDPSNPRSIARGSKTTTYVEEHPLSAFAETLRSAKIAIDLSAADQRCKVIG
VVSSLPGEGKSTTSINFAKLLAMQGARCLLIDGDMRNPGATRAIGRHAEAGLLEAIVDGRPLKDLILLDPKTKLAFLPTV
ARYRVPHSSELLASRGMDQLLEIARQSFDYIIVDLPPLAPVVDARAINSKLDAVVFVIEWGKTSRKVVQSTLLSEPELYA
KCVGAILTKVDPSQMKLYRTFGSSEYYYKRYSRYYTES
>gnl|bykdb|A0A0N1EPE8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Novosphingobium sp. ST904] (length=723 residues).
MSAAFEKLPVSNLRGVDAAPSTTSGPDGSKLIDLSWLAMLAWRHKWAMLAVIGCALAATLAAYMLAVKQYDANVVLALDR
NDQQLVRTAQTDKDTAVDSPTVDTEVQVLLSPEVATAAVRNARLNTNPAFIAAGAPDIAGPLSIPAATAIVRSNLTVGRQ
GLSYAINLGYKSRDPAVAASVANAVADAYVSGNVQSEQSARSQDINMLRTRLDQLRGDVIKAEAAVAAYRAKSDLVSVSN
DSTIAQQELSTLNTELASAKAELAASQGRASANAGENGTAVNSSPVIRDLRTDVSRLEVKLAEQSSVYGPNHPDRVKTQA
QLTTARQALSREVSRASSGVRSDISVDSQRVGAIQSAIGSAKGRLLAGNNASVRLNELERVAESSRQLYQTFLDRYRVEL
ATRGTEKSKAQVIARAQVPVRPSSPDLLVYMLGGLIAGIIAAVLLAMALEWRERGLRTRAETEEFTGYEVVSSLPDIGTM
DEPDFRRNDALGVPDFVVEHRESPFSESVRAIWTALKIGHKGQLARSVGVTSSIPGEGKTSTAIALARSTALAGRRTLLV
DCDMRRMGTTLALGLRNRPGLVEVLNGQARIEDVIVLDEASGAHVLPLNTELTAQSDIMHSQATAAMFDRFRQEYDFVVL
DIAPAIPVAEARAIATMADLTLMVVRWRTTQRKVVKTAIRELDRAGARIFGIILTQVDTRSSAVLSEEMAYYQYYYSRES
RPN
>gnl|bykdb|A0A0N1F054 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudoalteromonas porphyrae] (length=745 residues).
MNAQPTALAANKQNTAQQASQEIDLMALLGALIDRKYFIIALTAAFMFIGVVYAVLSTPVYQATAMIQVEDGSGSVPGFD
DMAGMFESTSAAVTEIELLKSRSIIGEAVDSLKLDIIVVPKLYPFIGGRAFRKFTPLAEGELAEPSFGASSYAWGGESVD
VFRFDVPNSAIGRGFTLVAQVNNGVALLDGESEQILAGKVGQELTNGQFNLTVRSLNAREGTEFTILRKDRLNTILDLQA
AIGASEKGKDSGIINLSLQSTKPAYAEKVLDKVAGIYVRRNVERNSAEAKKSLDFLEVQLPEIKKQLEFAEQRFNDYQIK
RQSINITLETQGVLEQVVKLETKLQELELKRLEMSRKFKRDHPTYQGLIEQISAVNEQKKELVGEVGNLPETQQELLRLK
RDVEVSNQIYTLLLGKTQELDIVRAGTVGNVRIIDSAEVNTSKPVKPKKALIVVMATMLGGMLAVAIVLVQKAMHKGVED
PNEIEAIGLPVYASVPYSDYQDKLTGFSKALKNKVNKPKSVLALDNPADLSIEALRSLRTSLHFAMMEAKNNIIAISGPS
PGVGKSFISVNLAAVLAQSGKKVLIIDADMRKGYLQTQFGLKWNDGLSDYLSGRLNLTQVTKPTTVAGLSVITRGQIPPN
PSELLMHSNFSKLVAEVSAEYDIVIIDTPPILAVTDPAIVSAHTGTTLLVTRFGQNHIKEIELTRNRFEQNGIDVKGVVF
NGVLKKASNAYGYYGYYNYEYKSDK
>gnl|bykdb|A0A0N1F108 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Novosphingobium sp. ST904] (length=721 residues).
MNINDRFAGAYDAAGFGGVDLNLNAIRAAIIRNRWILIGTAIACLLVGVLVAMLSTPIYEAKTTLQIEQQAPQVLGNSGQ
SLDESGRDDSYIETQVNLLSSRSLVERVARAQNLFRDATFFTRMDRDPPTSAPGSEGWQRAVIDMLQSNLSVELIPGTRL
VEVHFTSPDPKLAQIIANEFGVQFINSTLKRRFDTSDYSRKFLQDQIERTRVQLERSERALIIFAQQAGITEVDSGGSGS
AAGGSGSKSLTDSNLEAINAAYAKASTDRILAEQKWQQASRSPLLQIPDVLSNSSIQGMMSSRGEKAAVLQGEMQRHAEA
YPTVIKAKAELAAIDAVINNAAERVRGSIRDQYQIAVDQENSLKSSVEEMRQKSLAEQGRGVQLSILRRDADTNRALYDA
LLQRYREINAASGVTINNISVIDKAEIPRSPVWPKPLFNALIGAIIGVVLGVLIALVRERLDDSIRSPDEVERKFGLPLL
GLLPLSKAGSVRDELNDPGSAFSESIYSIRTSLQMATAHGLPRTLAMSSTQQGEGKSTTSMAIAREIAQSGSRTLLIDAD
LRRPSLHALFDLKNDQGFSNYLTGQAPFDGLIVQTDTANLSVLPSGPLPLSAPRLLTHEVLVPALAELGKYYDVIMLDCP
PVLGLADALQLTSCVEATLFAHEAGKASQHQAQTALRRLARGGANLIGVILTKFDFDRGGHSSYGYTQYYYQYTAGGEGK
N
>gnl|bykdb|A0A0N1F709 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Bosea vaviloviae] (length=753 residues).
MLQSKIDAPGSSFPIASSREAMDALVGIVRRQMPVFIITIGCIGLLALAYLLTTPSKYAASGLMLIDTRKVQLVQQQQQV
VGDAPMDASSVQTQIEVLKSENISLAVIKKLKLDEDPEFIGTGGGLLTGVRSLFSQFLPPPAEPSQYRLQRNALRYFEQN
RLIARVGLTYVMELRFTSTDPEKSARIANAIADAYSVDQLEAKFQATRNASVWLQERIQTLRSQVATAEKAVVDFKAQNN
LVSSNGRLVNDQQLSEINTQLVTAQAASAEAKARFDRIQEVLANPLAEGIVNDAQRNEVIVKLRQQFNELQSRESIWAQR
YGRDHLAAINLRNQMQEIRRNISEEYQKIAQGYRSDYEIAASREAALRASLATVIGETQSTSQSQIQLRELESNAQTYRT
LYDNFLQRYMESVQQQSFPITEARLISPAAVPLVKSEPRTLIVLVIAGAFGVIASFGIAFLREFSDSAFRTTAQVEETLK
ATCLGILPALSLKAAKRSGPAPKPDQRLISVADSINSYVVDAPFSPFTETLRSLKVNVDLAPHRQSNSVLGFTSTLPGEG
KSTISSNFAELVAHGGARCILIDADLRNPTLTRSLGPHAKKGLVELVAGTAKLEEVLLRDDRTGLFFLPTGDTRRIVHTA
EFLGSEGMHAVVQDLRQMYDYVIMDLSPIAPVVDARMTTRFMDSYIFIVEWGKTKADVLEHAIANAPEVYDKILGVVLNK
ADMRKLGRYERGRSDYYMQKYYGRYGYLTNDRA
>gnl|bykdb|A0A0N1FBS5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Komagataeibacter intermedius AF2] (length=724 residues).
MSWTAHDVGLVIRQTVRAFLRHRMLFILTTLGVVVVGGAVMLTLKPRYTATTTVVVSGRAQQDPLAPNGQQQNLAPPDDE
LVSTEAAMIHSRDVAAAVMAQLPPPAAPPHVGLRDRLCHMGIGFLCHASAPVDPQVQREHEEDAFLNNLTVTPEPRTQIL
DINVVDGNAERAAALANAVVTNYQRIALARQTGDINRVATWLDNRTAALRQRWLDAVQKANTFDNVHGLTNTNEGSTSTP
LIERQIADTSANLSQAEGRLAAAQARADALRDAAARGDARAAVALSQEPILVATANALMQLQSTRQEEAATYGPQHPRLR
ALDQQIATTRASLEAETQAALSTIREDQISARAEVQRLNENLDLLRQKAGGQSAPQAEYRTLDQEAQSARAVYETFLEHA
KEVVDRAALLQPPISVVSHASPPDVPSFPNRKKIGLGLIAVALAAGAGAVLLRDYFAAGFTEIERLRAAVPLPLLAVVPK
VGGRTEQAVRRHVIDHPYSRATEAVRSLVMQLSMRVHEGGQPLCLAITSAGPEEGKSTLALWMATIARRGGQKVLVIDAD
HRRGMLDQYLADGTTGRPSLGMSDLVTSGVPVADVIRTDPDTGFDYIPAGRTMQHAFSPVEIRRLRTILTELKRSYELVI
IDCPPLLGLSDALVHANMADQVIFVCRWKSTAQRAVMACLERLEACGAPLAGVVATMVEDNAMDVMGYSYGNRDIKILSR
FDDK
>gnl|bykdb|A0A0N1KKW8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia sp. ST111] (length=743 residues).
MNLIDTPPMEAVAEDENREFFDVLDTLLENRKMIALVTSLFLIAGIAFAILARPVYEARIMVQVEDSPDASAAKSLLGDI
SSIFDVKSSAAAETQILSSDLVVTSTVNNLRLYIQAEPTRFPLIGDFIARHTDGLSTPGIFGFGGYAWGEESIDVPLFNV
PKRLLDKKFTLTILPSGRFSIDAWALDKRLEGVVGVTQHFRTAQGDFDILVARVAANAGTAFSLIRTSPVEAVSDLQKIL
DAQEKVKTSDVVVATLRGYDPVLVAKTLNEIGTQYIKQNVERKSAEAAQSLDFLRSQLPQLKDQLRDAESRLTKLRDQHK
TVDLTEEAKLALAQSADAKTRLLELQAKRQELVSRFADTHPSVVAIDAQIASLSSYRGDADVQLRKLPELQQDLVRLMLD
VKVDTDLYTGLLGNMQQLDLVRAGKVGNVRLVDVSQVPEIPVSPKKPLVIIIAFIFGLLVSCGIAIGRSMLFRGITDAND
IERRLGLAVHAIVPLSQQQKRVSFLSKKSGESENLLSVVFPNDPAIESLRSLRTATQFSMLDAKNNVLLVAGPAPHVGKS
FIASNLAAVLAAGGQRTLLIDGDIRKGRLSDVFHVSRERGLSELILGSVDISDVIHQNVIPGLDLITTGTLPPNPSELLL
SKRLSQLIQKLSGLYDIVLIDSAPVLAVTDSTTLGAFAGTVLLVAYSGATKLGELAESKKRLAQSGTRVNGVIFNGVNPQ
LGRYGYGSRYGNYRYTAYEYGSK
>gnl|bykdb|A0A0N1LT16 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Novosphingobium sp. AAP83] (length=740 residues).
MDEKVQARMSEANSRESWVDQYLPRTDGAAIDRTGNLISLETIRGLAFRQRNLLIGVILAVLVLSLVATLMTKPVYQASA
TVQVDSSQANIVEGQDLEPAMRGGEFSRYMSTQGAVIMSKRMAYQVVDTLKLADNDELLGDAATTRPANLSDEKWKARRR
EIAAAILKGGVSVVVPDDIRILTISFKSENPRLAASIANAYVDNFVLEDTRRGIEISTYAQNYLTTQIREIGNKLQNAEM
AANAYAKANGIIATTAPAAGDTNGASPPATITVATLGTVSGTYTETRNRRIAAEQRWRNAQGLAASQLPEVQANNAIQAL
VAERSKVAAQISELRQRYGENYPQVSEARATLTSLDSQITRLSTDVKNSIRDQYQLALRQEEALSGELKKVSGDTLDEQD
RRVRYNLLDREAAALRTQLAALLDRYNQVAAAANIQQGAITKVDDASVPGAPISPNLTKNLLAAMVVGIGLAVALAVLRD
SLDDRLRSVDDVERKLGTPLLGFTPNVESMDVEAQVADPFSALMESYSSLRTSLDFAQSGDNRVLMVTSSQPSEGKTLTA
TVLARKYAELGHKTLLIDADLRKPTVSAMFGATKRPTQGFVEVLLGDIDLQSALIKGTIDNLSVLPVGSIPHNPVEILSS
PRLAEFIQKCRGDYALIMIDSAPVMGLADAPLVSRLVDGVVFIVEANRSNFGQTKTALRRLRSVGANVLGVVLTKYRSAE
AGLSYDYHYNYYSYGHGKKD
>gnl|bykdb|A0A0N1MC43 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas sp. RIT-PI-q] (length=741 residues).
MQQAPVLNVQEDDNKEIDLLGLVGTLIDHKLLISVVAGAFMVAGAAYAVLSTPVYRANALVQVEAKKNDMLGFSDISSML
GQESPSVTEIELIKSRSVLGKAIDNLKLDIDIEPNYFPLVGEFISRRFNPDNPQDVAAPLFGLSSFTWGGEALNISELEV
PSSLLGETMTLIVGENGTYSLLDEDDNVLVKSRVGETVEQDDIKIKVDTLRANPGATFNVTRQPRMATIIEYQKALDVFE
RGKDSGILSLALEDVDADKSIRTLNEIIKLYVRQNIERTSAEAAASLDFLKEQLPQVRKDLERAEKALNQYQIRSKSIDI
SLETKAILDQIVALDSSISTLKLQRAEMDRKFTEQHPAYRALMMQLSELTSKQNSLIKKVEGLPATQQELFSLTRDVQVG
NEIYTQLLNKSQELDVMRAGTVGNVHLIDEADVDQSKPVKPQKALIVLTMTLLGAFLAIAIVLVRKALNRGLETPEAIEQ
LGLPVYASVPYSSLQKAEEDKRARGRTNGAKTVHLLALSHPTDLAIEALRSLRTSLHFATLEAKNNRLMISGPSPAVGKT
FVSVNLAAVIAQAGRRVLLIDVDMRKGYLHKMLGTGAENGLSDVLSKQCALDKAIHPTDIKGFDFISRGRIPPNPSELLM
KANFAELLDEVSKNYDLIILDTPPLLAVTDAAIVGRQSGTNLIVTRFGLNPAREIELTMRRFSQNGIELKGAIFNGVEKR
ASAYGYGSYGYYHYDYKSDNA
>gnl|bykdb|A0A0N1QYA9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Salmonella schwarzengrund] (length=719 residues).
MTEKVKQSAAVTGSDEIDIGRLVGTVIEARWWVLGTTAIFALCAVIYTFFATPIYSADALVQIEQNAGNSLVQDINSALA
NKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVTKNTFPLFGAGWERLMGRHNERVKVTTFTRPETMSGQIFTLKVLGDKR
YQLVSDGGFSAQGVVGQPLNKDGVTMWVEAIDARPDTEFTVSKFSTLGMINNLQNNLTVTETGKDTGVLSLTFTGEDRDQ
IREILNSITRNYLQQDIARKSEEAGKSLAFLAKQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQLN
ELTFKEAEISKLFTKAHPAYRTLLEKRKALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITEA
STVGDVRIVDPAITQPGVLKPKKALIILGSIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARDS
VKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMLTGVSPSIGKTFVCANLAAVISQTHKRVLLI
DCDMRKGYTHELLGTNNVDGLSDILAGKGEIASCAKPTAIANFDLIPRGQVPPNPSELLMSERFGELITWASSRYDLVLI
DTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFDQNGIQVKGVILNSIFRRATGYQDYGYYEYEYQSDSK
>gnl|bykdb|A0A0N5ED36 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella pneumoniae subsp. rhinoscleromatis SB3432] (length=722 residues).
MTSVTTNKPATPDSDEINLGRLIGELIDHRKLIIAITTGFTVLSVLYALLATPIYQADALIQVEQKQGNAILNSLSQMLP
DGQPQSAPEIALLQSRMILGKTVDDLNLQAQVRPKYFPLVGRGLARIMGDKPGNIAISRIYLPSRGDDESAPKVILTVKD
DKHYLVEGDDFSANGTVGTLLNEHGISLLVNSIDAKPGDKFTVSQLTRLKAITDLQEIFSVADQGKDTGMLELTLSGDNP
ELISRILDSISQNYLTQNIDRQAAQDAKRLEFLNEQLPKVRSDLDIAEDKLNAYRKQKNSVDLTMEAKSVLEQIVNVDNQ
LNGLTFREAEISQLYTKEHPTYKALMEKRQTLQEEKSKLNKRVSSMPSTQQEVLRLSRDVESGRALYLQLLNRQQELNIA
KSSAIGNVRIIDNAITEPDPVKPKKVLVVAIGIILGLFVSISLVLVKVFLRRGIESPEQLEEIGVNVYASVPVSEWLAKN
NRKSKQLRKNESDALLAVENPADLAVEAIRSLRTSLHFAMMEAKNNVLMISGASPNAGKTFISSNLAATIVLTGKKVLFI
DADLRKGYVHKMFGRKQDKGLSEILAGQVAAETVIEKVTGGEFDYIGRGQIPPNPAELLMHPRFEKLLKWATQVYDLIII
DTPPILAVTDAAIIGRYAGTSLLVARFEENTAKEIEVSMKRFEQSGVIVKGCILNGIVKKASSYYGYGYNHYGYSCSDKK
HY
>gnl|bykdb|A0A0N7I8S6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Azospirillum brasilense] (length=747 residues).
MGPDFRFILRVLGSHKWLIAAIVVVLTGLSALGVSTLKDQYTSEALLLVDNRQVRVVREVEQVVGAIPTEDAAILSEIEI
LKSPQVLNQVVNDLQLAQHPEFNPPAQEDETLPLVERAVAYGRGLADRFWDGAPPAPVAWLLSHGDEVAQDIRAREAHAA
LGNDQIIARIHRKLDVAIVGRSRVIQVRFTSKEPQLSRDVVDGIVRRYMETRQQMDRDLSTSAISWLQDRIVLLRREVAE
ADSKVEEARVKGGLLKGGTGLMAQNELEQTRLRLSEASAIRARSVAQADTLERNLKAGNWNAIGGSIASPVVAQLRATVA
AISTEMAQLSRQYGPKHPRIVELQGRLNEANSSLQQEIRREINGVREAAQVAVEQETALRSMITRMEGSYATMQEQAIPL
RTLESEATAKRQLLDSLLGRLEEVEAQKDSRAFPAAVKLVSAPQVPHEPSGPFRILLLLAGFVAALALAIFSVFGLELLQ
RRIHTPDAVRRILGVGTVHIVPHHSDRGAKGRLYKIFQRHPFSLFSESLRALFRNHLSDLGPVGALAVTSARPQDGKTSL
TLAVAQVASQAGRRVVVVDTDFRRSRMEGLFDLSTKKGLSDWIAGDATLDEIVHTSDDVPFAMVPAGKLNPMTLDRFNVD
SLVQLMAGLSPSFDLVVFDTAPALAVSDARIVCGAASKVLFVTRWGHTTASDLDAVADLGPIDHSKFVCVMTDVNLKKAA
SKGYQGPYNSYVATRKYYGDQTLRAAP
>gnl|bykdb|A0A0N7KWF6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. 1756/51] (length=718 residues).
MTSVIKNNSPTTDSDAIEIGRLIGELIDHRKLIIAVTSAFTVLAVLYALLATPIYQANALIQVEQKQGNAILNSLTQMLP
DAQPQSAPEIALLQSRMILGKTVTDLDLQTVVKQKYFPIIGRGLARALGESNGKISITRLYLPGSDDADAPKVILTVIDN
EKYEITGDDFTVHGKVGELLEDKNISILVNEIKAEPGTKFNVIYRSRLKAINDLQEVLSVSDQGKDTGMLTLMLSGDDPA
LISNILNSISQNYLAQNVARQAAQDAKSLEFLNQQLPKVRSDLDIAENKLNAYRQMKDSVDLSMEARSVLSQIVNVDNQL
NELTFREAEISQLYKKEHPTYKALIEKRQILQEEKNKLNKKVSDMPTTQQEVLRLSRDVESGRAVYMQLLNRQQELSIAK
SSAIGNVRIIDNAVTEPKPIKPKKLMIVAIGVFLGLLVSVGLVLLNVFLRRGIESPEQLEDMGVNVYASVPVSEWLTKNV
GKNKRRKNESDALLAIENPADLAVEAIRSLRTSLHFAMMEAKNNVLMISGASPNAGKTFISTNLAAIIASTGKKILFIDA
DLRKGYVHKMLGFSESAGLSNILSGQKKIEDVVTTVKNAGFDYISRGNIPPNPAELLMHPRFENLLTWATNNYELVIIDT
PPILAVTDAAIIGKYAGTTLLVARFESNTVKEISVSIKRFEQSGIAIKGCILNGVVRKASSYYSYGYNHYGYSYTDKK
>gnl|bykdb|A0A0N7KWH3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. 4463/52] (length=715 residues).
MSQVNEKTKDNDEIDLGRLIGELIDHRKLIISITTLSTLIALIYAIFATPIFQADALVQIEQKQGNAILNSLSQVLPDSQ
PQSAPEIALLQSRMILGKTVNDLNLQINVQRKYFPLIGRGYARLTGQSAGEITVGMLHLESQDQTETPDITLKVADSQKF
IIEYNGNEVSGNVGELIKKAGLTIRVDSIDAKEGSVFEINYVDQLKAIRNLGTSFKVTEQGKDTGILSLTLTGENPKLIA
TILNDISENYLAQNIARQAAQDAKSLDFLNEQLPKVRTELDIAESKLNEYRKQKDSVDLSMEAKSVLDQIVNVDNQLNEL
TFREAEISQLYTREHPTYKALMEKRKTLQDEKNRLNKKVSVMPSTQQEVLRLSRDVESGRAVYLQLLNRQQELNIAKSSA
VGNVRIIDQAVTNPKPVKPQKIMIVLIGIVFGLFISMGLVLLRVFLRRGIESPEQLEEAGVSVYASVPVSEWLMKNIDKN
KRKKNESTILLTAENPADMAVEAIRSLRTTLHFAMLEAKNNVLMISGASPNAGKTFVSTNLAATIASAGKKILFIDADLR
KGYVHKMLGGEQVGYGLSDILSGQKDVNSVIKNSREGGFDYIGRGQVPPNPAELLMHTNFKKFIEWASKNYELVIIDTPP
ILAVTDAAIIGQYVGTVLLVARYEENTVKEITVSIRRFEQSGVAVKGCILNGVVKKASNYYGYGYHDYGYTYKNN
>gnl|bykdb|A0A0N7KWJ1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. 26] (length=719 residues).
MSSAKNKTAVKDPDEIDLGRLIGELIDHRKLIVSVTSLFTLLALVYALFATPIYQADALVQVEQKQGNALLNSLSQILPD
SQPQSASEIALLRSRMILGKTVDDLNLQAKIEENYFPVFGRGLARLLGYKPNNLKISRLYLNIPGEDVPEIEIKVLDNKK
FSITGDGIELTGTVGELVEAKGLSLLVSEIGAEPGTTFTVSYIPRLKAITNLQDNLAIVDEGKDTGILTLSLTGDDQAQI
KNIIDGISTNYLAQNIARQAAQDAKSLEFLSEQLPKVRSELDLAEDKLNGYRQQKDSVDLSLEAKAVLDQIVNVDNQLNE
LTIRESEVSQLFTKEHPTYKALMEKRKILQEEKSKLNKRVSAMPETQQEVLRLSRDVDSGRVVYMQLLNRQQELSIAKSS
AIGNVRIIDTAITQPKPVKPNKVLVTLLGLIIGLLVSVGLVLARVVLRKGIESPEQLEELGISVYASVPISEEFAKRVER
TNKIKSRKPDEVAVFLAVENPADLAIESIRGLRTSLHFAMMEARNNVLMITGASPNAGKTFISSNLAEVISQTGKKVLFI
DADLRKGYTHKLFNIDNNNGLSDILSGKTTMDLAVKNIPNIGFDFISRGMVPPNPAELLMHKRFGELIDWANSRYDLVIV
DTPPILAVTDAAVIGNYAGTTLLVARFEQNTAKEIEVSIKRFEQSGVNIKGCILNGVVKKASNYYGYGYNHYGYTYTDK
>gnl|bykdb|A0A0N7LZV6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Epibacterium multivorans] (length=749 residues).
MNNLTSKQLGSTTGYAPSSSGARDSVDYIDIHRVLRGLRRRIWLLIFVAIAAAGAFAGIASLQEPQYESSATLMLDPREQ
RALGNQTQVVQHLKLTSPIVDSEVAVLRGQSLQMRALELVLGDPELARRYYAIDPALQPPGLVDRLQSIASSALSQLFGS
AATAGPEPIAEPRDESADLDGRKKRILGVLRKGLSVHRIGESYAINLRQETADPELSATFANALAAVYIQEQVENRRKTM
EEVTGWLQVQVDASGRELERAEEAVRDFRVADSWNSKDVLRQQLDEMKVQIAETRADQVTKRAWLQTVASLADENEIMVI
AQQQGSSLLQQLHNELEALLREDVRLSSSLSADHPDRRNLAVEMARLRANIDDAVLSYSAGLQSEVEVLHLREKDLEVEI
AAMDHKLEQLELTDISFRQLERKADAARISYENLLARLGEARAQVTFERAEAKVIDPAEISLVPSSPKVKLMAAFGAALG
LSATLIFIVLREFVSAGFTQANELENHFALPVLGSIPHVRMKKPFAVIAKMNMDRFSPLAERVRQISAILGQKNKSGDTL
TMVVMSSLPDEGKTTTAMAMAYTYASFDKRTVLVDLDTRCAEAMPALTQGTGPDLSSWLEKGGDPSACTYPSQQGDFWVI
GNRNGAGNMVPPPSRDEIRALLTELSKNFDVIVVDAPPLLVLSDGLAIAKEVDHILMNVRYRKTAKQSVATALALLEKVG
ERPTGLIMTMTDAKSEPQAYGYGYSYGYS
>gnl|bykdb|A0A0N8FUU8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas sp. RIT-PI-r] (length=742 residues).
MQLPSVIGTRDNDQDSIDLLGIFGSLIDQKWLIGALTGAFMVTGVAYAVLATPVYLANALVQVEPKKNDMLGFSDLNSML
GGQSPSVTEIGIIKSRAVIGKTVDDLRLDIDVTPNTFPMIGGFLARRYRGETETSVAAPRFGLNSYAWGGERLEFARLNL
PKELLGKKLTLIAGEQKHFQLLDDNDNLLVDGVAGEAFAQDGIEGQITQLQANPGTRFEVVRNPRIVTIQGYQDALDISE
QGKESGIIKLALASSDAAEAVKILNKIAALYVDQNVRRTSAEAAQSLAFLRSQLPQVKRDLAKASDALNAYQTHGKTVNI
SLETQSVLGQSVALETRISELKMQQAEMDRKFTKQHPAYRALMSQIGELTQQQKSLEGKVGDLPATQQELLNLTRDVEVA
SQIYTQLLNKSQELDIVRAGAVGNVRLVDAADVDLTSPVKPKKALIVLIATFLGAFVGVALVLLRKSLSRGLEGPEAIEQ
LGLPVYASIPYSALQDEEDNKKGRARDGVDKPAYLLALRNPTDLSIESIRSLRTCLHFAGLDSTNNRIMISGPSPQVGKT
FVSSNLAAVMALSGQRVVLIDADMRKGHLHKTLNTPITNGLSDLLVKRCSIDQAINKVEIDNLHFISRGQVPPNPSELLM
HANFRDLLAELSERYDLVIIDTPPLLAVTDAAIVGREAGISLIVTRFGVNPAKEIELTIRRFAQNGIELKGAVFNGVEKR
AASYYGNGGYGYYNYEYASDKS
>gnl|bykdb|A0A0N8QGJ7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. apii] (length=753 residues).
MTVMSRPTLDYYQDARIDLATVLRILFDQKALILWTVGLFFLIGLAYAVLSTPVYQANAMIQIEPRKIGIEGTPEVSGKP
LSVSQATTEIELIKSRALLGKVVDDLQLNVLQKPDLFPVIGPYLYRTFAPPQDGALAEPLWGLSHYAWGGEKIEVFQLEV
PEHLLGEKLTLTAGKPGQFALYDSDHNRLLGGAVNRVIEGNGVKIQIAALLARPGTDFTVSRQRTLGTALIYQNRLKIAE
AGRDSGIIYLSIEDQDAQRANRILDQISRLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESEAALNAFQTSSRSVDL
SIETKGLLDQVVHLDSMLSELKLKRVELERLYTREHPTYRSLMSQINQLEQQKQGLLKKIETLPMTQQELLRLTRDMQVT
SQTYTLMLNKSQEQDILRAGNIGNVRVIDNADSNIEKPVKPMKTLIVLIATLLGALAATVIIFVRQAFYRGVESAEVIEN
LGMPVYASLPYSRQQERLEKRGKNTQGKNMPGEERHGKDSQSVQVSRLLSIAAPSELAIESLRSLRTSLHFAMLEARNNV
LMISSPTPGAGKSFVSSNLAAIIAQTGKRVLLIDADMRKGYLHRLFGLQPKHGLSDTLAARLRCTEVINPTRIRHLDFIS
CGFAAPNPSELLMHDNFHKMLAELSPLYDLILVDTPPILAVTDATLVGRQAGTCLLVARFGMTTVKEIEACKRRLGQNGI
LIKGAIFNAVVRKATTSDYDCAAYGYNYHPAPR
>gnl|bykdb|A0A0N8VAR8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio metoecus] (length=737 residues).
MTGKQFTQEEVIDIRQYFNVLLNYKWRILLFSIMVTAITLLFVLSMRSEYTARATILIESTQAKAVSIEEVYGLDTKSQE
YYLTQIEILKSDTIAQEVIDRLDLASDPEFDLNPESEQSPSLKERLLEWMPFLQGFKQQEVVIDPELEAYRGNRLILYKF
KRGMEISPIRKTQLVNIYYTAGDPKLAAKIANEIARVYMDSHLEAKLEVELKANTWLNTRMEELRTQLRESEAKLQAFLQ
SEGLVDVQGVEGLASQELEELTSQMNKARDRRVAAETLYQVANSYSKNDSDLTALSSIPEISNHPTIRDLKVAEVDAERK
VSEFSKRYGPKHPKLKSATAQLDAVRKNLRSELKQLLNGINNELQAAKQSERSLQTEFNQRKSEFQTLTVKNAKYSELKR
EVQTNRELFDLFLARQKETSASGDFNTTIARFTDQASAPLVPSKPNKKLIVMLAFVVSFGFACVVAFIADAMSDTFADIK
QVEKQLALSLLGVVPAVRKRNGKLDAKAYFDTELRELTEAVRTIRTSYLLAHVNQEQHVVMLTSCLPGEGKTTSSINLAL
SLAQMEKTLLIDCDLRKPAIAHRFAISGSQPGVTNLLTGTQSFEDCVYHDEQSGLDVLTAGVYSSNPLELLSSTKFSELL
ADLRGQYQRIVIDTPPCLAVSDSFMLAQHVDSVILVIDANHTRTQVVREVVGKLTQQGSRIDGVVLNRLNAKKASRYSGY
YHYQAYYGEDHKSSATQ
>gnl|bykdb|A0A0N9UEX2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingopyxis macrogoltabida] (length=728 residues).
MNQLTETRETPLGDAQPFQGDASDDALRQELPIIEQIWTAALNHRNLALAIVAAFLVLGFLATFLATPQYTSTTRLEILP
DVPVATSVEGQRDKALVNEVAFYNTQYSLLQSESLAERVVRAGNLTADREFLGAFKLDDPDASMTSAQRQNRTRQIAKIL
LAQQAVSPVRNSSLVDVSFSTPSPTLSARLANLWAKQFLLASIDRRFAATSDARKYLEARLASLRQNLEASERALINYGT
GKGIVTISSQTDVNGRTQTQTLVASDIEAISEALAKARELRIATEAELSNTLTGNAATNATTISSLRQKRAEVAAELAQQ
QTIFADGYPTVISLRAELENLDRSIAKESTRSSQGNREAYNAALKRENDLQAELDGLTQKYNVQQRDSIEMAILQREVDS
NRQLYEGLLQRYKEIGVSGVGTNNVSMVDVARPGESPSSPNLLLNLILALFLGIVAAAVLIFILEKMDSSIRDPQDVTKR
FGLPLLGTIPEIQDQTLAEAITDKKSLAYEAYFSLRTNLTFLTSHGAPRSIMLTSSRPREGKSSSSLCLATTLAATGKSV
VLVDADVRNPSQDKYLNVENKRGLSHYLAGDDDLDGIIMKMPSHGFSLITAGKLPPNAAELLDSDRLDNLIALLTRRYDH
VIVDAPPLLGLADAPLIARRVEGVLFTIEANSTKTRALATALARLRMGGAKIFGAIVTKVGAKNSAYGYGYGYGYGYGYG
YGSSAEKN
>gnl|bykdb|A0A0N9WBG0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter equi] (length=724 residues).
MNTKQNIEDHIDLKELFFSIIAHWLLILICIVLSLFIALMYLRVTPNIYSVNALVQVEEKKGTSAALLGDLSNIVDQKQP
AQTEIEILKSRLVLGDVIRHLNLDIAITGDKTSLLDRLIHKNQYITEYHAQSIIFNDDKKSFRIQKFIIPEKYLDHPLEI
HFKDNVFSLYDTETETKLIQLPLNQDHITRTVDGEWHLSIYTSDHHNSSYFITKKSFPRAINDILGHFSVAEKGKLTGIL
NLQYRGENREHITKVLNSILSAYNKQNIDRRTAETAQTLKFLDEKLPILLNELMVAERQFNEFREKNNTIDITKESELYL
TQSMQLDTQRAKLLQQVAEASSKYTDAHPVMQQMNAQLTALNQKIAELDGVLKKLPDLQHQYLQLFREVEVKQQLYTSLL
NSSQQLAIAKAGEIGNVRIIDTAIDPITPIKPSKLTIIVLSIFIGGFIGIMIAILRNFLRNGIKDAQQIENTFDIPVYAT
VPRSKTQLNWVKLRKHKKNQVIPILAVQNSTDIAIESLRSMRTALHVASKTAKNNIIMITGPAPEVGKSFTSTNLAVILA
QGKKRVLIIDADMRRGNLDQYFNMINQPGLAEYLNNQLELGCVTRKTNIENLDLITRGKSPHNPSELLNSNNFKKLLDHF
ATQYDYILIDTPPILAVTDGLIISQYVGMSILVARFAKTQIKELEIVINRFKQVDSQVTGIILNDIQKSTLGYNYSYTYH
YENR
>gnl|bykdb|A0A0P0AA32 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Celeribacter marinus] (length=704 residues).
MMNLESTDISGLMSMIKRQIRLMALSGAIIIGLVLVYLFNTTPLYTSSALIYVDPSKKDLLATEQFGSLSGLAENSKIES
EVEILRSNRVLFETMTQLRLVQDTEFGPRLSRFDQIKTALGLTTSSQGDPTKMVAATAVKLSDALRIQRKGLTYLISVSA
TSSSPQKAATIANTLSEVYIAQQVAAKTDAALSARDVLQAQINTAKTQLARSESGFDRFMSDNSARLKAEVGTDVFLELE
RQVTAARESTRQIKAQIETAQTARASKDWDALVTALSNDALAGLNAQRRQIELRLTGTQESAQTQESLRAALSQTQSQMD
QQADDAISSFQTTLTVRQNSLAEAQRAMRQEMMQGDLSPETLASLFEIQQEADIAQRQYTTLLSSLRSIEAQALVQVADS
RVVSDAIASSFPSAPNYKISLAIALIVASGVAFGLAIINEYFVGGVSALSQLRNLVSGPVIGLIPNVTITDTQLSIADLV
TDAPMSLFSEALRRARAHIDQGLRDHPSRCVVMMVTSANIGEGKSSVSLALARTYANAGKNVLLIDADLRRPSQHKYIGF
EPDEGFLEYLRDSRDKKEVGRSFYVADPKSQAAIILGRGNADLPTDQLLQTTAFCDLIESARQSVDIVIIDTPPVLPVVD
ARYIAPLVDAIVFTVRYGTTAQGDVRDATAQLEAAKKSDTPIFATLNADETQSMRGGYYYAEVE
>gnl|bykdb|A0A0P0DCC6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingopyxis macrogoltabida] (length=726 residues).
MKQNEASEALAWEADLAGQRKIGAKDFQETGALIFARIWAAVWSRRTLALGIIMSALLLGLVATFLATPQYSSETRIEIL
PDAPVATSVEGQREKALLNELSFYNTQYSLLKSESLAERVARAGNLAADKDFLEAYKLEGADASLGSGERQKLSKSIAAI
LLKNVNVTPVRNSSLVDVSFSTPSAKLSAKLANLWAQQFLQATIDRRFSATSDARRYLEQRLEALRQGLEASERALINYG
TSKGIVTIAAQTDANGRTQARTLVGADIEAISSALSKAKELRVAAQAELANTMTGSAAINAPSIANLRQKRAELEAELAQ
QRTIFAEDYPRIVSLRTQLASLDRSIVAETARSTQSNREAFNAASRREDELRAELEKLTGQYNQQQRESIEMAILQREVD
SNRQLYEGLLQRYKEIGVSGVGTNNISIVDRAMVSSSPSSPILLLNLALALFIGLMAAAATIFVLEKIDSSVRDPQEVAD
RFGLPLLGAIPESSQPVAEAISDKKSAIYEAYFSAMTNLGFLTTHGAPRTLMLTSSQPREGKSNSSLSLATVLAATGKSV
ILIDADIRNPSQDHYLSLPNQLGLTHYLAGDDNLDAMIVELPDKGFSVITAGKVPPNAAELLGSERLDQLVELLSARFDH
VLIDTAPLLGLADAPIVARCVEGVLFVIEANSTKGRAISLALSRLRMSGAKLFGAVVTKVGLRNQAYGYGYGYGYGYGYG
ATSEAK
>gnl|bykdb|A0A0P0EZE9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Azospirillum brasilense] (length=757 residues).
MATQDIQDQPQRRQSAPVPGPVSFDLSTAAASAVRRTTGMLLRHKLLIGTVIVLGTGIAGLVALRMTPLYTAQTLIMVEH
RKNQVMNYQEVVSGLSTELGALQSEVAILKSPAFAEKVVDKLGLMNDPEFNAALRPEQTNWFYYLNPKNWMPDSWWNSAR
GDRPEITLSPEEKTANERTSVVNSFIENLAVRPQGRSYVIAVDFDSEDPRKASLIANTIGEMYLVDQLDEKFKAAKRATA
WLEERITELRREAKTTGEAAEKYRAESGLTNANGETTLIAQQLAELNTSYVLARTKRQEAEAKLREVTTLAQSPRGVSAI
GDVLGSPLIQALRQQEVELQRKIADAANKYGARHPTLTALQSELRDLQGQIKADVGRIVQNLSNEVEVERGREAALKTNL
DQLQAQRNQQQESNVTLRTLERDAETSQTMYEAMLTRFQEIAGQTEIQQPDARIVSEAAIPLNPSQPNKKMIVLLALIAS
ATLGVLLAMLREQSERGFRSPHQFESATGVRSLGIVPAIGRRRRGTSPADYAIEKPMSAFAEAMQNLRTTLLLANPDGHQ
RVILFSSSVPGEGKSSIAAAFARICANAGQKTIILDCDMRRKGLHPMLGLENRHGLYEVLSGECAPNEVIQTDPRTGLHF
IASGRGSALPQDMLGSSRMHQLISRLALEYDRVILDSPPVLAVSEGKLLAALADQTVFIVHWGKTKRETAMAGLKEIVEA
GGEVVGVLFSQVDIRRHAQYEFPDSGRYHGYRRYYAN
>gnl|bykdb|A0A0P0F4J6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Azospirillum brasilense] (length=782 residues).
MNSSIGKGGTLPGHEAHASVLPDSLLQSGAGESSDVRSRQEATVFATLAVLWRRKLLLLTVILLGTATITYVMQSLKPMY
RATAMVQLDSRRVELAEFKSVVSNLTPEAPAVRSEVSIVGSRALAERVVEKLGLLNDPEFNPTLKAPDGADDHWLKRVTK
AGVGALPPEGNDVLRRIVQQATALFRADDGPVARDPDQARLLTIDTLLRRIEARNDDRSFTIIIEASSVDPAKAAAIANA
FGQAYLDYRTEMNRDLTERVNQWLGGRLIEAREAVRGAEEAIRNFRKENSLLELPPDGRNMVQQQMNEIATQLTAAQAQK
AAAEARVRQARDQTATNNAAAIPEVLASPLIQKLREAEAMLERRLAELQQVYGDKHQEIVNLRRGIGELKARIRDEVGKI
QKGLDADLEVARIREATLLKSIADLQEQQKGIEATGIQLRDLERAADAHRTLYRSLAERYEQTMALKNTGALDAHLSAPA
LPPIRPAFPQLRMSLGVGLVGSTALAVALVLLLERLSSGLRTPSQVERATGVPCLGMVPSLPRNEATWNLPLHPDSRRAR
EIGAFREAIQTVRTMACMPRKRGTPPKVLLVTSSIPKEGKSVLAANLARSLAGLGLNTLLIDADFRRPSIAKLLGYQPQG
SVADLLDGRVGIDDLIHQETTNLGVLGNAVGTPDAHDRISSQAMSDLIQWARHNYDVVVIDSAPVMLFSDALALSFLADS
VIYVVRWQHTPLDTVTAGFNKLKSVDSAVGGVVLSRVVASKHVKYGHKDDAYYYALHAPARH
>gnl|bykdb|A0A0P0P3K6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Caulobacter henricii] (length=739 residues).
MDGSSYETQHAPAPGAGAMSFDLNIAIATFRRRLRLFAAIALAVFVAVLLYTLQETPRYTATSQVMLDVRKEQVADMSAV
LSGLPADSSVVDTEVEVLKSRSLATRVVKSLKLAEDPYFNPYAPGAKGVSTWLPWVKTVVAPIAAVGSAEAQRQQEKVVD
NLLEGLKVRRAGLTYLISVEYTHTNPVEAARIANAFADLYLTEQLEAKFDATAKANEWLDTRVAELRDQLQVAEAAVQQY
KIANNLMSAEGATLTEQEISGLNQQLAAARAQQAESDARLNIARNQLARGSTGEDVGESLNSPVVQQLRKQRAEQSAKVA
DMSGRYGERHPDLLKAKRELADVDGQIQAEIRRIISNLEAQAQVARQRTGSMAGSVSASKGALAGNNRASIRLGELERKA
ESVRTLYESLLARFKQTSSSQGIEQADARVVSRAKIPTTPSYPKPSLNLALGLVLALGAGAAAIVLAEILMAGIFTEDEV
ERRIGLPYLGSIPLLSSTIEDSKVARTLTPPEYLLAKPLSTFAESFRKLRAAILYSKVGEAVKVIAVTSSLPGEGKTTTT
FSLARTLATSGSNVIIVDCDLRQSAINRFLPEVPALGLLEVLNGVCTLDQALIDDPSGAKVLALTKSAYTPRDVLGSPAM
LKLLAELRLRYDVVLLDTAPLLAIADTRILAPHTDAVVMLARWKKTPVKAITSALSLLQGRGVFVAGLALTQVDLKAQTR
YGYGDSYYYYKSYRKYYAD
>gnl|bykdb|A0A0P0QDE3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Serratia marcescens] (length=724 residues).
MIDKNRTSSLASKENDEIDFGRLLGTLVDHKWLIVSITSLFAVIGIIYSLFATPIYQADATVQVEQNEGNMLVSNLSQML
PNSLPASSTEIELISSRMIVGKTVEDLHLDTVVTQKYFPIFGRGWARLMGNKPGQVALSRLTVAEPLVESAIELEVIDDQ
NYVVTVDKDKIFQGKVGRLENASGVSMLVSEISAKPGTVFNVKKLTTLAATVQLLDDLTVEDKGKDTGVLSLTLMGDDPV
LIKRIIESISNNYLIQNVERKSEEAAKSLAFLKEQLPQVRDSLNTAEDKLNSFRQANDSVDLSLEAKSVLDTIVGVEAQL
NELTFKESEISKLYTKEHPAYRALLEKRATLQKEKDKLNQRVSKMPQTQQEILRLTRDVDAGKEIYMQLLNRQQELSITK
ASTVGNVRIIDTAVTQPKPVKPKKTLIVIIFTLLGGIASVAVVLLKSVLHRGIESPEQLEDQGINVYASIPLSEWQQKKD
IETLMRGNKKTNTRSKTLLAVGNPADLAIEAVRSLRTSLHFAMLEAKNNVLMVCGASPNIGKTFVSINLAAVIAQAGQRV
LVIDADMRKGYSHSLLNTDWHNGLSDILSAQTTMANSVRKTEIENLDFIPRGQIPPNPSELLMGARFNELIDWASKNYDI
VMIDTPPILAVTDAAIIGHRAGTSLMIARFASNTVKEIEVSIRRFNQNGIDVKGVILNAVEKRASSYYGDYGYYQYEYRS
NDKA
>gnl|bykdb|A0A0P0QG40 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Serratia marcescens] (length=726 residues).
MKNNALSVMVAEQDEKLEWERLVGPLWDNRWRIAVVTGVAGALGVAYALLATPVYQATAVVQVENQLSGDSLLRETLDSS
LGQNSATQDEVTLVKSRYVLGKTVDALGLTVRVEPDYFPVFGKGFARLSGEKTPVLDIGTLTTPADMQGEALTLTVRDGQ
HYELSHDGAKLFSGVVGQPVAQGEWGMTVSALDAAPGTSFTVVKVARQEAVDDLRKYLGVVPSGKDSGIMTFTLPSEDPQ
RAEAVLKNITDNYLQQNVDRKTEEAQRMLAFLQEQLPQTQTSLNNAETQLNQFRQQNDSVDLSLEAKSVLDTQVQLEAQL
NELTFKEAEISKLYTRVHPAYRALLEKRATLEAEKARLGKQVQTLPKMQQEILRLTRDVQVDQQVYMQLMNKQQELSISK
AGTVGNIRIVDEAETAIRPIQPQKLLIVLLALILGAAGTAAVVLLRTAFHRGINDIDTLEKRGINVYATVPLSPWQAKRN
REQRLLLPKSGGRRLPILAVAEPADLSVEAIRSLRTSLHFAMLEAKNNILMVSGASPESGKSFTSTNLAVVVAQAGQRVL
LIDADMRKGFLHRWLSDDAHQGLSDMLVGKVTTEQAVRKTAIANLDFVPRGQVPPNPSELLMHRRFADFLRWAGQNYDLV
LIDTPPILAVTDAAIVGNHAGTSLLVVRFEVNTVKQIETSMRRFEQNGVAIRGVILNGIVKRAATDMSYYNFAYPSHRED
RRQAEE
>gnl|bykdb|A0A0P0R857 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Paraburkholderia caribensis MBA4] (length=741 residues).
MAINFDNRYTDVSSDEMHLTDYLQAIVANWRSILMITLAITALGTAYAFVATPVYRADVLFHVVDKADNNNKQDGLQPLT
GMFDTKPSTAAEIELMKSRLVTEETVKSLHLDIAARPHTLPFVGGMLAPLMNGKWGIKLPPALQLPSYAWGNESIKVSRF
DTAKDMYDKDFTLIAGQNGDFVLNNPDGVAILEGRVGENVVRETPAGPITLRVDEMTGAPGTRYDLTRGSTLTTVERLQK
AMDIGESTLQSGVIRASLEGHDPKLTADIMNSMAREFIRQDVESRSTEAEHMLAFLDQQLPQLRKELDAAEQRYNTFRNQ
HGTVDLSEESRLLLQQIVDNKTKLVDLQTQRAEMSQRFTANHPAVAALDAQIAGLQGNLSKMGKSVQTLPDTEQTALRLL
RDVHVDTELYTNLLNSAQQLRIAKAGQVGDVRIVDFAEAADDPVRPKRVLVILISFGAGLFIGIVFAFVRKTLYGGVERP
DELEAALGVPVFAVVPRSEQQLRLQQDVMMRRRGLHVLAEQAPQDIAVEGVRNLRTSLQLSVDDKQNNVVMLTGSRPDAG
KSFLSVNLSALVASTAKRTLVIDGDMRRGDVHSHFGLQHQPGLSDVLRGGDLQSSIQRDVLPGLDVLTKGSLPSHPSELL
MSKRFETMLDELKKQYDFIIIDTPPVLAVTDSTVIGKHVGTTLLVIRHGRHPVGELAETAKRLRNGGVDLQGVLLTDVPQ
AGAFIGSGYRGGYYGYESIAG
>gnl|bykdb|A0A0P0R9G7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Paraburkholderia caribensis MBA4] (length=744 residues).
MKQREYLLEGSVDEGVLPPEGGYVGKLLDTLYEGRKTIVIIAALFTLVGLVYAMLARPVYQADMLIHVEDSDGAAKNALA
DVSSMFAVKTAASAEIEVLRSRMVVSRAVEATQLYINASPRYFPVVGRWIATHLSVSSWSGRGGYAWGDEAITVARFDVP
DRMHGARFIVTVKGNGAYTLEHNGMDLPGRVGETLHAEVPGGAIDLLVSAIDGHPGVTFELSRSSALAATLGLQSRLMIS
EKGKESSVIGAALEGDDPVKTSVILNAIGNEYMRQKVQRTQEEAEKSIAFLNQQLPELKATLERAEEEYNQFRSEHGAVD
LGAEAAALLQSSAQAQNRIAELRQQRAQLDARYMPDNPALIAMNGQLEEAEKAMAELAVQTKRLPPLEQSVLRLQREVQV
DTNIYTNLLNTKEQLRLAKAGKVSNARLIDSAAVPEGPIRPKRALIVVAGSLTGLFVGAALVLFKRRMNSGIAMVDEIEA
GAGLHVYASVPRSRVQQTLTRRLPDGVPGTCSVLACTASFDAAVESLRSFRGALEFALRDAPNHVVLLAGPTPMVGKSFV
SVNLAALLGASGQRVLLIDTDLRRGTLNASVGVRSSPGITDIMQGMHYESAVHRQIMPGVDFVANGGYVANASELLRHSR
FKRFVEWADREYDVVLMDAPPILPVADSGIVANLAGMVFLVARQGVTSVSELRESVRRFEQIGVPVRGVVFNDMTSRPGK
YGSEYATYGYASYSNAGGDAGNAN
>gnl|bykdb|A0A0P0RAE6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Paraburkholderia caribensis MBA4] (length=740 residues).
MSTQANPHLAIQARTEEEDVVLGQLLQVIIDDIWWLIGIAATIVAIAGFYCYVAKPVYSADAHVRVETSDNTSQALTQTQ
TGATISTGQSTIPTDAEIEMIKSRGVVAPVVHDMKLNFSIAPKTIPVLGSLAARLATPGQPAKAWLGLGSYAWGGEVADV
DSLDVAPALEGQKLVLTALDNQRYTLMTPDGQLLLRGQAGQPAQGGGVTMLVNKLVARPGTQFTVMRANDLDAIAAFQSA
INVQEQGKQTGVISISLEDQSPEHAAAVANALAQSYLLEHIRTKQADASRMLDFLKSEEPRLKSDLERAEAALTAYQSKS
GSINASDEAKVYLEGSVQYEQQISALRLQISQLEQRYGDDHPMIKAAQQQMAELQAQRTKYADRFRDLPATEVKAVQLQR
DAKVAEDIYVLLLNRVQELSVQKAGTGGNVHIVDAALRPGSPIKPKKALILSAATILGLIIGTGFVFLRRNMFKGIDDPE
TVERTFHLPVYGLVPLSAEQALLESAAVRGGTRQRAVLANAKPKDVCIESLRSLRTSMQFTLQDARNHIVMFTGPLPGVG
KSFLTINLAVLLAHSGKRVLMIDGDMRRGALEKHLGGSQDNGLSELLSGQIALDDALRATEIDNLSFISCGRRPPNPSEL
LMSPRLPQYLEGLAKRYDVILIDTPPVLAVTDASIIGGYAGSTFFVVRSGMHSEGEIADALKRLHSAGVHVQGAIFNAMP
PRARGNYDRSYAAVQEYLST
>gnl|bykdb|A0A0P0RCZ3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Paraburkholderia caribensis MBA4] (length=738 residues).
MTLLKQNSAVEQGDDEIDLSEIFNILRESWKLIALVAVGALLLGTMYAVLATPVYRADAVIQVDDDSGLSSINSKLSDLA
SLFQSTATADAEIELIRSRLIVGETVNRLRLDVFAQPDYFPLIGGAIARYRQDNGLIGLANPVIGLSSFPWGGEHIDISR
FDVPPVLYETKFKLRVLDAQGYELVDPDGNVTLRGHVNEDASGATSNGIVHLKVASLMARAGTSFQLKRFSTQQTVDEMQ
KKLDIAEKTKQSGIIGVKLDGHDAQRVTATINMIASLYVQHNVDGKSAQAQQMLSFLGEQLPKMRADLDQSEARYNEYRS
KSGAVDLDAQAKLLLQSVVDTKSHLVELQQQRADLVQRYTPSHPAVLAVDARIAELEHQQDQYDGVVSGMPKTQQEVLRL
MRDVKVNTDLYMKLLDSTQQLRVLKAGQLGNVRTVDFAVVPEQPVRPKKVIVTALALVLGLVLGCVVALGRRALNRGLES
PAEIELAIDVPVRAIISRSEKQAELERSVRRNPLWSRGVLAAIFPDDAAIEGLRSLRTALQFGLIKPDNNVLMITGPRAE
VGKSFVSVNLATVIATAGKRVLLIDADMRRGNVHSYFSFRNTPGLSEVLSGRPFAEVIHHQVVPNLDVMTAGAYPDRPSE
LLMQGRFGTMCKTISAMYDLVIVDSPPILAVTDPVVVGKEAGATLMVIRHGRHSAAELREATRHLASAGVSLNGVLLTDV
PRRGSTYGAYSEYRTKTS
>gnl|bykdb|A0A0P0SN54 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=726 residues).
MTTKNMNTPPGSTQENEIDLLRLVGELWDHRKFIVSVTALFTLIAVAYSLLSTPIYQADTLVQVEQKQGNAILSGLSDMI
PNSSPESAPEIQLLQSRMILGKTIAELNLRDMVEQKYFPIVGRGWARLTKEKPGELAISWMHIPQLNGQDQQLTLTVGEN
GHYTLEGEEFTVNGMVGQRLEKDGVALTIADIKAKPGTQFVLSQRTELEAINALQETFTVSERSKESGMLELTMTGDDPQ
LITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQRDSVDLNLEAKAVLEQIVNVDNQL
NELTFREAEISQLYKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVYLQLLNRQQELSISK
SSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGAVLARAMLRRGVEAPEQLEEHGISVYATIPMSEWLDKRT
RLRKKNLFSNQQRHRTKNIPFLAVDNPADSAVEAVRALRTSLHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSD
QKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMLDRMRQLLEWANDH
YDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVIKRASTAYSYGYNYYGY
SYSEKE
>gnl|bykdb|A0A0P0SX02 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQSSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDNK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHASPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAYRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGVKRYKQNQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A0P0URN6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][endosymbiont of Bathymodiolus septemdierum str. Myojin knoll] (length=730 residues).
MDTPTHTNQNLSLEGENEIDLQELFGTLVEEKWLIAIVTAVAFAVSLFYVLVATPIYRSDTILQIEGKPNNTLGLGGLNG
FSASSPTLAEIEIIKSRNIIGKTIDELNLDILVKPDYFPIIGAAIARRNNDKNITQDSSYTGYAWGGERIKIEQLTLSRL
LQEDGVTLVAQKNQTYDILNTQGEVLLTGTVGELAQNQDIAVFISELIARIGTEFSLSKGNRIQIVNNLKNIINVIELGK
KTGILSISLEGEDSALISRIIDSIANFYLRQNVERTSVEAERSLIFLQKQIPLIKDEMEAAEVELNNYRGNKRSVNLTLE
TQSLLNRIITIETQIAELEVKRSDLSKKYTDIHPIMVTLTNQEVKLKEQLEQINAKAHSLPKTQQEILRLSRDVEVATTI
YTQLLNKTQELKVVKAGTVGNVRIIDSAFTAEHPIKPKKLLIVFISTLLSLLVVIVWVLVRRFMNKGVEDSDLIEQNIGI
PVYANVPLSPSQTLLSKDRNTGKVKHAILCEQDPKDISLEGLRSLRTNLHFALLEAKNNIVMITGPAPSIGKSFVTINFA
HVVAQSNQKVLIIDADMRKGHIHEEYNISRSPGLSELIAQKVDTKKAIRNSGFKNVDIITTGNLPPNPSELLMHENFAKT
LERLSKEYDLILIDTPPLLAVTDAAIIGNLCGTTFVLLRYSAHSMSEIQATIKRLRQNNIEPRGFIFNALQPRVGYGKYA
HYHYEYKSKD
>gnl|bykdb|A0A0P0YPV3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044] (length=710 residues).
MSTGSQESDGIDLGRLIGEVIDHKGLIISVTFFFMGLGFLYAFLAPPVYEADSLVQVEQNAGNNFLSSLSDVLPTTPPQS
AAEIELIKSRMVLGKTINDLNLSVVIEEKTTPIIGQFLKKIRGDDGSKINVKYFNVPHDALDTKFTIKITGKDSYTINLD
DAGELKGQVNEPVSKNGFEILLTQIESPPGTEFSIKRKDTLQVLSDLNDAFTVADTGKDTGVLSLSLTGNDPEKIKTILQ
SITDNYLLQNIERKSEEAAKSLNFLDRKIPDVKNELNAAENKLNYYRQQNSSVDLTMEAKSLLDTMVQLDAQINQLTFSE
AEVSKLYTKEHPTYRALLEKRKTLEEEKNNLKKKINNLPETQQEVLRLTRDVQVGQDVYLQLLNKEQELSITKASTVGNV
RIIDNAVTQPDPIKPKKLLVIVVLTVFGTMLSLMYVIVKVAFHKGVQSAEQLEENGLNVYASIPLSDWQLKNVNNSRKKD
KKKFDVLIKENGADLAIEAIRGLRTRLYFAMLEAKNNILMISGPSPEIGKTFVSTNLAGVVAQAGQKVLLIDADMRRGYM
HHYFGGLPNNGLSEILTGRVDYEKAVVHTDIAGLDYIGRGEIPPNPAELLMGSRIEKFLEWASGKYDLVLVDTPPILAVT
DAAIIGRHVGTTLLVARFEKNTVKEIDVAKNRLEHSGVIVKGVILNAVTRKASNKYGEYAYYEYEYKSKE
>gnl|bykdb|A0A0P0YPV6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. F052] (length=724 residues).
MTERTKQTRQSSKKNDEIEFSRLVGVFIDNRWLIFGITSLCVFFGIVYALLAKPIYRSDALIQVEQSAGSNILSSLSDVL
PTGQPESSAETQLLQSRLVIGKTIDDLDLTTRLEYDHFPVIGKGISRIFGDSNKTAKESLSIARFTVPSELLNVSMKLKV
VDNNHYILDVPDVGKFDGTKGKVLSADGIELLVNDIDAEPGQAFNMTKWTIQKTVANILSNLSVSDKGKDSGILQVSYDA
ESEKEANLVLSSITQNYLLQNIESKSEEVDKSLQFLEKQLPAERASLDENEDKLNKFRQENDSVDLSLEAKSVLDTMVSV
ESQLNQLTFREAEISKLYTVQHPAYKALLEKRVILEKEKANLSKRVEQLPKLQQEILRLTRDVESGQAVYMQMLNKRQEL
RINKASTVGNVRIVDNPLIQDYPVAPKKKLILAISLFIGIIFSVCAVIVKLLLHKGIESAEQLDEIGVNVYASVPFSDWQ
SRNVQKRAKNDNRPEGLLAINNPADLAIESIRGLRTSLHFAMLEAKNNVIMITGATLEIGKSFTSLNLAAVIAQQGKKVL
VIDADMRKGHLHDAFGLTNKGTGLSAYLAGILDYDKVKSPTGIDNLTMIVRGSNPPNPSELLMGNRMTKLLEKAGAEFDL
VIVDTPPVLAVTDAVIIGALAGTTLLVAKFETNTVKEVEICYQRFERVGVEVKGVIINGVMKRATNYYSYGSYADYGYKY
ESDK
>gnl|bykdb|A0A0P0YPX2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. D5050] (length=717 residues).
MIDKLNSMSTGSQESDGIDLGRLIGEVIDHKGLIISVTFFFMGLGFLYAFLAPPVYEADSLVQVEQNAGNDFLSSLSDVL
PTTPPQSAAEIELIKSRMVLGKTINDLNLSVVIEEKTTPIICHFLKKIRGDDGSKINVKYFNVPHDALDTKFTIKITGKD
SYTINLDDAGELKGQVNEPVSKNGFEILLTQIESPPGTEFSIKRKDTLQVLSDLNDAFTVADTGKDTGVLSLSLTGNDPE
KIKTILQSITDNYLLLNIEKKLEKAAKSLNFLDRKFPDVKNELNAAENKLNYYRQQNSSVDLTMEAKSLLDTMVQLDAQI
NQLTFSEAEVSKLYTKEHPTYRALLEKRKTLEEEKNNLKKKIHNLPETQKEVLRLTRNVQVGQDFYLQLLNKEQGLSITK
ASTVGNVRIIDNAVTQLDPIKPKKLLVIVVLTVFGTMLSLMYVIVKVAFHKGVQSAEQLEENGLNVYASIPLSDWQLKNV
NNSRKKDKKKFDVLIKENGADLAIEAIRGVLTRLYFAMLEAKNNILMISGPSPEIGKTFVSTNLAGVVAQAGQKVLLIDA
DMRRGYMHHYFGGLPNNGLSEILTGRVDYEKAVVHTDIAGLDYIGRGEIPPNPAELLMGSRIEKFLEWASGKYDLVFVDT
PPILAVTDAAIIGRHVGTTLLVARFEKNTVKEIDVAKNRLEHSGVIVKGVILNAVTRKASNKYGEYAYYEYEYKSKE
>gnl|bykdb|A0A0P0YPX3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. D5050] (length=713 residues).
MTDNTKLGLSTANNHDEIDLRRLLGTLIAHRWLIIGITALFSVAGIIYSLLATPIYQADAMVQVEQNVGNLLVNDLSQIL
PNSQPGSSTEIELIKSRMVTGKTVDDLNLETVVQQKYSSIFGRGWARLTGTEPAKIALSRLNVPANSGDVELELTVIDAQ
QYVLSNNGTEIIKGKVGALESGHGISLLVSEISAEPGTVFEIAKLPRLVAINNLLDALTVEDKGKDTGVLALSLVGDDPV
LVRNILNSISKNYLLQNVERKSEEAAKSLDFLKDQLPEVRSFLDSAEDKLNRFRQANDSVDLSLEAKSVLDTVVGVEAQL
NELTLKEAEISKLYTKEHPAYRALMEKRATLQQEKDKLNKRVSVMPKTQQVILRLTRDVQAAQEIYMQLLNKQQKLGITK
ASTVGNVRIVDPAITQPRPVKPQKTIIVLIATLLGGLFSTGFVLLKTMLHRGIESPEQLEQLGINVYACIPLSELQHKSD
RETMLSGKRSSNRSSTLLAVGNLSDLAIEAVRSLRTRLHFALLEAKNNVLMISGPSPSIGKTLVSINLAAVIAQAGRRIL
VVDADMRKGHAHSLLNCELGLGLSDVLSGQASPQQAIKQTSIENLSFISRGKIPSNPSELLMHNRLTEFLEWAGKEYDIV
LVDTPPILAVTDAVIVARNVGTTLLVARYGVNSLKEIEVSIRHFEQNGIEIQGIILNAVENKSGNVYYAYEYK
>gnl|bykdb|A0A0P0YQ29 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. 1015] (length=722 residues).
MSSIKNKIDKTESAEIDLGRLIGELIDHRKLIISVTSIFVLIALVYALFATPIYQSDALVQVEQKQGNAILSSLSQVLPN
VQPQSAPEMALLQSRMILGKSVEDLNLQALVTPEYFPIFGEGWARLLGEKPGSISVSRFSLFGTDDDIDSIYLTVKDKEH
YVITGNGYEISGKVGEQLKNKSLLLEVNEINAVEGSRFKITYMSRLRAISLLQKNFTIEEQGKDTGILSLSLVGEDPELI
TKILNNITTNYLMQNIDRQAAQDEKSLEFLNKQLPKVRSDLDIAEDKLNDYRRTKDSVDLTLEAKSVLDQIVNVENQLNE
LTFRESEISQLYTREHPTYKALMEKRKTLQDEKNKLNKKVSEMPGTQQEVLRLSRDVESGRAVYMQLLNRQQELSIAKSS
AIGNVRIIDDAITHPKPVKPKKTIIVIVGFILGVMASISIVLLRMLLRRGIESPEQLEEVGINVYASIPVSDTLSNYNQK
KGIRIRADKLEHKSFLAIDNPADIAIETIRGLRTSLHFAMMEARNNILMISGASPNAGKTFVSTNLAAVIAQTGKKVLFI
DTDMRKGYVHKLFNSTNENGLSDILSGGINITDAIKRMSGGGFDYITRGTVHPNPAELLMHPRFGELLKWGGENYDLVII
DTPPILAVTDAAIIGNYSGTTLLVARFEKNTTKEIEISIRRFEQSGVKVKGCILNGVVKKSSSYYGYGYNHYGYSYESSS
DK
>gnl|bykdb|A0A0P0YQ32 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. 919] (length=719 residues).
MSPVLKHSVTKDTDEIDIGRIIGELIDHRKLIISVTALFTVLALVYALFATPIYKADALVQVEQKQGNAILSNLSQMLPN
SQPMSAPEIALLQSRMILGKTVDDLNLQSKIEPKYFPIFGKGLSRLMGEKNGTLEITRLYIPRVDNEASELEIEVKDQSH
YFVKYNNKVIEGTVGIAIDEEGVSLKVSEISAKPGSRFTVKYEDRLKAISDLQDVFTVADQGKDTGILTLSLTGDNPILI
RKIVDSIAQNYLSQNIARQAAQDEKSLEFLNIQLPKVRKDLDIAEDTLNQYRRQKDSVDLSLEAKSVLEQIVNVDNQLNE
LTFRESEISQLYTKEHPTYKALLEKRKTLQDEKEKLNNKVSAMPKTQQEILRLSRDVESGQAVYMQLLNRQQELNIAKSS
AIGNVRIIDTAITQTKPVKPKKILIVLIGIFLGFATSVGIVLLRVFLRRGIENPEQLEELGINVYASIPVSETFAKRMVQ
TPSWKKNRNKDTYGFLAIENPADLAIEAIRGLRTSLHFAMMEARNNVLMISGASPNAGKTFVSTNLAAIIAQAGKKVLLI
DTDMRKGYTHKLFEVSNEYGLSDFLSGKNDLPKSVKKIKNVEFDFISRGVVPPNPAELLMHRRFGELITWASNNYDIVIL
DTPPILAVTDAAIIGHYAGTTLLIARFEQNTPKEIEVSYKRFEQSGVIVKGCILNGVVKKASSYYGYGYNHYGYSYKDS
>gnl|bykdb|A0A0P0YQ41 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella pneumoniae] (length=722 residues).
MTSVISKKTNVTESEDIDLARIVGEFIDHRKLILSVTSICTMLAIVYALFATPIYQANSLLQIEQKQGNALLDSLSQVLP
NTQPQSAPEIALLQSRMILGKTVDDLNLQAEIEQQYFPIFGKGWARLMGNKPGKIAISHIYLTKKNNNEAPEIEIKIIDN
KNYLISGDDFQIKAKAGELIDSNGVTLLIDSIDAEPDTKFQITYLSKLKAINNLLKNFSVADQGRDTGILNLTLTGDDPE
NIAKILDSISNNYLTQNIERQAAQDAKSLEFLNVQLPKVRSDLDLAENKLNEYRRTKDTVDLSMEAKSVLDQIVNVDSQL
NELTFREAEISQLYTKAHPTYKALIEKRETLTQEKNRLNKRVSSMPTTQQEVLRLSRDVESGRAVYMMLLNRQQELNIAK
SSAIGNVRIIDHAVTDPKPVRPGSILVVVIGFVIGLVFSSAIVILRIFLRRGIESPEQLEELGINVYASIPISEWMAKAN
INENKNKNKNNQKYSFLALDNPADLAIEAIRSLRTSLHFAMLEARNNILMISGASPSAGKSFVSSNLSAVVVQGGKRVLF
IDCDMRKGYLHKVFNVSNDIGMSDILSGKNQFSSAVKHLEPEGFHFIPRGQVPPNPAELLMSKRCGEFLDWASKEYDLIV
IDTPPILAVTDAAILGRYVGTTLIVARFEANTAKEIDVSIKKFEQSGVQVKGCILNGVVKKASNYYGYGYSSYGYSYKDD
TK
>gnl|bykdb|A0A0P0YQ65 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. 313] (length=720 residues).
MSPVTNKSAIKDADEIDLGRLIGEIIDHRKLIISVTAFFTLCSLIYALFATPIYQADALIQVEQKQGNALLSNLSQMLPD
SQPSSAPEITLLQSRMVLGKTVSDLNLQARVEQNYFPIFGRGWARLMGEQPGGITISRLFLTENQEEVPELTLTVKDGFH
YTIIYNGKEFEGKVGELLDERGISLKVDSIDASPGTEFTVSYVSKLKAITDLQNIFTVVDQGKDTGMLTLTLIGDDPTLI
KKIVDSISNNYLAQNIARQAAQDAKSLEFLSLQLPKVRSDLDIAEDKLNQYRRQKDSVDLSLEAKSVLEQIVNVDNQLNE
LTFRESEISQLYTKEHPTYKALMEKRKTLQDEKAKLNERVSAMPKTQQEILRLSRDVDSGQAVYMQLLNRQQELSIAKSS
AIGNVRIVDNAVTQPKPVKPKKILIILVGIIFGGLVSVMIVFLRIFMRRGIESPEQLEEVGINVYASIPVSETFAKRMSK
KHGWRSDNRGEIQEFLAKANPADLAIEAIRGLRTSLHFAMMEARNNVLMISGASLNAGKTFVSTNLAAVISQTGKKVLLI
DTDMRKGYTHKLFDVSNDNGLSDILSGKIGIESAVKNIKTIGFDFISRGAVPPHPAELLMHRRFGELITWASQSYDIVIL
DTPPILAVTDPAIIGHYVGTTLLVSRFEQNTVKEIEVSFKRFEQSGVIVKGCILNGVVKKASSYYGYGYSHYGYSYTDDK
>gnl|bykdb|A0A0P0YQ69 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. 2005/49] (length=722 residues).
MSSVNNKLITNDADEIDLGRLLGELVDHRKLIIAVTSLFTLCALIYALFATPIYQADALIQVEQKQANAILSNLSQMLPD
SQPQSEPEIALLKSRMILGKTVDDLNLQAVIKPKYFPIFGRGWQRLSGKKDGELVVSRLYLPTSEDIDVPKVELTVKDNE
HFVVKGDDFTFNGKVGELLDDKGISIKVDKIDAEPGSKFTISYITRLEAITKLQEVLSVADQGKDTGILVLSITGDNPEL
ITNIIDSISNNYLSQNIARQAAQDAKSLEFLSNQLPKVRNDLDVAEDKLNEYRRKNDSVDLSLEAKSVLEQIVNVDNQLN
DLTFRESEISQLYTKEHPNYKALMEKRKTLQEEKAKLNKRVSVMPETQQEILRLSRDVESGRAVYMQLLNRQQELNIAKS
SAIGNVRIIDNAVAQTKPVKPKKIVIILIGFIFGSVVAIGIVLLRVFLRRGIESPEQLEELGINVYASIPVSEAFANNAV
KKASWKNKNYDIKQAFLAVENPADLAIEAIRGLRTSLHFAMMESRNNILMISGASPNAGKTFVSTNLAAVIAQSGKKVLF
IDTDMRKGYTHNLFNVENTKGLSDILSGKMAVERAIQPLSMAGFDFIARGAVPPNPAELLMHKNFDALLSWASQNYEIVV
LDTPPILAVTDAAIIGNYVGTTLLVARFEQNTAKEIEVSVRRFEQSGVIVKGCILNGIIKKASSYYSYGYNHYGYTYTDN
KK
>gnl|bykdb|A0A0P0YQ71 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella aerogenes] (length=722 residues).
MNSVTTNKPATPDSDEMDLGRLFGELIDHRKLIIAVTTGFTVLAVLYALLATPIYQADALVQVEQKQGNAILSSLSQMLP
NSQPQSAPEIALLQSRMVLGKTVDDLNLQAQVKQKYFPLIGRGMARIMGDKPGNISVSRLYLPSEDDDSTPKITITVIDK
KNYLVEGADFSINGTVGTLLTEHGISLLVNSIDANPGDKFTVSQLTRLKAITDLQEVFNVADQGKDSGMLGLTLTGDNPE
LITRILDTISQNYLAQNIDRQAAQDAKSLDFLNMQLPKVRSDLDIAEDKLNAYRKQKDSVDLNMEAKSVLDQIVNVDNQL
NELTFREAEISQLYTKEHPTYKALMEKRHILQEEKTKLNKRVSGMPATQQEVLRLSRDVESGRAVYLQLLNRQQELNIAK
SSAIGNVRIIDNAVTETKPVKPKKILVVAIGLIFGLFVSVGLVLLRVFLRRGIESPEQLEDIGINVYASVPVSEWLAKNN
RKSSKLRKNQSDTLLALENPADLAVEAIRSLRTSLHFAMMEAKNNVLMISGASPNAGKTFISSNLAATIALTGKKVLFID
ADLRKGYVHKMLGRKQGQGLSEVLSGQVAVEKVIEHVDDAAFDYIGRGLIPPNPAELLMHPRFEALLKWGSQNYDLVVID
TPPILAVTDAAIIGRYAGTSLMVARFEVNTVKEIEVSMKRFEQSGVVVKGCILNGVVKKASSYYGYGYNHYGYSYSDQKN
NQ
>gnl|bykdb|A0A0P0YQC8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. 390] (length=720 residues).
MSSVKHKSVEKETDEIDLGRIVGEIIDNRKLIISIVSLFTLIAIVYALFATPVYQADALVQVEEKQANAILSNLSQMLPD
SQPQSAPEIALLQSRMILGKTVDDLNLQAEVRQKYFPVFGSGWARLVGDKPGEIYVSRLYISMPNEDTPELTLKVIDNNN
YTISGDGFELSGKTGVLLDSKGLSIKIAKIDAKPGTEFTITYLTRLQAITELQKILTVTDQGKDTGILSISLTGENKRLI
ENIVDSIIGNYLAQNISRQAAQDSKSLEFLSLQLPKVRNELDLAEDKLNAYRRQNDSVDLSLEAKSVLDQIVNADNQLNE
LTFRESEISQLYTKEHPTYKALMEKRKTLQDEKLKLNKKVSSMPETQQEILRLSRDVESGRAVYMQLLNRQQELNIAKSS
AIGNVRIIDEAVTQPKPVKPKKILVVLAGLILGGIISLGLVMIRMFLRRGIETPEQLEDLGINVYASIPISDDFAKRVAQ
EQKWKRRKNNEVNGLLAIDNPADLAIEAIRGLRTSLHFAMMEARNNVLMISGASPNAGKTFVSSNLAAVISQSGKRVLFI
DVDMRKGYTHKLFNVSNDNGLSDILSGKVDAKKAVRTIPTVEFDFIPRGMVPPNPAELLMHRRFGDLVTWASANYDMVIL
DTPPILAVTDAAIIGNYAGTTLLIARFETNTAKEIEVSVKRLEQSGVLVKGCILNGVVKKAGSYYGYGYNYYGYKYTDDK
>gnl|bykdb|A0A0P0YQI9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. 2812/50] (length=720 residues).
MSQMSNKPSVKDEQDINLGRIIGELIDHKKLIIAITSLFTLIALVYAVFATPIYQADALIQVEQKQGNAILNNISQMLPD
SQPISAPEIALLQSRMVIGKTVDDLNLQAIIERKYFPLFGKGWARLKGEKPGALKISRLYIAENLQGKSSELSIIVKDNN
HYEVIYNDHKLNGEVGKLVSAPGFSINIEEIDASKDAEFTVTYVSKLQAITDLQNSFSVVDQGKDTGMLTLSLAGSNDEL
IKNIVDSISQNYLAQNIARQAAQDAKSLDFLNQQLPKVRSELDIAEDKLNQYRRQKDSVDLSLEAKSVLDQIVNVDNQLN
ELTFRESEISQLYTKEHPTYKALMEKRKTLQEERNKLNQKVSSMPKTQQEILRLSRDVESGQAVYMQLLNRQQELSIAKS
SAIGNVRIIDSAVTQPEPVKPKKLLIIILGLLIGGIISIAVVVVRTVLRRGIESPEQLEELGINVYASIPVSETINKETI
STKNRKDNNNNKTSFLAIENPADLAIEAIRGLRTSLHFAMMEARNNVLMISGASPNAGKTFVSTNLAAVIAQTGKKVLFI
DTDMRKGYTHKLFNTKNAEGLSDYLAGRVELSRVTQTLEIVNFDYISRGSVPPNPAELLMHSRFSDLIAWACSNYDIVIL
DTPPILAVTDAAIIGNYVGTTLLVARFELNTPREMDISVKRFEQSGVVVKGCILNGIVKRASNYYNYGYNHYGYSYDEKK
>gnl|bykdb|A0A0P0YQK2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. 6613] (length=721 residues).
MSSIKSNKPINDSDELDLGRVIGEIFDHRKLIIAVTSLFTLIALIYALLATPIYQADALIQVEQKQGNAILSSLSQVFPD
SQPQSAPEITLLQSRMILGKTVDDLNLQVKVEELFFPVIGQGLARLFNKTKNTIQVHKLFISPNMYDDNFITLTVKNDHQ
YSISGENIDFDGEIGRLIDKNGIRIQVDSINAEPGTRFLLTYTSRINAINYLRDSLLIADQGKDTGMLTISLLGSDPDLI
KRVIDSISDNYLEQNIARQAAQDAKSLDFLNQQLPKVRTELNESEDKLNAYRRQKDSVDLSLEAKSVLDQIVNVDNQLNE
LTFKESEISQLYTQEHPTYKALMEKRKILQDERAKLNKRVSTMPETQQEVLRLSRDVESGRAVYMQLLNRQQELNIAKSS
AIGNVRIIDNAVTQPKPVKPKKLIIIAIGLISGFAISLGVVFLRTFLRRGIESPEQLEDLGITVYASIPVAEVLSNRAKQ
PSKIRFKKEEDANYTYLATSHPTDLAIEAIRGLRTSLHFAMMEARNNILMISGASPNAGKTFVSSNLGGVIAQTGKKILF
IDADLRKGYTHKIFNESNENGLSEYLSGKIKLEDTIKHLGSEGFDFISRGMAPPNPAELLMHRRFGELIKWVSQAYDMVI
IDTPPILAVTDAAIIGNYVGTTLLVARFEQNTTKELEVSVKRFEQSGVAIKGCILNGVVKKASSYYGYGYAHYGYSYKDE
K
>gnl|bykdb|A0A0P0YQK4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. 1754/49] (length=720 residues).
MSSVKNRNIDRETDEIDLKRLMGELIDHRKLIISVTSLFTLVSLVYALFSTPIYQADALLQVEQKQGNAILSSLSQMLPD
SQPQSAPEITLLQSRMVLGKTVDELNLQTRVEQDYFPLLGKGWARLTGDKQGSLQISRLYISPELQDIKEFVLQVIDNHN
YMIILNRKEIKGVTGKLINDNGLAIKVDVINAEPNTKFNISYVTKLKAITDLQKVFSVSEQGKDTGMLSLSLTGDNPEVL
ERILNSISNNYLAQNIARQAAQDAKSLEFLNAQLPKVRSELDSAEDKLNQYRRQKDSVDLSLEAKSVLEQIVNVDNQLNE
LTFRESEVSQLFTKEHPTYKALMEKRKTLQDEKAKLNERVSAMPKTQQDILQLSRDVESGQAVYMQLLNRQQELNIAKSS
AIGNVRIVDDAVAQPQPVKPKKAIVILVGLLLGTLISVSLVLLRVFLRRGIESPEELEEIGINVYASIPVSEALAKKNMQ
SNGWKKKNISEYQSFLAIENPADLAIEAIRGLRTSLHFAMMEARNNILMISGASPNAGKTFVSSNLAAIIAQAGKKVLFI
DADMRKGYTHKLFELNNNDGVSDILAGKVELSKAIKTVNRAGFDYISRGAVPPNPAELLMHRRMGELFQWASDHYDLVIV
DTPPILAVTDAAIIGNYVGTTLLVARFEENTVKEIEVSSKRFEQSGVIIKGCILNGVVKKASNYYGYGYSHYGYNYSDDK
>gnl|bykdb|A0A0P0YQK5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. 1754/49] (length=720 residues).
MPSVINKNSLKEKDEIDLGRLIGEFIDHRKLIISVSSLFTLLALLYAIFGTPIYQADALIQVEQKQANAILSNLSQMLPD
SQPQSAPEIALLQSRMILGKTVDDLNLQTRIKQKYFPLIGRGFSRLSGEKSGIVTISRLYLPDNGKDESDLLLTVKDSNH
YIISNDDFEIEGKVGELLDEKGISLKVDAIDAIPNTQFIITYVSRLKAITDLQEKLAVNDQGKDTGILTISMTGDNPQLI
EKIVDSISENYLAQNIARQAAQDAKSLDFLSKQLPQVRSDLDQAEDKLNQYRRQSDSVDLSLEAKSVLDQIVNVDNQLNE
LTFRESEISQLYTKEHPTYKALMEKRKTLQDEKLKLNKRVSAMPETQQEILRLSRDVESGRAVYMQLLNRQQELNIAKSS
AIGNVRIIDNAVTQPKPVKPKKIIIVLIGIFLGIVVSAGIVLLKVLLRRGIETPEQLEELGINVYASIPVAEAFARKKVN
DKGWGNRNSEQSQSFLAIENPADLAIEAIRGLRTSLHFAMMEARNNVLMISGVSPNAGKTFVSSNLAAIIAQTGKKVIFI
DTDMRKGYTHKLFNVKNDKGLSDILSGKSDINGAVRTIEQANFDYISRGAVPPNPAELLMHRRFGELLNWASERYDIVVL
DTPPILAVTDAAIIGNYAGTTLLVARFELNTAKEIDISVKRFEQTGVNVKGCILNGVVKKASSYYGYGYNHYGYSYTDKK
>gnl|bykdb|A0A0P0YQL1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. 1680/49] (length=717 residues).
MNTKDNRQQRSEANELELGRIVGELIDCRKLIIGITTGFTVIAVLYALMATPIYQANALIQVEQKQGNAILSSLSQMLPD
GQLQSAPEISLLQSRMILGKTVDDLNLQTQVEKEYFPIIGKGISRILNNKNESIKIDKLYIERKEDSTDPEIIITIKDDK
HFTVEGDGFKVDGIKGEMLDKDKLRILITEINAEPGASFEVKYLSRLKAINNLLEAFNVSDQGKDTGMLGLTLTGTDPNL
ISKTLNSIANNYLEQNVERQAAQDAKSLDFLNQQLPKVRADLDIAEDKLNSYRKEKDSVDLSMEAKSVLDQIVNVDNQLN
ELTFREAEISQLYTKEHPTYKALIEKRQTLQQEKTKLNKRVSGMPSTQQEVLRLSRDVESGRAVYLQLLNRQQELSIAKS
SAIGNVRIVDDSITDPKPIKPKKILICIIGFILGLFFSVALIMLRFLLRRGIESPEQLEEMGINVYASIPVSEWLLKASD
KRKRKNNESDKLLAVENPTDLAVEAIRSLRTSLHFAMLEAKNNVLMISGVSPNAGKTFVSTNLAATISLANKSVLFIDAD
LRKGYVHKMLGNEGKSGLSDILSGQANVEETIISVPDGQFDYIGRGQVPPNPAELLMHPRFEKLLAWASAKYDLVIIDTP
PILAVTDAAIIGRYAGTTLLVARFESNTVKEIEVSITRFEQSGVNVKGCILNGVVKKASSYYGYGYNYYGYNYSNKS
>gnl|bykdb|A0A0P0YQL8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. 5725y] (length=719 residues).
MSPLKNKSVEKDTDEIDLGRLFGELIDHRKLIISVTALFTLLALIYALFATPIYQADALIQVEQKQGNAILSNLSQILPS
GQPQSAPEIALLQSRMILGKTVADLNLQAQVKQDYFPLFGRGWSRLMGEKPGAINVTRLYIPNNGDETPELKVTVVDDVN
YKVIYGDFELNGRVGELLNEKGISLKIESMDSQPGVSFSVSYISKLKAIADLQNTFTVADLGKDTGMLNLSLMGDNPEKI
RNIVDSISHNYLSQNIARQAAQDAKSLDFLNAQLPKVRSELDVAEDKLNQYRRQKDSVDLSLEAKSVLEQIVNVDNQLNE
LTFRESEISQLYTKEHPTYKALMEKRKTLQDEKGKLNERVSAMPKTQQEILRLSRDVESGQAVYMQLLNRQQELSIAKSS
AIGNVRIIDEAVTETKPVKPIKIIILLVGIVLGMVVSVGMVLLRVFLRRGIESPEQLEEVGINVYASIPVSENFAKKALQ
TGWKKKPESEIQGFLAVENPADLAIEAIRGLRTSLHFAMMEARNNVLMISGASPNAGKTFVSTNLAAVVAQTGKKVLLID
TDMRKGYTHKLFEVSNDNGLCDILSGKIDIGRAIKTINQAGFDFISRGVVPPNPAELLMHRRFGELVDWASQNYDIVILD
TPPILAVTDAAIIGHYAGTTLLVARFEQNTVKELEVSFKRFDQSGVIAKGCILNGVVKKASSYYGYGYSHYGYSYTDEK
>gnl|bykdb|A0A0P0YQR3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. 5758] (length=714 residues).
MTSLKNEKKIASENDDFDINRFIGEIIDHKKLIIAFTTGFTLIAILYAVLARPIYQANALLQIEQKQGNVLLNSLSQMLP
DSQPQSAPEIALLQSRMILGKTVDDLNLQAKVRREFFPLIGEGLARINGEEFGTIAISHIKYNNDDDKIPKIKITIINKE
QYKLEVADRVFKGKVNALLNTGDFDIVISSLKGTPGSVYNVTYMPHLKAIGMLQNALTVADQGKDTGILNLTLLGDDPKQ
TSIILQTIVENYISQNIARQAAQDEKSLEFLNKQLPIVRNDLDIAEDKLNSYRKMKDSVDLSMEAKSVLDQIVNVDNQLN
ELTFREAEISQLYTKEHPTYKALLEKRNTLQEEKNKLNKKVSSMPSTQQEVLRLSRDVESGRPVYLQLLNRQQELNIAKS
SAIGNARIIDNAVTDPKPVKPKKILIVLFGFVLGLGFSVFFVLLRVFMHRGIESPEELEEIGVTVYASIPVSQWLMKKTN
KKNNESNVLLATDNPADLAIEAIRGLRTSLHFAMMESKNNILMISGASPSAGKTFISSNLASVIASTGKKILFIDADMRR
GYVHKLFNVTSEVGLSNILSGGCSIEQAIFHIENSGFDFIPRGIAPPNPAELLMSDKLEYVLKTVSGKYDLIIIDTPPIL
AVTDAAIIGRYAGTSLLVARFEENTAKEIAVSIKKFIQSGINIKGCILNGIVKKASSRYGEGYNYYSYSYKGKD
>gnl|bykdb|A0A0P0YQR4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. 1702/49] (length=720 residues).
MSSLKNKPENKDADEIDLSRLYGELIDHRKLIISVTAFFTLIALVYSLFSTPIYQADSLIQVEQKQANAILSNLSQMLPD
SQPQSAPEITLLQSRMILGKTVDDLNLQAKIKQNYFPILGRGFSRLSGDKPGIINVSRLYLPKTDDDIPELTLTVIDANK
FTIQTDSFEAEVKVGELFEKNNISIKVDEIQAKPGTSFTVEYLSKLKAINDLRDVLTVSDQGKDTGMLTLSLTGDDPVQI
RKILDSISNNYLMQNIDRQAAQDAKSLEFLNRQLPQVRHDLDISEDKLNKYRQQKDSVDLSLEAKAVLDQIVNVDNQLNE
LTIRESEVSQHFTKEHPTYKALMEKRVTLLEEKAKLNKRVSAMPETQQEVLRLSRDVDSGRAVYMQLLNRQQELNIAKSS
AIGNVRVIDEAVTQPRPVAPKKILIVIGGIIFGLIVSVAIIALRVFLRRGIESPEQLEVLGINVYASIPVSETFAKNITK
GLKSNKKKSLEYDEFLAIQNPADLAIEAIRGLRTSLHFAMMEARNNILMISGASPNAGKTFVSSNLAAIISQTGKKVLFL
DADLRKGYTHKLFNVSNENGLSDYLAGKVDIKNCVKQIKTAGFDFISRGMVPPNPAELLMHSRFQNLLSWASDNYDLVIV
DTPPILAVTDAAIIGNYAGTTLLVARFEQNTVKEIEVSAKRFEQSGVMIKGCILNGVVKKASSYYGYGYSHYGYSYSNKE
>gnl|bykdb|A0A0P0YQT0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. 2002/49] (length=717 residues).
MTSVINNKMAPQDGNEIDFGRLVGEVIDHRKLIVAITTGFTVIAVLYSLLATPIYQANALIQVEQKQGNAILSSLSQILP
DGQPQSAPEISLLQSRMILGKTVDELALQAQITPKYFPLIGKGLARIMGKKTGEIALSQINIANVNSNEATKFILTVKDE
KNYTIEGDGFKLNGTVGTPLYGQGISLLVSKIDAEKGSQFEIEYISKLKAITLLQDSLSVVDQGKDTGMLSITFTDENPA
LAERIIDSISQNYLTQNIARQAAQDAKSLEFLNQQLPIVRNDLDNAEDKLNAYRKQRDSVDLTMEAKTVLDQIVNVDNQL
NELTFREAEISQLYTKEHPTYKALMEKRQTLQEEKNKLSKRVSSMPATQQEVLRLSRDVESGRAVYLQLLNRQQELNIAK
SSAIGNVRIIDQAVTIPKPVKPKKIIIIAVGFILGLLCSIGLIILRVFLRRGIESPEELEEMGINVYASIPVSEWLMKRT
TKTNKNQSDTLLAVENPADLAIEAIRGLRTSLHFAMMEAKNNVLMISGASPNAGKTFLSTNLAAIISSGDKKVLFIDADM
RKGYVHKMRGSKNEKGLSELLSGLVTIENVVEKVTLGGFDYIGRGQVPPNPAELLMHPRFENLIEWSAKHYDLVIVDTPP
ILAVTDAAIIGKYAGTTLLVARFETNTAKEIYVSTKRFEQSGVMVKGCILNGVVRKASSYYGYGYNHYGYSYDDIKK
>gnl|bykdb|A0A0P0YQX6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. 5884] (length=718 residues).
MSSIANKKTQDSDEIDLGRIIGELIDHRKLIITISVFFTAIAIIYALFATPVYQADSLIQIEQKQGNVLLNDLSQMLPDS
QPQSAPEIILLQSRMILGKTVDDLNLQAKVEQNYFPIFGQGWSRLSGEKPAKINVSRLYIDSIDGKTPKLKLTIVDNRHF
KVEMEDSDIIINGEVGTLLNDKGISLLVDNIDAKAGDSFTITYLTRLNAISDLQKIFTVTDQGKGSGILNLTLTGEDQSR
TTDLLRSISANYLSQNIARQAAQDEKSLEFLNKQLPQVRMELDQAEDKLNAYRQQKDSVDLTMEAKSVLDQIVNVDNQLN
ALTFREAEISQLYTKEHPTYKALAEKRSTLLQERAKLNKRVSSMPATQQEVLRLGRDVESGRAVYMQLLNRQQELSIAKS
SAIGYVRIIDDAVTDPNPIKPKKTLIVIIGLFLGLLTSVGIVILRVFLRRGIESPEQLEEIGINVYASVPVSESLAKMKA
KGRKFQHEDKSLLALDNPADLAIEAIRGLRTSLHFAMMEARNNVLMISGASPNVGKTFISTNLSAIIAQAGKKILLIDAD
MRKGYVHKLFNANNNKGLSDVLSGKMEVQDSVQRIAIAGFDFISRGIVPPNPAELLMHKNFAELINWASVNYDLVIIDTP
PVLAVTDAAIIGRYVGTTLLVARFEENTAKEIDVSIKRFEQSGVSVKGCILNGVVKKASSYYGYGYNHYGYSYSDEKK
>gnl|bykdb|A0A0P0YQZ2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. 6837] (length=719 residues).
MSPINNKSTTKESDELDLGRLVGELIDHRKLIVSITTLFTVLAIMYALFATPIYQADSLIQVEQKQANAILSNLSQILPD
SQPQSAPEVALLRSRMILGKTVDDLNLQTIVEEKYFPVFGKGWHRLLNDKPGKVLVSRLYMPESESDENKLELVVNDKSN
YTIYGDSYEIKGKVGELVDGHGISIKIDSIDAEPNTKFSIKYISRLKAIADLQELLSVADQGKDTGILVLSLTGDDPVQI
ERILDSISSNYLAQNIARQAAQDAKSLDFLNQQLPQVRNELDVSEDKLNQYRRQNDSVDLSLEAKSVLDQIVNVDNQLNE
LTFRESEISQLYTKEHPTYKALMEKRKTLQDEKVKLNKRVSTMPETQQEILRLSRDVESGRAVYMQLLNRQQELNISKSS
AIGNVRIIDNAETQPKPVAPKKILIMLVGFILGAMVSTSVVLIRVFLRRGIETPEQLEEIGINVYASIPVSEEFSKKNIK
NGIQSKKPHPQQGFLALENPADLAIEAIRGLRTSLHFAMMEARNNVLMISGASPNAGKTFISSNLAAVISQTGKKVLFID
TDMRKGYTHKLFGVTNDCGLSDLLSGKTDVNKAIKKIPMIGFDFISRGMAPPNPAELLMHKNFSDLISWASGHYDLVILD
TPPILAVTDAAIIGSYVGTTLLVARFELNTPKEIEVSIKRFEQSGVPIKGCILNGVVKKASSYYGYGYSHYGYSYTDDK
>gnl|bykdb|A0A0P0YR07 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. 6168] (length=725 residues).
MSPVMQTKAKNAESDDVDLARLVGEIIDHRKLIISVTAIFTFIALLYVLFATPIYQADSLVQIEQKQGNSLINSLNQALT
DSQPQSAPELALLQSRMILGKTVDDLNLQIIAKQDYFPIIGRGWARLTGQENNSVLISQFDAPSTLDSEAEVTMTVISAN
EYVIDHDGNIVKGKVGVLLKNNDLTFMVTKIDAEPNSKFIVTKKTKLEAINNLQKFFSVADQGKDTGILNLTIQGDNPAL
LRKILDSISQNYLAQNIDRQAAQDAKSLDFLNEQLPKIRKDLDTAEDKLNYYRQQKDSVDLSLEAKAILDQIVNVDNQLN
ELTFREAEISQLFTKEHPTYKSLIEKRTILEKEKERLNKKVSAMPATQQEVLRLSRDVDSGRAVYMQLLNRQQELNIAKS
SAIGNVRIIDNAVTEPVPVKPKKFIVILIGLVLGIVFSVSVVIIKTFFNKGIESPEQLEELGVNVYASIPVSEWLLSNKG
RTKGLSHKGKFKKQEHSFLAIENPADLAIEAIRGLRTSLHFAMMEAKNNVLMISGATPDAGKTFISSNLSAIIAQTGKKI
LFIDADMRKGYVHKLLLTGQDNCKGLSEVLSSNENFEKVVHNINFANFDFIARGQIPPNPAELLMHKRFEELMTWAMENY
DLIIIDTPPILAVTDAAVIGRYAGTSLLVARFEENTPKEIYFAVKRFEQNGVTVKGCILNGVVKKASSYYGYGYNSYGYT
YKDDK
>gnl|bykdb|A0A0P0YR08 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. 7824] (length=723 residues).
MAPISYKKQELSETDELDLGRLVGEFIDHRKLILSVTIFFTVIALLYAMFSTPIYQADALVQVEQKQGNALLDSLNQVLP
TGTQQSAPEIALLQSRMVLGKTVDDLNLEIAIEKDYFPVFGRGWARLTGTDGGNIKVSKLILKKNDLENVKLKVINENDF
LVTTSSGDIKGRVGTAIDNRDFTLKVDEINADEGSSFTIQKITRLQAINNLLKVFSVTDQGKDTGMLNLTLVGEDPNQIT
NILNTISNNYLAQNISRQAAQDEKSLEFLKAQLPKVRDELDEAENKLNAYRRKKDSVDLTMEAQAVLNQIVNVDNQLNEL
TFREAEISQLFTTDHPTYKALLEKKKTLAQEKVRLNNQVTSMPTTQQEILRLSRDVESGRAVYMQLLNRQQELNISKSST
IGNVRIVDSAIAEPKPVKPKKIMVVLIGLVFGLFVSVGIVLARMFLRRGIESPEELEDMGINVYASVPVSEWLTQKHFKN
GKRLAAKDVFKEDRESLLALENPADLAIEAIRSLRTSLHFAMLESSNNILMISGASPNAGKSFISSNLGAIVAQTGKRVL
LIDADMRKGYIHKVFGVSNSNGISEILSGKSTVGSAILKTQLDNLDLITRGQVPPNPSELLMHERLKLSLESVSKEYDLI
LVDTPPILAVTDAAIIGQYVGTVLLVARFELNTAKEIEISKRRFEQSGIPVKGCILNGVVKKASSYYGYGYNHYGYSYNT
DKK
>gnl|bykdb|A0A0P0YR48 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. 8306] (length=720 residues).
MSPVTNKSVVKDADEIDLGRLVGELIDHRKLIISVTALFTLIALIYALFATPIYQADALIQVEQKQGNAILSNLSQMLPD
SQPSSAPEITLLQSRMILGKTVSDLNLQARITQNYFPVFGKGWSRLLGEKPGFINISRLYIAEEGSDTPEIVLIVEDKFN
YIIKYNDKKLEGKIGELLEANGLSIKVDSIEAEPGTEFTVSFVSKLKAITDLQKVFTVADEGKDTGMLSLSLTGDNADLI
VKIVDSISNNYLAQNIARQAAQDAKSLDFLNLQLPKVRADLDIAEDKLNQYRRQKDSVDLSLEAKSVLEQIVNVDNQLNE
LTFRESEISQLYTKEHPTYKALMEKRKTLQDEKEKLNERVSAMPKTQQDILRLSRDVDSGQAVYMQLLNRQQELSIAKSS
AIGNVRIIDNAVAQPKPVKPKKILILLVGIALGIITSFGIVLMRVFLRRGIESPEQLEELGINVYASIPVSETFAKKMVQ
VPSWRKKRNEEFQGFLAIENPADLAIEAIRGLRTSLHFAMMEARNNVLMISGASPNAGKTFVSTNLAAVIAQTGKKVLLV
DTDMRKGYTHKLFSVSNENGLSDFLSGKVELSKTVKNISQVDFDFISRGISPPNPAELLMHRRFGELITWASQNYDIVIL
DTPPILAVTDAAIIGHYTGTTLLIARFEQNTAKELEVSVKRFEQSGVIVKGCILNGVVKKASSYYGYGYSHYGYSYTDDK
>gnl|bykdb|A0A0P0YR59 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. 6258] (length=720 residues).
MTSVINKKVDNDSEDIDLGRIIGEVIDHRKLIISITALFTLLALTYALFATPIYQADALIQVEQKQANAILSNLSQMLPN
SQPESAPEISLLQSRMIIGKTVDDLNLQARVRQNYFPIFGKGFSRITGEKPGSIEVSRLFIPNVGDDTPEIIVKIINENS
FEVNIGDDTVQGKRGEIVDINGATLKIDKIEAKPGTEFTIDYVSRLKAITDLQENLTIVDQGKDTGILSISLTGDNKELI
SKIIDNISDNYLAQNIARQAAQDAKSLDFLNLQLPKVRSDLDIAENKLNQYRRQNDSVDLSLEAKSVLDQIVNVDNQLNE
LTFRESEISQLYTKEHPTYKALLEKRKTLQDEKMKLNKRVSSMPETQQEILRLSRDVESGRAVYMMLLNRQQELNIAKSS
AIGNVRIIDEAVTQPKPVKPKKVLVVILGFLLGCIVSVGMVLLKVFLRRGIESPEQLEELGINVYASIPVSESFAKNITR
DSPLKKTKSQETYTFLAVENPADLAIEAIRGLRTSLHFAMMEARNNVLMISGASPNAGKTFISTNLAAIIAQTDKKVLLI
DTDMRKGYTHKLFGKSNEQGLSDVLSGKIAIETAVQKELNIGFDFISRGMVPPNPAELLMHKNFGQLISWASSNYDIVIL
DTPPILAVTDAAIIGNYAGTTLLVARFEVNTAKEIEVSIKRFEHGGVIVKGCILNGVVKKASSYYSYGYSNYGYTYDSKD
>gnl|bykdb|A0A0P0YR93 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. 8588] (length=721 residues).
MSSVKNISSEKDSDEIDLGRLVGELIDHRKLIVAVTALFTLVALLYALFATPVYQADALLQVEQKQGNAILNSLSQMLPD
SQPQSAPEIALLQSRMILGKTVDDLNLQARVEQDYFPLFGKGWARLTGKPAGNLTVSRLYLPSDRNLDIPELKLTVKDNT
HYSVTFNDKLMTGEVGVLLDSNGIALKVDNIEAEPGSEFIISYVSKLKAITDLQEMFSVADQGKDTGMLNLSLTGSDPLL
LEKILNSISNNYLAQNVARQAAQDAKSLEFLNVQLPKVRNDLDIAEDKLNQYRRQKDSVDLSLEAKSVLEQIVNVDNQLN
ELTFRESEISQLYTKEHPTYKALMEKRKTLQDEKAKLNQRVSAMPKTQQDILQLSRDVDSGQAVYMQLLNRQQELNIAKS
SAIGNVRIIDNAVAQPKPVKPKKIITLLVGIILGGIVSIGLVLLRVFLRRGIESPEQLEDIGINVYASIPISETFAKKAV
QAPKLRKKAESGYQSFLAVENPADLAIEAIRSLRTSLHFAMMEARNNVLMISGASPNAGKTFVSSNLSAIVAQTGQKALF
IDMDMRKGYTHKLFKLNNDNGLSDILSGKIENSQAIKSVPLAGFDYISRGAVPPNPAELLMHRRLGELISWASQNYDIVI
LDTPPILAVTDAAIIGHYVGTTLLVARFEQNTVKELEVSFKRLEQSGVMAKGCILNGVVKKASSYYGYGYSHYGYSYTDD
K
>gnl|bykdb|A0A0P0YRF9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. 7730] (length=730 residues).
MIRNKYMSPVTNKDISKESEGIDLGRLIGELIDHRKLIISVTALFTLISLIYALFSTPVYQADALIQVEQKQANAILSNL
TQMLPDSQPQSAPEIALLRSRMILGKTVDDLNLQARVKQIFFPVFGRGWARLSGQSLGDVNISRFYVPDVKLNEDEIKFT
LKVIDNTHFTLTGENIALKGRIGELVEDDGATIKIDSIDAEKGSEFEIKYVTKLKAITDLQNDLIVIDQGKDTGILTVSL
TGENPILIKRIIDSISNNYLAQNIARQAAQDEKSLEFLNLQLPKVRAELDVAENKLNAYRKQNDSVDLSLEAKSVLDQIV
NVDNQLNELTFRESEISQLYTKEHPTYKALMEKRKTLQDEKIKLNKRVSGMPEKQQEILRFSRDVESGRAVYMQLLNRQQ
ELNIAKSSAIGNVRIIDNAVTQPKPVKPKKALVVLLGFFVGAIFSVALVLLRVFLRRGIESPEQLEELGINVYASIPVSE
MFAKKMTQPLNLRKKQNEDGTGFLALENPADLAVEAIRGLRTSLHFAMMEARNNVLMISGASPNAGKTFVSSNLSAVIAN
AGKRVLFIDTDMRKGYTHKLFNVNNTNGLSDFLSGKTDIKSIIKTLDDVGFDIISRGVVPPNPAELLMHKRFSDLLGWAS
ENYDIVILDTPPILAVTDAAIIGNYAGTTLLVARFELNTPKEIEISVRRFEQSGVAVKGCILNGVVKKASSYYGYGYNYY
GYSYSGKNKT
>gnl|bykdb|A0A0P0YRH5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. 8414] (length=721 residues).
MSSATSKNILKDDDEMDLGKLIGELIDHRKLIIAITSFCTLISLVYAIFATPIYQANSLIQVEQKQGNAILSNLSQMLPD
SQPQSAPEISLIQSRMILGKTVDDLNLQIMIKQNYFPIFGQGFARLLGEKPSNIEVTRLYVTNANDDVTQLELKIKDGEH
YQIKYDGAVFNGRVGELLENKQLAIKVNDISAKPGDTFTIYYFNRLKAIADLLDNLNVSDQGKDTGILSISYTGENPQLI
KNIVNSISENYLAQNISRQAAQDAKSLDFLNIQLPKVRNDLDIAENKLNAYRRQSDSVDLSLEAKAVLDQIVNVDNQLNE
LTFRESEISQLYTKEHPTYKALMEKRKTLQEEKLRLNKKVSSMPETQQEILRLSRDVESGRAVYMQLLNRQQELNIAKSS
AIGNVRIIDDAVTQLKPVKPKKILVVIIGFILGLSIAIGVVFLRIMLRRGIETPEQLEEIGINVYASVPVAESLVSNDRS
IKNIRKKITHKEYTGLLATTNPADLAIEAIRGLRTSLHFAMIEARNNILMISGASPNAGKTFISSNLAAVVAQTGKKVLF
IDTDMRKGYVHKVFDVENDNGLSNYLSGKLGLEATLKKIPEAGFDFISRGVVPPNPTELLMHRRMEEMLKWASQNYDLVI
LDTPPILAVTDAAIIGHYAGTTLLVARFELNTVKEMDVAFKRFEQSGIVAKGCILNGIVKKASSYYGYGYNHYGYSYKDN
T
>gnl|bykdb|A0A0P0YRL1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. 1702] (length=722 residues).
MTSVTTNKPVTPDSDEIDLGRLIGELIDHRKLIIAVTAGFTLLAILYAVLATPIYQADALIQVEQKQGNAILSNLSQMLP
DSQPQSAPEIALLQSRMILGKTVDDLNLQAQVEQKYFPLIGRGMARVMGDKPGNISISRLYLASSEDDDDVQKVIVTVQD
KKNYLVEGKNFSTTGTVGTLLNEHGMSLLVNSIDAQPGDKFTVSQLTKLKAISDLQKIFNVSDQGKDTGMLTLTLTGDNP
DLISRVLDSISQNYLAQNIARQAAQDAKSLEFLNQQLPKVRSELDIAEDKLNAYRKQKDSVDLNMEAKSVLDQIVNVDNQ
LNELTFREAEISQLYTKEHPTYKALMEKRHTLQEEKSKLNKRVSGMPSTQQEVLRLSRDVESGRAVYLQLLNRQQELSIA
KSSAIGNVRIIDNAVTEPKPVKPQKVLVVAIGLILGLFISVGLVLLRVFLRRGIESPEQLEEIGINVYASVPISEWLSKK
NRKSNQLRKNQSATLLAVENPADLAVEAIRSLRTSLHFAMMEAKNNVLMISGASPNAGKTFISSNLAATIALTGKKVLFI
DADLRKGYVHKMFSRKQDKGLSEILSGQTSAETVIEKVTDGEFDYIGRGQIPPNPAELLMHPRFENLLKWAAQHYDLVII
DTPPILAVTDAAIIGRYVGTSLLVARFEVNTVKEIEVSMKRFEQSGVIMKGCILNGIVKKASSYYGYGYNHYGYSYSDKK
QD
>gnl|bykdb|A0A0P0YRL8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. 5281] (length=720 residues).
MTPIVNNKSQQAESDDFDLGRLLGELIDNRKLIISITSAFTVLAVLYTLLATPIYQADALIQVEQKQGNAILNSINQILP
NSQPESAPELTLLQSRMILGKTVDDLNLQAQVRKKYFPIIGRGIARLLGEESGSITVGKLYLPQVEGGDAPQVILTVNDE
QRYTIAGDDFTLEGKVGQLINEKGISLLIKEINAQPGSEFVITYLNKLKAISNLQDVFNVADQGKDTGMLSLTLTGDNPT
LIKNILNSISNNYLAQNVERQAAQDAKSLAFLNEQLPKVRSDLDFAEDKLNAYRKQKDSVDLTMEAKSVLDQIVNVDNQL
NELTFKEAEISQLYTKEHPTYKALVEKRKTLQDEKVKLNKRVSSMPSTQQEVLRLSRDVESGRAVYLQLLNRQQELNIAK
SSAIGNVRIVDDAVTEPNPVKPKKILIIIIGTILGAFISIGIVLLRMFLLRGIESPEQLEEAGINVYASVPVAEWYKANL
VKGNNKRKEPESLLAIENPADLAIEAIRSLRTSLHFAMMEAKNNILMISGASPNAGKTFISTNLAATMASSGKKILFIDA
DLRKGYVHKILGSDNDNGLSDYLSGRIPLEKMITTVTKGNFDYIPRGQVPPNPAELLMHPRFNVLISHVSKLYDLVIIDT
SPILAVTDAAIIGRYVGTTLLVARFEINTTKEILVSIKRFEQSGVNVKGCILNGMIRKASSYYGYGYNHYGYAYSEKNNK
>gnl|bykdb|A0A0P0YRN4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. 1196] (length=719 residues).
MSSIKNKPEVKDSEDFDIGRLLGEIIDHRKLIISITSLFAFTGLLYVLLSTPVYQADALIQVEQKQANAILGNLSQILPD
SQPQSAPEIALLQSRMILGKTVDDLNLQIRVEQEHFPIFGKGLSRLLGQKDGTLNISLFSPVDQTEDIQKFKLTVEGNGS
YVIYGENVELKGRVGETLDKNGFTVKLSSIQAEPGTSFTVTYVSKLKAISDIQESLTINDQGKDTGILAISLNGKNPILI
KDIINSISQNYLAQNIARQAAQDAKSLDFLNQQLPKVRSDLDEAENKLNDYRRKNDSVDLSLEAKAVLDQIVNVDNQLNE
LTFRESEISQLYTKEHPTYKALLEKRKTLQEEKGKLNKRVSAMPETQQEILRLSRDVESGRAVYMQLLNRQQELNISKSS
AIGNVRIIDNAVTQPKPVKPKKVITLLASIILGLFVAVGVVLLRVFLRRGIETPEQLEELGINVYASIPVSETFSLKKMV
KKSKKNSYSDAEIFLALENPADLAIEAIRGLRTSLHFAMMEARNNILMISGASPNAGKTFVSTNLAAVISQTGKKVLLID
TDMRKGYTHKLFNVNNDHGLSDFLSGKNDINKTIKTIDVAGFDFIPRGIVPPNPAELLMHKRFGELLKWANENYDLVILD
TPPILAVTDAAIIGNYSGTTLLVARFELNSPKEIEVSIKRFEQSGVHIKGCILNGMVKKASSYYSYGYSHYGYSYTDKK
>gnl|bykdb|A0A0P0YRQ2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. 2482] (length=720 residues).
MSVNKKTTVTESDDIDLGKLVGELIDHRKLIISITALFTLIAIIYALFATPVYQADAMVQVEEKQANAILSNLSQMLPDS
QPQSAPEIALLQSRMILGKTVDDLNLQTLVSEKYFPLFGEGWAKLTGQKPHSISVSRFYVGEKDNNDETDAILKVLDSKN
YTITGENFELKGTVGELVEGNGVSVKINEIDAPIGTEFKISSITKLKAISDLQKIFSVADQGKDTGILSLTITGEDPVLI
KKILNSISENYLAQNIARQAAQDQKSLEFLNQQLPKVRSDLDNAEDRLNAYRRQNDSVDLSLEAKSVLDQIVNVDNQLNE
LTFRESEISQLYTKEHPTYKALLEKRKTLQDEKGKLNKRVSSMPETQQEILRLSRDVESGRAVYMQLLNRQQELNIAKSS
AIGNVRIIDNAVTQPKPVKPKKVLIVIVGLVLGGFVSIGFVLFRVFLRRGIESPEQLEELGINVYASIPVAEAVAEKALQ
KSSWKRKSVEEYSSFLAIDNPADLAIEAIRGLRTSLHFAMMEARNNVLMISGASPNAGKTFVSTNLAAVIAQTGKKVLLI
DTDMRKGYTHRLFNVSNDNGLSDVLSGKIKIENAVKPVKDIGLDFISRGMVPPNPAELLMHRRFGELIEWASKNYDIIVL
DTPPILAVTDAAVIGNYAGTTLLVARFEQNTVKEIEVSFKRFDQSGVAVKGCILNGVVKKASSYYGYGYNHYGYSYNNDK
>gnl|bykdb|A0A0P0YRQ3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. 6177] (length=721 residues).
MSSVKNRAVEKEADEVDLGRLIGELIDHRKLIIFVTALFTLFALLYALFSTPVYQADALLQVEQKQGNAILNSLSQMLPD
SQPQSAPEIALLQSRMILGKTVDDLNLQARVEQKHFPLFGKGWGRLTGKQPANLTVSRLYLPSDSGLDIPELELTVKDKT
HYSVTFNDKPMVGEVGILLDSNGIALKVDNIDAEPGSTFIISYVSKLRAIKDLQEMLAVADQGKDTGMLSLSLTGPDPVL
LEKILNSISSNYLAQNVARQAAQDAKSLEFLNEQLPKVRNELDVAEDKLNQYRRQKDSVDLSLEAKSVLEQIVNVDNQLN
ELTFRESEISQLYTKEHPTYKALMEKRKTLQEEKAKLNQRVSGMPKTQQDILQLSRDVDSGQAVYMQLLNRQQELNIAKS
SAIGNVRIIDSAVAQPKPVKPKKVIILLVGIVLGGIVSVGLILLRVFLRRGIDSPEQLEELGINVYASIPVSETFAKRSV
QTLKLNKKTATEYESFLAVENPADLAIEAIRGLRTSLHFAMMEARNKILMISGASPNAGKTFVSSNLAAIVSQTGQKVLF
IDMDMRKGYTHKLFNLDNNNGLSDILSGKTEITKAIKTASNAGFDYISRGAVPPNPAELLMHRRLGELITWANQNYDLVI
LDTPPILAVTDAAIIGHYVGTTLLVARFEQNTTKEIEVSVKRFEQSGVMVKGCILNGIVKKASSYYGYGYNHYGYSYTDK
K
>gnl|bykdb|A0A0P0YRT5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. 3985/51] (length=721 residues).
MTIDTTNKKNVSESDEIELGRLIGELVDHRKLIIAVTSVFTLIALLYAIFATPIYQANVLIQVEQKQGNAILSSLSQMLP
DSQPQSAPEIALLQSRMILGKTVDDLNLQIEVRLNDFPLIGSGLARIFQKSPGTLTVKKLDFINFKGSDYPDLVITVIDN
NNYKVEGDGIIAEGKVGEEAHTNGLNILVDSIDSKPGQQFKIKYYSKLEAINRLQNSLKVTDQGKDTGMLSLILTGDNPD
LISKILDNISDNYLTQNVARQAAQDEKSLQFLSQQLPKVRSDLDAAEDKLNEYRKQKDSVDLTMEAKSVLDQIVNVDNQL
NTLTFREAEISQLYTKEHPTYKALMEKKQTLQDERIRLNKKVNTMPSTQQEVLRLSRDVESGRAVYLQLLNRQQELNIAK
SSAIGNVRIIDNAVVEPQPVKPKKFLIIVVGFLLGVFISVLLVLLRVYLRRGIESPEQLEEYGINVYASIPVSDWLSKQL
SRKGKVKQNESDTILSIENPTDLAVEAIRGLRTSLHFAMMEAKNNILMITGASPNAGKTFVSTNLAATIAQTGKKVLFID
ADLRRGYVHKMFGSEIKSGVSDILSGKESITNAIQKVKNADFDYVSRGQVPPNPTELLMHPRFNELLAWASNNYDLVIVD
TPPILVVTDAAIIGRYVGTTLLVARFEVNTPKEIDISIKRFEQSGVPIKGCILNGIVKKASSYYSYGYHQYGYSYTDNKK
D
>gnl|bykdb|A0A0P0YRU9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. 4715/50] (length=720 residues).
MTLSQNNKISQQENDIIDLGRLFGEIIDHRKLILSITAAVTLLAILYVSLSTPIYQANALVQVEQKQGNAILNGLSQILP
STQPQSAPEITLLQSRMILGKTVDDMDLQYSVKPKSIPFIGEGIDRIWGEGKGEIHIKHLYIPMRNGENVASFVLTVKNK
STYEIKKDDVEAEGNVGTTLEVGGISLLVDAITAREGSQFVVNYKTRLKAISDLQDALSISEQGKDTGMLELTLIGANPT
LIRNTLDGITQNYLEQNVARQAAQDAKSLDFLNKQLPKVRDELDIAESKLNTYRKQKDSVDLSMEAKTVLDQIVNVDNQL
NELTFREAEISQLYTKEHPTYKALMEKKQTLQEEKSKLGKRVSSMPATQQEVLRLSRDVESGRAVYLQLLNRQQELNIAK
SSAIGNVRVIDNAVTDPEPVKPKKVLIIVGAVTIGLILSIILVLLKVFLRRGIESPEQLEELGINVYASIPVSEWLTNKT
SKTNKKKNESEILLIDENPADLAVEAIRSLRTSLHFAMMESKNNVLMISGASPNAGKTFVSTNLAATIASAGKRVLFIDA
DLRKGYVHKIFKNNHEKGLSDILSGLIEVKSSIEKVPNGAFDFISRGQVPPNPSELLMHPRFEALLKWASQEYDLVIIDT
PPILAVTDAAIIGRYVGTTLLVARYEANTAKEILISKRRFEQSGVEIKGCILNGVVKKASSYYGYGYNHYGYSYGEHPKK
>gnl|bykdb|A0A0P0YRV8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. 7522] (length=718 residues).
MPSVTNKSQVKESDDFDLGRLIGELIDHRKLIISITAFFTVIALIYALFATPIYQADALIQVEQKQANAILGNLSQMLPD
SQPQSAPEIALLQSRMILGKTVDDLNLQAKVEQKYFPLFGKGLARLLGKKKNGIHISHLYVASDPEQDAEFSLTIKDNSH
YVITKGDYSTVGTVGSLLDTGKFSIKVDQIDSEPGTEFMVSYIPKLKAISDIQDVLNITDQGKDTGILTLSLTGEDTNLI
KNILDSISSNYLAQNISRQAAQDEKSLEFLNLQLPKVRSELDASEDRLNDYRRQSDSVDLSLEAKAVLDQIVNVDNQLNE
LTFRESEISQLYTKEHPTYKALLEKKKTLQDEKSKLNKRVSAMPETQQEILRLSRDVESGRAVYMQLLNRQQELNIAKSS
AIGNVRIIDNAVTKTKAVKPKKALIVLMGFILGLVVSIGLVLLQIFLRRGIESPEQLEELGINVYASVPVSETFVNQKNP
KSKNQKEQEYSSFLAVDNPADLAVEAIRGLRTSLHFAMMEARNNVLMISGASPNAGKTFISTNLAAVTAQTGKKVLFIDA
DMRKGYTHKLFNTDNDNGLSDILAGKSDINTALKRISTIGFDFISRGMVPPNPAELLMHRRFGEVLKWAGENYDLVIIDT
PPILAVTDAAIIGNYVGTTLLVSRFELNTAKEIEVSIKRFEQSGVTVKGCILNGVVKKASSYYSYGYNHYGYSYSEKK
>gnl|bykdb|A0A0P0YRY4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. 636/52] (length=719 residues).
MKMINDLNKNDRITNEEDTIQLGTIIGHLIDHKKLILSSMVMFALIGGLYSWIATPIYKADALIQVEQNTGNSILTNLSS
ILPDNQPASAPEIELLKSRMVLGGAVEELNLDIEVKPKNFPIIGRLYNKFTGNQQPNLPVISFNVPSENYNVEYIVKTVS
NNEYELFLDGNKIFSGKVGERKEVNGVALYIADTTLTQGNTYTLKKIAEVTAISNLLEQLNISEKGKDTGIISLSINGSD
PVKIKNILSVISRIYLSQNIERKSAEAAKSLDFLDKQLPEIRTALDESENKLNLYRQQKDSVDLSLEAKSVLDTVVQLDS
QLNELTFREAEISKLYTKEHPSYKALLEKRRTLEDEKKRLSGKITALPQTQQEILKLTRDVQVNQEIYMQLLNKKQELSI
SKASTVGNIRIIDPAITNPEPIAPQSVLIILMMTIFGAIVSIVYIIIHTILHKGIQSAEQLEEMGMNVYASVPLSELQFD
KTNKGGKLKAKRGILSEDSPADVTVEAIRSLRTSLHFATMEARNNIIMISGPNPGIGKSFISTNLAVVIAQANMRVLLID
ADLRRGELHKDFSIEMKNGLSDLLSNSVEYEKAIIKNKIANLDFLPRGQVPPNPSELLMRKQFSNLLDWASNNYDLVIID
TPPVFAVTDPVIIGKHAGTSFLVALFEGNTVKEIDAAKRRFENNGININGIILNGVVKRATNKYGNYAYYQYSYDSDKR
>gnl|bykdb|A0A0P0YS37 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. 5710/52] (length=720 residues).
MVSVTKTSASKNEDDIDLSRLVGEFIDHRKLIISVTSLFTVIALVYALFATPIYQADALIQVEQKQANAILTNLSQMLPD
SQPQSAPEIALLQSRMVLGKTVDDLNLQARITPKYFPILGRGWARLTGTKNGELRIAKLFIPGANEDYIPKLQLNVIDNK
RFEIVGDDFSFESDFGKLTQKNGVVIDIANISAKPGDKFYISYTTRLKAINDLQDSFSVNDQGKDTGILTLSISGSEPSL
IKVILDRITENYLEQNIERQAAQDAKSLEFLNQQLPKVRGELDIAEDKLNAYRRKSDSVDLSLEAKSVLEQIVNVDNQLN
ELTFKESEISQLYTREHPTYKSLMEKRKTLLDEKSKLNKRVSAMPETQQEILRLSRDVESGRAVYMQLLNRQQELNIAKS
SAIGNVRIIDDAITQPKPVKPKKVLVVIIGLVLGFMISVGLVLIRVFLRRGIESPEQLEEIGISVYASIPVSESFTKKIN
NSNKVKNVKAAEYQGFLALDNPADIALEAIRGLRTSLHFAMMDAKNDILMISGASPNAGKTFVSTNLAAVTAQTNKKVLF
IDADMRKGYTHKLFNVNNDNGLSDYLSGRVDTEKCIKAISAGFDFISRGAVPPNPAELLMNSRLEKLLDWAKDNYELVIV
DTPPILAVTDAAIIGRHVGTTLLVARFELNTPKEIEVSLRRFDNSGVHINGCILNGVMKKASSYYGYGYNHYGYSYSDKD
>gnl|bykdb|A0A0P0YS75 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella pneumoniae] (length=720 residues).
MSSVTNKATSKDADEIDLGRLIGEFIDHRKLIISVTSLFTLVALIYAIFATPIYQADALIQVEQKQANAILSNLSQMLPD
SQPQSAPEIALIRSRMILGKTVDDLNLQARVKQKYFPLLGRGFARLSGDKPGSLSISRLYIPENDNDTPEIILTVKERNS
FSISVGDFIINGKVGELLDERGISLKVDEISAKPGTEFSIVYVSRLKAITDLQDDIAVADQGKDTGMLTLSLTGDNPVLI
ERILNSISENYLAQNIARQAAQDAKSLEFLSKQLPQVRSDLDQAEDKLNQYRRKSDSVDLSLEAKAVLDQIVNVDNQLNE
LTFRESEISQLYTKEHPTYKALMEKRKTLQDEKAKLNKRVSAMPETQQEILRLSRDVESGRAVYMQLLNRQQELNIAKSS
AIGNVRIIDNAVTQPKPVKPKKVFIVLSGIIFGIVFSAGIVLLRVFLRRGIETPEQLEELGINVYASIPVAEKFTKSVVQ
RKGWNKKSVDEIQGFLAVDNPADLAIEAIRSLRTSLHFAMMEARNNVLMISGASPNAGKTFVSSNLAAVISQTGKKVLFI
DTDMRKGYTHKLFNESNTNGLSDILSGKIEINKAIKTITSAGFDYISRGMAPPNPAELLMHRRFGELLNWASENYDIVVL
DTPPILAVTDAAVIGNYAGTTLMVARFELNTAKEIEVGIKRFEQTGVVVKGCILNGVVKKASSYYGYGYNHYGYSYKDNK
>gnl|bykdb|A0A0P0YSA1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. 2212/52] (length=720 residues).
MSTVNQKIDKKNHEEIEIGRLIGELIDHRKLIISVIALFMLLAIIYALFSTPVYQADALIQVEQKQGNAILSNISQMLPD
SQPQSAPEIAVLQSRMILGKTVDDLNLQASIQQKYFPIFGKGLDRLLGEKPQHITISRLYIPSKDDEEPQLNIEVLDKNN
YKINYNGKEILGAVGQLLNDDEFTLKLDKIDAKPKTRFTVTFKTRLKAITDLQEVFSVSDQGKDTGMLVLSVLGEDPELI
KSALNSISDNYLAQNIARQAAQDAKSLDFLNEKLPKVRNDLDVAEDKLNLYRKQNDSVDLSLETKSVLDQIVNVDNQLNE
LTFRESEISQLYTKEHPTYKALMEKRKTLQDERGKLNKKVSSMPETQQEILRLSRDVESGRAVYMQLLNRQQELNIAKSS
AIGNVRIIDDAVTQPKPVKPKKVLIVLIGIVLGTIFSFGLVLLRVFLRRGIETPEQLEELGISVYASIPVSETLTKKTAQ
AKGKRKKKDSEEKSYLAIENPADLAIEAMRGLRTSLHFAMMEARNNILMISGASPNVGKTFVSTNLSAVISQTGKKVLFI
DTDMRKGYTHKLFGLSNDKGLSDVLSGKIEVKDSIKKVTLTGFDFISRGAVPPNPAELLMHRRYGELLSWASQHYDIVIL
DTPPILAVTDAAIIGNYAGTTLLVARFEQNTAKEIEVSVKRFEQSGVTVKGCILNGVIKKASSYYGYGYSSYGYSYKGED
>gnl|bykdb|A0A0P0YSA3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. 43] (length=720 residues).
MTSVINNKSSSPDSDEIDLGRIIGELIDHRKLIVAITTGFTVLALLYALLATPVYQANALIQVEQKQGNAILNSLSQMLP
DSQPQSAPEIALLQSRMILGKTVDDLNLQARVEQNFFPIVGRGLSRIIGEKPANIDVTHIYLPKIEGQDSPSIKVKIKDK
NHYQIEYGDTILDGVVGELLETKGISLLIRSVDAEPGDSFTVTYVSSLKAINNLQESFNVTEQGKDTGMLNLTLTGDDSE
LITHILDGISQNYLAQNVARQAAQDAKSLEFLSKQLPEVRSELDSAEDKLNAYRRQKDSVDLTMEAKSVLDQIVNADNQL
NELTFREAEISQLYTKEHPTYKALVEKRKTLQEEKAKLNKRVSGMPSTQQEVLRLSRDVESGRAVYLQLLNRQQELNIAK
SSAIGNVRIIDTAVTEPKPVKPRKVLIVVMGLLLGLFVSIGLVLLRVFLRRGIETPEELEDMGINVYSSIPVSEWLTKHL
SSNKRKKQESDTLLAVENPADLAVEAIRSLRTSLHFAMMESKNNILMISGASPNAGKTFVSTNLAAIIALTGKKVLFIDA
DLRKGYVHKMFGQNQPKGLSDILSGQEVTENVVQKVVGGEFDYISRGQIPPNPAELLMHERFEAILKWASQQYEIVIIDT
PPILAVTDAAIIGRYAGTTLLVARFEVNTPKEIAVSIRRFEQSGVTIKGCILNGMVKKASSYYGYGYNHYGYSYTDKRSD
>gnl|bykdb|A0A0P0YSB2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. NCTC 8172] (length=724 residues).
MSSGNKQTNTKEADEIDLGRIIGELIDHRKLIISITALFTLLALVYAIFSTPIYQADALVQVEQKQANAILSNLSQMLPD
SQPQSAPEIALLQSRMILGKTVDDLNLQIRVQENYFPLFGRGWARISGKKESEVKISNLYIPKKDGDTPQVNLIVQDEKN
YIIETDDFKFKGVVGELVEEKGISIKVDSISAQPGTSFTVSYVSKLKAISDIQEQLTVSDQGKDTGILILSLIGDNPKLI
EDIIDSISNNYLAQNISRQAAQDEKSLEFLSAQLPKVRNELDNAEDKLNLYRRQNDSVDLSLEAKSVLDQIVNVDNQLNE
LTFRESEISQLYTKEHPTYKALMEKRKTLQDEKGKLNKRVAAMPETQQEILRLSRDVESGRAVYMQLLNRQQELNIAKSS
AIGNVRIIDNAVTQPKPIKPKKAIIVLLGIIGGGVVSIGLVFLQIFLRRGIESPEQLEEIGINVYASIPVAEAFSKQAMQ
AAKTISVKKKANSEYSAGFLAVENPADLAIEAIRGLRTSLHFAMLESRNKILMISGASPNAGKTFVSTNLAAVIAQTGKK
VLFVDADLRKGYTHKLFNVSNDNGLSGILSGTVTVDKAVKRLKEPGFDFISRGIVPPNPAELLMNSKFNELLDWANHNYD
LIIIDTPPILAVTDAAIIGNYAGTTMLIARFELNTAKEIEVSYKRFEQSGVKVKGCILNGVVKKASSYYSYGYNHYGYSY
TDKK
>gnl|bykdb|A0A0P0YSC3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. 8464] (length=721 residues).
MSSVKNRTVEKEADEIDLGRLVGELIDHRKLIISVTALFTLIALLYALFATPIYQADALLQVEQKQGNAILNSLSQMLPD
SQPQSAPEIALLQSRMILGKTVDDLNLQAKIEQSYFPLLGKGWARLVGEKKGILVVSRLYLSSDSDTEIPKLKLKVKDAN
NYIVTFNDHEFEGKVGVLLDSNGISLKVDSIEAKPGTEFVISYVSKLQAITDLQEIFSVADQGKDTGILSLSLTGPDPLL
LEKTLNSISNNYLAQNVARQAAQDAKSLEFLNQQLPKVRNDLDIAEDKLNQYRRQKDSVDLSLEAKSVLEQIVNVDNQLN
ELTFRESEISQLYTKEHPTYKALMEKRKTLQDEKAKLNERVSAMPKTQQDILQLSRDVDSGQAVYMQLLNRQQELNIAKS
SAIGNVRIIDDAVSQPKPVKPKKIIIVLVGIVLGGMISIGIVLLRIFLRRGIESPEQLEELGINVYANIPISETFANKAL
QNTKLRRKAGSEYQSFLAVDNPADLAIEAIRGLRTSLHFAMMEARNNVLMISGASPNAGKTFVSSNLAAIIAQTGKKVLF
IDTDMRKGYTHKLFNLSNDNGLSDVLSGKIEVSKAIKKVSSAGFDYISRGMVPPNPAELLMHRRLGELITLVSQSYDIVI
LDTPPILAVTDAAIIGNYVGTTLLIARFEQNTTKEIEVSVKRFEQAGVSVKGCILNGVVKKASSYYGYGYSHYGYSYSDK
K
>gnl|bykdb|A0A0P0YSD1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. SW4] (length=720 residues).
MSSVKNKPVEKEAEDIDLSRLIGEVIDHRKLIISIVSLFTLLALVYALFATPVYQADALVQVEQKQGNAILSNLSQMLPD
GQPQSAPEIALLRSRMILGKTVDDLNLQSIATQHYFPLFGRGFARLSGEKPATISISRLYVAKKDDETPKLKLKVIDAYN
YSISSDDTELHGKVGQLLDDKGISIKVDKLNAQPGVVFDIEYVSKLKAITSLQDVLNISDQGKDTGILSISLTGVDPELI
KQIVDSISNNYLAQNISRQAAQDAKSLDFLSEQLPKVRGELDVAEDKLNAYRRQNDSVDLSLEAKSVLDQIVNVDNQLNE
LTFRESEISQLFTKEHPTYKALMEKRKTLQDEKGKLNKRVTAMPETQQEILRLSRDVESGRAVYMQLLNRQQELNIAKSS
AIGNVRIIDDAVTQPIPVKPKKALIVVAGMIFGGMLSVGVVLLRVFLRRGIESPEQLEEIGINVYASIPVSEEFAKRTNK
IKSSRRKNSAEIQGLLAIENPADLAIEAIRGLRTSLHFAMMESRNNVLMISGASPNAGKTFVSSNLASIIAQTGKRVLFI
DTDMRKGYTHKLFNIGNENGLSDYLSGKIELVKSIKKVPSTDFDYISRGMVPPNPAELLMHKRFDELINWASSNYDIVIL
DTPPILAVTDAAIIGNYAGTTLLIARFELNTAKEIDVSVKRFEQSGVVVKGCILNGVVKKASSYYGYGYSTYGYSYSDKE
>gnl|bykdb|A0A0P0YSK3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. 3534/51] (length=720 residues).
MASMKNKTSSENTEQVDLGRLIGEFIDHRKLIISVTSLFTLLALVYAIFATPVYQANALIQVEQKQANAILSNLSQMLPD
SQPQSAPEIALLQSRMVIGKTVDDLDLQTRIRENYFPVVGKGLSRLMGKVPGEIDVSRFYLKAGENEQPKINLTVIDDNH
FKIDFDGDNINGVVGELINKNDIAIKVDKINAMPGTEFTISYVSRLQAITDLLDVFSVADIGKDTGMLSLSLTGDNPLQI
EKIINSISNNYLAQNISRQAAQDAKSLDFLNQQLPQVRHDLDIAEDKLNQYRRQSDSVDLSLEAKSVLDQIVNVDNQLNE
LTFRESEISQLYTKEHPTYKALMEKRKTLQDEKVKLNQRVSSMPKTQQEILRLSRDVESGQAVYMQLLNRQQELNIAKSS
AIGNVRIIDNAITQPKPVKPKKVLIVLLGIIFGLLISTGLVLIRVFLRRGIESPEQLEELGITVYASVPVAETFMKNNVS
KPNKLKSKDNDIKSLLAIDNPADLAVEAIRGLRTSLHFAMMESRNNVFMISGASPNAGKTFISSNLASVIAQTGKKVLFV
DTDMRKGYTHKIFNVNNENGLSAYLSGRVEIGKVIKKIDGVEFDFITRGAVPPNPAELLMHKRFGELIDWANNHYDIVIL
DTPPILAVTDSAIIGNYAGTTLLIARFELNTPKEIEVSIKRFEQSGVLVKGCILNGVVKKASSYYGYGYNHYGYSYTDNK
>gnl|bykdb|A0A0P0YSL8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. 1205] (length=719 residues).
MSLETSKSVKESDEIDLGRLIGELIDHRKLIVSVTALCTLIALVYAIFSTPVYQADALIQIEQKQGNTILSSLSQMLPDS
QPQSAPEIALIQSRMILGKTVDDLNLQAEVKQNHFPVFGNGWARISGDEKGELSVSRFYLAIKEDDAASIKLTVLDDENY
IVEGDGFRLKGKVGQLLEDKGFSLRIDAINAQKGSAFTITYISRLKAINELRKTLSVTDQGKDIGMLTLSLTGEEPDLIK
KIIDSVASNYLEQNVAREAAQDAKSLDFLNQQLPEVRSELNTAEDKLNKYRQQKDSVDLSLEAKSVLDQIVNVDNQLNEL
TFRESEISQRYTKEHPTYKALIEKRQTLVEEKRKLNKRVSAMPETQQEVLRFSRDVDSGRAVYMQLLNRQQELNIAKSSA
VGNVRIIDNAVTQPRPIKPNKLVIVLMGIFLGMLSSISLVLIRVFLRRGIESPEQLEALNINVYASIPVSESFVKNTSHV
QSWRKREQDEVQGFLAVDNPADLAIEAIRGLRTSLHFAMLEARNSVLMISGASPNAGKTFISSNLAAVIAQTGKRVLFID
TDMRKGYTHKLFNVSNDSGLSDFLSGKIGIDKAVKSIPTAKFDFITRGMVPPNPAELLMHRRFDELITWANSNYDIVILD
TPPILAVTDAAIIGHYAGTTLLVARFELNTSKEIEVSIKRFEQSGVIVKGCILNGIVKKASSYYSYGYNHYGYSYTDKK
>gnl|bykdb|A0A0P0YSN5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. 167] (length=720 residues).
MSPVINKPQAKDSDEIDLGRLIGELIDHRKLIISITSLFTLIALAYAILSTPIYQADALIQVEQKQANALLSSLSQVLPD
SQPQSAPEVALLQSRMILGKTVDDLNLQIRIKQNYLPIVGRGWARLLGESPGSLTISRLYLHSTSEESPEITVIVKNNKE
FTIAGEDFTIEGHVGDLIERKDFSIKIDSIDAEPNTSFTVSYVSKLKAITDLQEVLSVADQGKDTGMLAISLTGADPELI
VKIIDNLSANYLAQNIARQAAQDAKSLEFLNNQLPKVRSELDLAEDKLNQYRRQNDSVDLSLEAKSVLDQIVNVDNQLNE
LTFRESEISQLYTKEHPTYKALMEKRKTLQDEKTKLNKRVSAMPETQQEVLRLSRDVESGRIVYMQLLNRQQELNIAKSS
AIGNVRIIDNAVTQPKPVKPKKILILAAGIILGTIFSFGLVLLRVVLRRGIETPEQLEELGINVYASIPVSETFTKKADQ
SKGWRKKQQSEIQGFLAVDNPADLAIEAIRGLRTSLHFAMMEARNNVLMISGASPNAGKTFVSSNLAAVIAQTGKKVLFI
DTDMRKGYTHKLFNVSNDNGLSDVLSGKVNKENAVKSISSASFDFISRGIAPPNPAELLMHKRFGELVAWASHNYDIVVL
DTPPILAVTDAAVIGHYAGTTLLVARFELNTAKEIDVSIKRFEHSGVMVKGCILNGIVKKASSYYGYGYSHYGYSYTEDK
>gnl|bykdb|A0A0P0YSN8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. 26] (length=720 residues).
MDNCMTSQKNNGVPSQESDTIDVARLFGELIDHRKLITALTAGFTVLALLYALMATPIYQANALIQVEQKQGNALINSLS
QMLPDSQPQSAPEIALIQSRMILGKTVDDLNLQAQVEPIYFPIFGSAISRLFGNFRPKIEVKNIYISSSEHDPEITLSVK
DDYSYQVKWGDAVYNGRTGEILEGNGISLVISSIKAEPGSEFKIKYLSRLNAIANLQDSLNVVDLGKDTGILNLTLSGDD
PDKIALILENISQNYLSQNVARQAAQDAKSLDFLNQQLPKVRNELDIAEDKLNLYRRQKDSVDLSMEAKSVLEQIVNVDN
QLNELTFREAEISQLYTKEHPTYKSLMEKRKILQDEKTKLSKKVSSMPSTQQEVLRLSRDVESGRAVYLQLLNKQQELNI
AKSSAIGNVRIIDNAVTELKPIKPKKTLIVLIGIVLGSFISIALVLLKVLLRRGIESPEQLEEIGINVYANIPVSETQSK
QIVRNKDFNKESKTLLATENPADLAIEAIRGLRTSLHFAMMEAKNNILMISGASPNAGKTFVSSNLAAIIASTGQKVLFV
DADLRKGYAHKMFGNTNNFGLSDVLSGKLEVDKVITKVNESGFDYIGRGLVPPNPAELLMHPRFESFLKNISARYDLVII
DTPPILAVTDAAIIGRYVGTTLLVARFEVNTAKEIDVSIKRFEQGGVQIKGCILNGVVKKSSSYYGYGYNHYGYTYTDKN
>gnl|bykdb|A0A0P0YST4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. 4349] (length=714 residues).
MNTKNNINTKESDDIDLSRFIGEIIDHWKIIFSVTCFFALVGIIYAFFASPVFQADALVQVEQKQGNAILNNLSQMLPDS
QPQSAPEIALLRSRMILGKTVDDLNLQTIVSQNYFPVFGKGWARLMGEKPGNVSISRIYVDDSLNKEPSIKVHIFNNEKY
ELMVNGESVIGKVGNLLDFNGVTIKIDKVNAEPNTSFDIKYISKLSAITNLQDVFNVSDQGKDTGMLNLTLTGNDPGLIE
NILDNITSNYLAQNISRQAAQDEKSLEFLNQQLPKVRSDLDEAENKLNVFRRKNDSVDLSLEAKSVLDQIVNVDNQLNEL
TFRESEISQLYTKEHPTYKALMEKRKTLQDEKQKLNKRVSNMPETQQEILRLSRDVESGRAVYMQLLNRQQELNIAKSSA
IGNVRIIDNALTKTTPVKPKKILVIIFSIVIGAIVSISLVLARAFLRRGIDNPEKIEELGLNVYASIPVAESVSKKGINN
SDTQPQEFLSLSNPADLAIEAIRGLRTSLHFAMMEARNNVLMISGASPNAGKTFISSNLAAVIAQSGKKVLLIDADMRKG
YTHKIFGVANNNGLSDVLAGKSNYNQAIKHIERANFDFISRGITPPNPAELLMHKRFGDLIKLASENYDIVILDTPPILA
VTDAAIIGGYAGTTFLVARFEVNTAKEIEVSVKRFENSGVRIKGCILNGVVKKASNYYAYGYSDYGYSYKDANK
>gnl|bykdb|A0A0P0YSV6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. 370] (length=722 residues).
MPSVTNKTSSKETDEIDLGRLIGEFIDHRKLIISVTSLFTLIALIYALFSTPIYQADALIQVEQKQANAILSNLSQMLPD
SQPQSAPEIALIQSRMIIGKTVDDLNLQAQVKQKYFPVFGRGFSRLIGNKPGHLTISRLYIPENGRDEPEISLSVIDSNR
FSVKLDNTTVAGYVGQLINEKGISLKIDEIDAEPGTEFSITYLSRLKAITDLQERISVVDQGKDTGMLVLSLNGDNPDLI
ERIINSISENYLAQNIARQAAQDAKSLDFLNKQLPQVRNDLDLSEDKLNQYRRKNDSVDLSLEAKAVLDQIVNVDNQLNE
LTFRESEISQLYTKEHPTYKALMEKRKTLQDEKTKLNKRVSAMPETQQEILRLSRDVESGRAVYMQLLNRQQELNIAKSS
AIGNVRIIDNAVTQPKPVKPKKILIVLIGIVFGAIFSAGLVLVRVFLRRGLETPEQLEEIGINVYASIPVAESVAKSNAK
DKGWLKNSKDEFSSFLAVENPADLAIEAIRGLRTSLHFAMMESRNNVLMISGASPNAGKTFVSSNLAAVIAQTGKKVLFI
DTDMREGYTHKLFKQKNINGLSDILSGKIDLNNAVRTINEAGFDYIPRGMVPPNPAELLMHRRFGELLELASGKYDLIVL
DTPPILAVTDAAIIGNYAGTTLLVARFELNTAKEIEVSVRRFEQAGVTVKGSILNGVVKKASSYYGYGYNHYGYSYSDKN
DK
>gnl|bykdb|A0A0P0YSW2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. 5845/52] (length=721 residues).
MASITNKNEIKDSGELDLGRLLGELIDHRKLIISVTSLFTLLALIYALFATPVFQADALVQVEQKQANAILSNLSQLLPD
SQPQSAPEIALLQSRMILGKTVDDLNLQTRVEPLYFPLFGKGWARLTKKNAGSLDVVKFYLSGANDEDAPDAEVRVIDKN
HYEITVNDNVYKGTVGELLQNNDVIIKVDSINSEAGNEFKLTYYSRYKAIANLQENLSVIDKGKDTGMLTLSLSGYDPVL
IQKIVDNIASNYLAQNIARQAAQDAKSLDFLNEQLPKVRSDLDLAESKLNEYRKKSDSVDLTLEAKAVLDQIVNADNQLN
ELTFRESEISQLYTKEHPTYKALLEKRKTLQDEKNKLNKRVSAMPSTQQEILRLSRDVESGRAVYMQLLNRQQELSIAKS
SAIGNVRIIDKAITQTKPIKPKKVVIVLSGILIGIIFSVIIVLLRVFLRRGIESPEQLEEQGINVYASIPVSEEFAHNIL
KKNKSGTKKNVEYAHFLAVENPADLAIESIRGLRTSLHFAMMEARNNILMISGASPNAGKTFVSSNLAAVISQTGKKVLF
IDADMRKGYTHKLFKASNENGLSDYLSGKVELQHIIQKIPVGDFDFIPRGIVPPNPAELLMHRRFGELTNWANEHYDIVI
MDTPPVLAVTDAAIIGNYVGTTLLIVRFEQNTVKEIEVNIKRFEQSGVIVKGCILNGVVKKVSSYYGYGYQHYGYSYSDD
K
>gnl|bykdb|A0A0P0YSZ1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. 889] (length=725 residues).
MAPTSFKNQAVSEADEIDLGRLFGEFIDHRKLIVSVTAFFTVMALLYSLFSTPIYQADALVQVEQKQGNALLDSINQVLP
NGSQQSAPEIALLQSRMILGKTVDDLNLETSISRDYFPIFGNGWARLTGENAGEVKISKFLLNNEEGNTESKLTVIDNDN
FIISTDSADYKGKVGIVVSNKDLTIMVDHINAPPGASFTISKITRLQAINNLQKVLSVADQGKDTGMLNLTLTGEEPKRV
TAILDSISQNYLAQNISRQAAQDEKSLDFLKAQLPKVRDELDNAEDKLNSYRKTKDSVDLTMEAQAVLNQIVNVDNQLNE
LTFREAEISQLFTPDHPTYKALLEKKKTLAQERLRLNNQVTAMPATQQEILRLSRDVESGRAVYMQLLNRQQELNISKSS
TIGNVRIVDSAIAEPKPVKPKKIMVVLIGLVFGIFVSAGIVFGRMFLRRGIESPEVLEELGINVYASVPVSEWLTQKQSK
TGKVITKKALLKQKEETQSLLALDNPADLAIEAIRSLRTSLHFAMMESSNNVLMISGASPNAGKSFISSNLAVIIAQTGK
KVLLIDADMRKGYIHRVFGKNNDNGLSDILSGKVEFEKAVKNSQLENLNFVCRGQVPPNPSELLMHPRFKAFLDQASSNY
DLILIDTPPILAVTDAAIIGQYVGTALLVARFELNTAKEIEISKRRFEQSGVPVKGCILNGVIKKASSYYGYGYNHYGYT
YNSEK
>gnl|bykdb|A0A0P0YT12 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. 708] (length=722 residues).
MSILANKKIEKDSDELDIGRMFGEIIDHRKLIVSITSLFTLLSLIYALFATPIYQADALIQVEQKQGNAILNSLSQVLPN
TQPQSEPEITLLQSRMILGKTVDDLNLQAKVEQDFFPVFGRGWARLMGDSEGVLSISRLYLESPNKGKNTPEVKVIVNDN
NNYTVISDGYELKGKKGDLLDGKGISIKIDEIDAEPGTTFSVFYVPRLKAITDLQDTISVLEQGKNTGMITVSYTGDNPD
KITKIIDSISNNYLAQNISRQAAQDAKSLDFLNEQLPIVRNELDVSEDKLNAYRRKSDSVDLSLEAKSVLDQIVNVDNQL
NELTFRESEISQLYTKEHPTYKALMEKRKVLQDEKGKLNKRVSSMPETQQEVLRLSRDVESGRAVYMQLLNRQQELNISK
SSAIGNVRIIDNAVSQPIPIKPKKAIVVLVGIVLGLFVSVLIVLIRIFLRRGIESPEQLEELGINVYASVPVSETFSNIV
SSSKEWRGNKNGKIQKLLALDNPADLAIEAIRGLRTSLHFAMLEAKNNILMISGASPNAGKTFISSNLAAIISQADKRVL
FIDADMRKGYTHKLFESDNKNGLSDFLSGIAEKEATIKKITSIGFDFISRGTVPPNPAELLMHPRFKELLAWAGNNYDLV
IVDTPPILAVTDAAIIGGYAGTTLLVARFELNTAKEIEVSMRRFEQSGVNVKGCILNGIVKKASSYYGYGYHHYGYSYTD
KK
>gnl|bykdb|A0A0P0YT78 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. 3454-70] (length=718 residues).
MSSVKNKSVQKETDELDLGRLIGEFIDHRKLIISVTSLFIMLGLVYAIFATPIYQADALVQVEQKQANAILSNLSQMLPD
SQPQSAPEIALLKSRMVLGKTVDDLNLQAEVKQKYFPIFGAGWARLMGEKPGDISVTRLYLKPYQDEVPEITLTVNDSKN
YTISSNDLNLNGKVGQLLEGKGISLKINKIDADPGTQFNINYLTKLKAITDLQENLNIADQGKDTGMLSLSLTGSNAELI
KNIVDSISNNYLAQNISRQAAQDEKSLDFLNQQLPTVRAELDLAEDKLNLYRQQKDSVDLSLEAKSVLDQIVNVDNQLNE
LTIRESEVSQLYTKEHPTYKALMEKRKTLQDEKTKLNKRVSAMPETQQEVLRLSRDVESGRAVYMQLLNRQQELSISKSS
AIGNVRIIDKAVTLPKPIKPKKIIVVLGSVILGLVISIGVVLLRIFLRRGIESPEQLEDIGINVYASIPVSETFAQKLVK
KAGWKKNKIEEHQGFLAIENPADLAIESIRGLRTSLHFAMMEARNNVLMISGASPNAGKTFVSSNLAAIIAQTGKRVLFV
DADLRKGYTHKLFNVSNDNGLSDFLSGKVSIEQTVKTLPNVDFDFISRGAVPPNPAELLMHSRFGEIVSWANKHYDLIIM
DTPPILAVTDAAIIGNYAGTTLLVARFEQNTAKEIDVSVKRFEQSGVNVKGCILNGVIKKASSYYGYGYNHYGYKYND
>gnl|bykdb|A0A0P0YTE3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Klebsiella sp. A1517] (length=720 residues).
MSSVTNKSTSKDAEGIDLGHLIGEFIDHRKLIISVTSLFTLIALIYAIFATPIYQADALIQVEQKQANAILSNLTQMLPD
SQPQSAPEIALIQSRMILGKTVDDLNLQARVKEKYFPFLGRGFARLMGNKEGNISISRLYINGDDTEEPKVILTVKDKNN
YSIQMGDAVFNGKVGELLEENGISLKVDSIDAAPGNEFVVAYVSRLKAITDLQDSLIVADQGKDTGMLTLSLTGDNPLLI
ERILNSISENYLAQNIARQAAQDAKSLEFLSKQLPQVRGGLDLSEDKLNQYRRLNDSVDLSLEAKAVLDQIVNVDNQLNE
LTFRESEISQLYTKEHPTYKALMEKGKTLQDEKIKLNKRVSAMPETQQEILRLSRDVESGRAVYMQLLNRQQELNIAKSS
AIGNVRIIDDAVTQTKPVKPKKILILLAGIVFGGMVSVGLVLLRVLLRRGIETPEQLEEVGINVYASIPVAETFTKNNLQ
GKGNTKKVFNEIQSFLAVDNPADLAIEAIRGLRTSLHFAMMEARNNILMISGASPNAGKTFVSSNLAAVIAQTGKKVLFI
DTDMRKGYTHKLFNENNSNGLSDILSGKTEISLAIKTIKSAGFDYISRGMVPPNPAELLMNKRFGDLLEWANNNYDIVVL
DTPPILAVTDAAVIGHYVGTTLLVARFELNTAKEIEVSIKRFEQTGIIVKGCILNGVVKKASSYYGYGYNHYGYSYTDKK
>gnl|bykdb|A0A0P0Z6D1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Aureimonas sp. AU22] (length=758 residues).
MLHYTEMTAHDTAASKAAKGGASEFLNVERILAMVRRQMWVVIAAVAVGIVLGILYLLTAVPIYTSSTDILIDKGQSKLV
DELASASGVFQDEAEMLSQVELLKSRQIAGNVVDELKLDENDAFLAGTPSILRSVRVAVGGLIAAVRSELPVEQADASAQ
RRETAINILQNNLDVQRVGRTYVLRLSYDSPDPVLASSIARGFGSAYLDDQLQAKYAATRRASSWLQDRIAELRQQSYDA
DLAVQNFRNDNGLLLTGTGLVSQQQLSEINTQLTAARAQTAQSKAQLDQIEKIIQDGRTDALVNDALLSSTINTLRGKYL
DAARRESEIAGKLGPDHIQAIRLKTEMAEYERLIFGELRRIAESYRSTYEVSLERERSLETSLTDVTAVNAGNNTLQVRL
RELERESEAYRALYDDFLQRYQQTVQQQSFPITDARVITEPQAPDKPSAPKKPLILALFAFMGAAAGAGIAGFREYRERF
FRVGSQVRSELDMEFLGFMPILTPEEAKSDEQKAAPSKLWRPGALATYVRRHPMSSFAETLRNIKVAADLSMPDIPCKVI
GVVSCVPGEGKSSVAASFGNLLALQGMRTLLIDGDIRNPGLTRGLETKPEQGLVQAVLEQADVEDVTLRDDPMPLALVPT
VMRSRITNTSDLLASASMSRLLARFRGQYDYIVVDLPPVGPVVDAKAFAQRVDAFVFVVEWGKTSRQLVRSAIASNPIFH
SKSLGVILNKADSKKMRLYRSYGSPEYYASRYESYYRD
>gnl|bykdb|A0A0P6VNL5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Prosthecomicrobium hirschii] (length=727 residues).
MLFFALLGAVVGIGYALTAVPWYSASTQLLIDSRKGKDPDPTGSIAELQFDTGAIDSQVEVLKSERIVTAVIAKAGLADD
PGFQRATGSLFSNLMGAIRQSLDIKSWFGSDIESDTEVRFAKERLLISTLTNNLAVKRVARTYVLSIEFSWPDANRAAEI
SRAFADAYLDDQLESKFDATRRATEWLFARIQELKAKALETDMAVQRFKSDKGLVKSGSSGQLVGEQQLSELNSQLIVAR
GETARAEAKYERIKSIIDSGQADAAVSEALGSPVIIDLRNKYLKASKTEAELSARLGRNHIQVVSLRTEMREYERLIFDE
LGRIAESYKSEQEISRSREKALEEGLSGLVGANAGTNETLVALRELEREADTYKNLYQAFLQRYQEAVQKQSFPITEARV
ITAASRPLVPSHPKKSLVVALATILGLGLGLGIAALREIRDRVFRTGQQVRDELGLEFLGFLPAVTASQLRSMHPTSTDL
ASTGLPPVLANGVMRYSVGSPLSGYAEVLRSAKVAADITLGGHKPKIIGLASVLPNEGKSTTSKNLASLVAHLGARTLLI
DADLRNPGLSRSVAPEARQGLVEVLMDRIPFRELLLHEAETGLDLLPTVSRRDISHTSELISSVAMQALLQDAGQDYDYI
FVDLPPVGPIVDVRAAARLFDAFVFVVEWGRTARHVVRATLEHEPVIYEKTIGVVLNKANLAGVRLYEDYGSRDYYYGKY
KKYYRDR
>gnl|bykdb|A0A0P6W3C9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas viridiflava] (length=738 residues).
MTVMNRPSLDYYQDTRIDLATILRMLFDHKALIIWTVSLFFLAGLAYAILATPVFQASAMIQIEPKKVGIEGTPEVNNKP
SSVSQATTEIELIKSRALLGKVVDDLKLNLVQTPDFFPVIGPYLYRTFKPEYDGALAEPLFGLTQYAWGGEKIDVFQLEV
PEALLGEKLTLVAGNPGQFSLYDSDHNLLLSGAINRIVEGNGVKIQVAALHAHPGTEFTISRQRTLTSALIYQNRLKITE
AGKDSGIIYLSIEDQDADKANKILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPMVRKQLEESEVALNNFQTSAKSVDL
SIETKGVLDQVVKLDSMLSELKLKRVEIERLYTQEHPTYRSLMSQMSQLEQQKQGLLKKIEALPMTQQELLRLTRDMQVT
SQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTNVERPVKPMKTLVVLLATLVGALVAVTIIFVRQAFYRGVESAEVIEN
SGMPVYASLPYSRQQDRLEKTTKGGGAPKESKLLSIAAPNELAIESLRSLRTSLHFAMLEARNNVLMISSPSPGAGKSFV
SSNLAAIIAQTGKRVLLIDADMRKGYLHRIFGLQPKHGLSDTLAARLKCTEVINHTQIRHLDFISCGFAAPNPSELLMHD
NFNKMLTELSPLYDLILVDTPPILAVTDATLVGRQAGTCLLVARFGITTLKEIEACKRRLGQNGILIKGAIFNAVVRKAT
TSDYDCAAYGYNYHPVNK
>gnl|bykdb|A0A0P6ZCZ4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Citromicrobium sp. RCC1885] (length=743 residues).
MNIQASRFGSESGPSDQPPQGGGNPLGVQAGQPGEGDGPSIVQHYLRIAQRWRWLILGSIAACVALGLVATLLMTPQYTA
TATIEISREGSQVTNFEGVEREVSISDQEFYQTQYGLLRARTLAERVAGQLGLIDNPEFFASYGVEGGDDPAFALDNGRY
TAQGRQDRQRIAGEILLANISVAPARLSRLVDISFTGPDPAFAARVSNSWAENFIQSNLERKVQATSYGRDQLQAQLADY
KERLDESQRQLVTYASSEEIINLPAQPGADGRTQERSIVADDLAALNAALTEATADRIQAEARARQAGGGSSSTESLSNP
AINNLREKRADLAGQYELLMVRFEPGYPQARALQSQIDELDRAIAREEARVSGSLQGDYRAALEREQTLQARVNRLKADY
LDLRRRSIQYNIYQQEVDTNRALYDGLLQRFKEIGVAGGVGVNNVSIIDPADVPQAPSSPNLLMNILLSLIVGAGLGAAL
AFLLEQIDEAITDPTEVRRKLGLPLLGTIPTVAEGRPDEALLDRKSSLVDAYLAAFTNLGFTTEHGVPRSFAVTSTRPAE
GKSTSSLALATTLARAGKSVILVDGDMRSPSVHQLGGVDHDRGLSNFLAGDDEIETMTFPMTHLGFTAMSAGPIPPNAAE
LLTGNRLDLLMRRLLETYDHVVIDSPPVMGLADAPLIATHVEGVLYVVESHNIRAGLVKNAIGRLNSANIRIFGALLTKF
EAKKSAYGYSYGYEYGYSYGKED
>gnl|bykdb|A0A0P7DR08 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Cobetia sp. UCD-24C] (length=712 residues).
MLALLWHRRWWLIGSTLLFTLLGIYLVGSQQRIYLADSLIQIEDKGGSASLLGPLAGQATGSDESSTSDELEILTSRLVL
GQAVDRERLNIVVSPMRYPVIGDWLSNRHLRLPASLGGQDYAWGDDTLKVTTLELSGPWQQQTLTLEALGDERYRLLDAE
GQAIVDGKVGENALAEGIKVFVRELSAEPGARFTLTSISDLSAINSLKSRFTAVRNGTDTGVVTLSLSGSDQTAIVNTLD
TITNVFLQQNIERESAEADNQLGFLGDQIPTLRGQLDEAESALNDYRRRRDSVDLTAESQQVMENLVGLDNQLTEIKLRL
AELSRAYTSEHPAYRALVARRDSLNQEKARVQKQAEQLPAAQREALNLNRNVTVSQEIYVALLNKREEVRLKKAGTVGNV
RILDPAVLQPVPISPKTSLMLAVFCMIGLMLGTLAALLRHAMRKGIDTAEQIEALDLPVYATVPLSPQQHNMMRRVRLKG
EKGGREIYQGVLATSQPSDISIEALRSLRTSLHFALLDNRRKSVMFTGPSPGIGKSFVSLNLAAVSAEAGQRVLLIDADM
RRGHLHHAFQRTSEQGGLSDVLSGASPLDSVLYHSRIDNLDFLGRGVAPPNPSELLMQPNFAELLEQLGERYDLIIIDTP
PVLAVTEALIIGRHVGASLMVARFGMNQVRELEHARKKLENNGIHVKGAILNAIEPQAGDKHGYGYYNYSYA
>gnl|bykdb|A0A0P7DSP4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudoalteromonas lipolytica] (length=752 residues).
MNAQPTALAANNKQNRTTQDQTSQEIDLMALLGALIDRKYFIAAVTSVFMAVGVFYAVFATPVYQATAMIQVEDGGASVP
GFDDMAGMFESTSAAVTEIELLKSRSVIGEAVDTLKLDIVAEPKLFPIIGNRAFRKFTPMEVGDVAEPSLGASSYAWGGE
SVDVFRFDVPRSAVDDEFVLVAGEGTGKNKSFTLLNDEDEVILQGKVGEELTNGKFNLTIRSLTARAGTEFTLIRKDRLN
TILDLQAAIGASEKGKDSGIINLSLQSESTHFAEKVLDKVAAIYVRRNVERNSAEAQKSLEFLEVQLPEVKKQLEYAEQR
FNDYQIKRQSINITLETQGVLEQVVELETKLQELELKRLELSRKFKESHPTYQGVLEQIEAVQKQKQNLVGEVGNLPETQ
QELLRLKRDVEVSNQIYTLLLSKTQELDIVRAGTVGNVRIIDQAEVNTSKPVKPKKSLIVVMATMLGGMLAVAIVLIQKA
IHKGVEDPNEIEALGLPVYASVPYSDYQDKLTGFSRARKGKDKPKSILAVDNPADLSIEALRSLRTSLHFAMMEAKNNII
AISGPSPGVGKSFISVNLATVLAQSGKRVLIIDADMRKGYLQTQFGMKWDDGLSDLLSGRLTLEQVTKTSQVQDLDVITR
GQIPPNPSELLMHSNFTKMVDQVKDKYDIVIIDTPPILAVTDPAIVSAHTGTTLLVTRFGQNHAREIELTRNRFEQNGID
VKGVVFNGVVKKASNAYGYYGYYNYEYKSGGN
>gnl|bykdb|A0A0P7E3M3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio alginolyticus] (length=726 residues).
MNGTHPNNLQMNKVELIRFGHHFKAIKKNWLSIAAFTLLFSLTCTWYIYSKASIYQATATLLIQEEQKSALSIEEVYGVD
TTKKEYFQTQIAILKSNHIADKVIRELNLTQLPEFTSSGGVNKKIDQIKSIPFVQDLLNVAPSPKETAQFSESYYQALQA
FRSKLDIEPVRNTQLVRIRFRSTDPKLAMTIANAVGQAYIDANFEAKLVVTQNAATWLTNNSQKLEERLRNSEQALQEFL
LKEGLIDINGIDEIYANELEELTRKLNIAVNKRIEAQTLIQLLRRKSSQSLDSLLSIDEFANQAQIRDLKLSEAQAAKNL
SELAQRYGPKHDRMIQAKAQLAEIQSRTQQLIRDISFSKQQDLLAAKAQEDMLREELDNKKSDFQSLGSQKARYEQLKRE
VESNKALYEAFLNREKETNATSDYKNVTARFTDKAIIPLFPVAPQRIKLVLIATFFGFAIACALVIILETMREVIRSTAD
VQEKLGVTCLGVIPMVKKRNLRKNGVSYSAYLDDEEKLFSEACRSVRTSLLLRLTNTKQKILPFTSAIPEEGKTSTSINM
AVSFSKMEKVLIIDCDLRRPSIAKRFGIAESSPGLTHILTMDTPIKDCVTHIKEANLDVLPAGLVPPNPQELLASDRFKK
LLEHFQNKYDRIIIDTPPLLSVSDALILGKYANGLITVIRSESTKSSLVNLALSKQIQHSVPSLGVLITQAKAKEGETLY
VQKYAY
>gnl|bykdb|A0A0P7EEY3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Vibrio alginolyticus] (length=722 residues).
MTTQTIKQSRQADDEIDLGKLFGIILDAKWLILCTVVLFSIIGVGVAILSTPIYKADALIQIESKSSGGISAMVGDMGEL
FSAESSATTEIEIIKSRMILGGTVDKFNLTTVVSPNYMPIIGKGLARLQGEQISLSVSRFNAPSYAVGVPLTLEVIDSEK
QTFRLLEDDNNVILEGKVGELLEKNGYQFLATELVAQTGDSFTVSKISKLDAINKLQENLSISERGKQTGIISLSFSGED
RAKIQDILNDISQNYFLQNVQRNSAEAEQSLEFLKGHLPDIKTKLTASEDVLNRFRQENESIDLGLEAQSTLKVMVELEA
QLNELTFKESEISQRFTQDHPAYKSLLDKRETLLKEKERLNKQVQKLPKTQREVLRMTRDVEVNQQIYIQLLNKVQELNI
IKAGTVGNVRILDSAQSFSKPIKPKKALIVVLATLLGGMAGVAFVLIRAAFHRGVETPDQIEQIGMPVYASVPKSIQQLE
FANKLKRNKGSNNELVLLAEANPADLSIEALRSLRTSLHFAMMEAKNNVLMISGPAPSIGKTFVSTNFAAVAAKTGQKVL
LIDADMRKGYLQQCFGLRWDNGLSDYLSGKTSLSNIIKSTSIDNLDVVTRGQVPPNPSELLMHPRFKSFVDEMSAQYDLV
IIDTPPVLAVTDPSIVGALAGTTLMVARFDQTTLKEIEVAQGRFEQSGVEVKGVILNAVEKKASNSYGYGYGYYNYAYKS
ES
>gnl|bykdb|A0A0P7G8P5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Xanthomonas sp. Mitacek01] (length=747 residues).
MNKETQSPSRDEDEIDLRELAGMLIDRKWLILGITALFFVVSVAYALLATPVYQAQSMVQVESKVPSIPGLSDLSSLGMG
ASSSAATTEVALITSRAVIGDAVDALQADVVVKPARFPVIGDFFARRHRADRQNAVAPAKFGASSYGWGGESLKIVGLDV
PAFLIGKTLILIAADETGRFTLEDPDGNRLLDGAVGTEAAGQGVKLQVAALHANPGTRFEVTRLRRLDVVAGYQQAVKAS
EQGRESGILRLVFEDTDPVFAEAFLQQVAGAYVRQNVERNSAEASSQLTFVRDQLPTIRQQVEAAQAAMSAYQTTANSVD
ITMQTQGLLQQEVAVETSIQQLKMKQAEMDRSFTREHPAYRALMTQLGELEGRKAGFRRQVSNLPDTQQELLRLTRDLQV
SNELYTGLLNQAQQLDVARAGTVGNVRIVDPAVVDTARPVKPRKPLIVLIGTLLGGFLAVGLVFLQRIMNPGIEDPAQIE
ELGLPVYAAIPLSTAKDLLVTDRIRNRSGRVRRDAGFDKRQHLLAVNAPADLAVEAIRSLRTSLHFAMLEAKNNILTISG
PCPAVGKTFVSANLAAVIAQAGQKVLVIDADMRKGTLHKVLGSVHTEGLSDVLAGKVKAEDAIKSAPGLKGMDYMVRGDI
PPNPSELLMHPRFGELLASLAARYDLVIVDTPPILAVTDAAIVARHAGSNLLVTRFGVNQPKEILLTKKRFEQNGVTVKG
AIFNAVEKRATGYYSYGYYEYKADSKA
>gnl|bykdb|A0A0P7L2Z9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Neisseria sp. 83E34] (length=714 residues).
MATKSTQAFESSIDLRQLLTILYRHKLPIGTAIAAGFIVGGLYSMSAQPVYRADALLAVEVQSNQILPQLNAGALPQRGM
NGSSPDAEIDLIKSRSVIGQTVDNLQLDLDIQPAYTPIIGSTLAKFSNAGQPTIKVERFTVPEDFENQTFGLKVESPNSY
ILTTPDGESLEGKVGKPLKFSNNGEFFINQILAETGQSFSITKLSRLKAINNITDNLSVSAQGEGSPLITLGYTGTERKK
IETVLNHIIDNYVSQNKNRDVQMATSGLAFISEELPRLKQSLQDAETKLNQYRTNTGSVDIPSEAQGALRSLTDIETQIT
TLRAEEAGMSELYTPEHPSYKSVRDRLKVLEEARDRINRQISTLPQTEQEVIRLNRDVEINQATYVQLLNRQQELNILKA
SSQGNIRVIDPAVAEEKPFKPRRAMITLLSAIAAGLLASSLFVLRAIARPTIKVSDDIRAMGYNLISTIPASNTQMKADK
RYNRLSAGKSKHPQYLLANIHTNDVAVETIRALRTNLHFATINNKSSMIMIAGTTPGVGKSFVSSNLATVTAQAGSRVLL
VDADLRRGMLHHSFGLTEENGLAEILDGSSTFDASIKHTDVPGLDFISRGHSPQSPSEMLMSDKFKEFIATAKDKYDYVI
IDTPPVLAVTDSSIIGRVADLTLLIARYRKTSHDELEDSMSRLNNAGIKVEGVIFNGVERTARNYYQYQTYTGK
>gnl|bykdb|A0A0P7LT03 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas sp. In5] (length=739 residues).
MQLPSVVGTRDNERDDIDLLGIFGSLIDQKWLIGALTGAFMLTGVAYAILATPVYLANAVVQVEPKKNDMLGFSDLNSML
NGQSPSVTEIGIIKSRAVIGKTVDDLHLDIDVTPNTFPVIGGFLARRYKGDAVAPPRFGLNSYAWGGERLDIAQLNLPEE
LLGKKLTLVAGEQQRFQLFDDNDNLLVNGVVGEAFAQNGIEGRIADLAANPGTRFQVVRSPRIVTILDYQDDLDVSEQGK
ESGIIRLALASPDYAQAVKILNKVASLYVQQNVERTSAEAAQSLDFLQAQLPQVKNDLIKASDALNGYQTRGKTVNISLE
TQSVLEQIVTLDTRISELKLQQAELDRKFTKQHPVYRALMAQIGELTRQQKSLESKVQDLPATQQELLNLTRDVEVASQI
YTQLLNKSQELDIVRAGAVGNARLIDAADVDKTTPVKPRKALIVLIATFLGAFVGVALVLVRKSLSRGLEGPEAIEQLGL
PVYASIPYSALQQEEDSKKLRLSDESRRQAFLLALRNPTDLSIESIRSLRTCLHFAGLDSTNNRIMISGPSPQVGKTFVS
SNLAAVMAQSGQKVVLIDADMRKGHLHKTLNTPISNGLSDLLVKRCSLEQGIHETEVENLHFISRGQVPPNPSELLMHAN
FRELLAQLSELYDVVIIDTPPLLAVTDAAIVGREAAISLIVTRFGVNPAKEIELTIRRFSQNGIQLKGAVFNGVEKRASS
YYGNGGYGNYNYEYASDKA
>gnl|bykdb|A0A0P7PMA7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQSSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQVFTLNVLDDK
NYTLSSDGGFSARGQAGQMLTKEGVTLMVEAIHASPGSEFTITKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A0P7W5P3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Erythrobacteraceae bacterium HL-111] (length=744 residues).
MNSQEQLPPRAPRDALVERQQGALSPYLADEMIDDEDEFDFSIGDILTVLWERKWWILLAALLGLVAALGYSLSKSPLYR
ATATIELNPPSVPVLSNGGDASEGLVVPTTDSQFQETQIGILRSRALAERVVQDLGLVGESNRFDAAETSGAEAAAARDP
QRVAGLAASIAEGLTVSPSPNSRLIELSYVSDDPAEAARLANGFATSFIDLTLDRKYEATTSARRFLEERIRTVREEIND
AERRLVAYAKENGIVLVGSGEGEGGAGSSTLTGESLGTLNSALAAAQQKRITAEQRYRQAAALAAGGGNSATLRQEKAVL
EAEYREKSTYLQDSFPEMARLKTRIEELDRQILTENSRATGTLEAEYRAALAEEQALSERVSQLTGSALTEREDAIQYNI
LQRELDTNRSLYDALLERYNEVGVVEGIGTAQAATVDQAQAPSTPFEPNILRNTILGTLLGLFLGAGLAVLYDRLTDTVK
TKDDLREKLGLPALGAIPLATKNANFLEEVRDQYSVIYDAYASLRTGLQLSGEGGFPQVLLVTSSRPEEGKSSTSYSLGV
QLSDTGRRVLLIDADMRKPSFVVSEDDRIGLSTLLTSDTSLTEHVVKTTSPNLFLLPSGPIPPNPANIILPARLDAILAN
ARSLFDHVIIDAPPVARFADAVLLSSCSDGVLFTLESGKTRTALARAALSQLRMAGANLLGGSLTKASARVIDYGYGRYQ
SYYGGASRGDDTTIAIAAAPDRAT
>gnl|bykdb|A0A0P7WN85 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Erythrobacteraceae bacterium HL-111] (length=752 residues).
MNANPPAAAPGQGIPPTQAEDDFIFGPDARSGQDAGYAARGQETPLMREYLGILERRKWVILAIVALSLVVGLVVTLMMT
PQYTANSRIEISRQQQRVTNVEGLERDDRTFDQEFYDTQYELLAARSVAERVARELRLAANDDFFTAHGFDPGETEWLGR
SDGPVSRETLAERRKVAVGLLLGNVSISPIPRSALVDIGYSSANPALSANVANEWAEQFMAESMDRRFENTADARAFLER
RLAELRQRVEESQTQLVNYANEKGIVVIDRVEQDGRTVASPTLVQLDLRAMNEALLKATEERVLLETRARAAQATNADLV
NNRTVSALRQEKSAKEAEYARLMVQFEPDYPAARALRVQIAELDGAIAREEGRVRSGVQADYRAALEREQDLRQKVDDLL
QRLNSQERDRIQYTIFQNEVDTNRELYDGLLQRYKEIGVAGVAANNISLVDAAQVPATPSSPNLPLNLLVALFGGLALAG
AAVFALEQFEEGIRDPSQVPALTGLPLLGVIPATDTRDDVIEEVQDPKSTISEAYLTVRSNLAFSTSKGIPRTLMVTSTR
PAEGKSTSGLAIASVLARTGKRVLMVDADMRSPSAHALLGLDNTDGFSSVLAGQADPFALIQETAFPNLFLLSAGRTPPS
AAELLSGDAPRAVIERLAERFDHVMVDAPPLLGLADAPLLAQAVDGVVFVIEARGVASRGINTSLDRLRASKAPLIGAIF
TKFSGQGIEGYGYGYGYGYGYGYGHRAEEETA
>gnl|bykdb|A0A0P7X9V2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Marinobacter sp. HL-58] (length=737 residues).
MSESVVPAQKIRNTSNDDEIDIGFLLGSLWDHKYFIGLVAFVFALCGFVYGILATPIYRADSLVQVEQKSSSMAGADLEA
ALGGEPENPTSTQVEILKSRLILRQVVDQTSVDIRVTPKTLPLIGQWLVRSDISRPNLFDTSGYIWGGETLSIASFVTDH
DSEGMELRIRSDGNQRYTVMAPDEDRVIAKGRVGIPLEVEEPWFELRVDELTAPEGAIFKVTKQNRLAATRELQGRLDIA
EQGKDTGMLRLSLDGPDRKEVVSSLNAVNQVFLTQNIARQAAEAEKSLEFLDEQVPQVRQQLTEAEDRLNEFRLKSDSVD
LSFETENALSSLVEVEASLNELELQEAELARRFTEYHPVYRALVEKKEQLQREKARLEDRTDNLPRTQQQVLRLSRDVQV
TQEIYVQLLNRMQELQLAKAGTVGNVRILDEAEIQGQVEPRRGLITGVSLLAGLLLAMVVVLLRAAFNRGIVSSEQLEDL
GLPVYATVPLSEEEKRGMEAKSSGGNKKSRRKHTDLLAFRNPADLSIEAIRGLRTSLHFAMMEGADNRLVITGPSPGIGK
SFISSNLGAICAVGGQRVVVVDADMRKGHLHIDMGQEAKSGLSEVISGKLGFEASVRESKINGLHWVSRGISPPNPSELL
MQPGFTEFLDHLSRRYDLVILDTPPILAVTDAAIIAKQCSTALMVVRFGVNTQKEIEIAQARLATGGVNVKGTILNAVER
RAANSYGYYGYYNYSYK
>gnl|bykdb|A0A0P8ALU7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Roseibaca calidilacus] (length=730 residues).
MDSSDIDLKEIIGILRRQVRLIGLSFIVILVPVIIYLALATPMYRATALISIDAGGSNLLDPRETQNSQSAILNSRVDGE
VEVLRADSTILAVVEKGELVRDPEFGARLGLRERIAIALGLDGAADRLRRAVGLRPSEPRSGEALVKSTISQVRSAVEVR
RRGLTYLISVGVTSADPQRAAELANLYVDTYIERQVVSKTETINDARDVLQRQTENARQNLTRAEEDLNTFIDDNLARLE
AESDDPSVGRIRRELESAQASRSTNVALLQATEDAAERSDWITVAATLEDSALDQLAREREQLLDRLSGETAGSQAEIDL
RSALASVEQNLNETFAEAQGSVESRLDTISQNEQAAREQLRDALLRTDVSSEVVADLFNLQQNATIAREQYQRLLSRVQD
LSALANVQVSDARVVSEALPPTSAASPNKRLFISAALVLAIGVGVGIALLNEYYIGGITSLAQLKNLSVARAIGTIPDSV
SEGDAQLLGNQIIDAPLSQYSESMRKLRLAIDTNLAQGRAERTQESEGKQRGIVILVASALPGEGKTTSAIALARTYAAS
GKRTLLIDADLRRPSIGNYLNVTPEYGLIDYLDPDTSHKQLKPYVDTVENLIFVPAGHRSTKPTDQLINSDLFLKMIATV
REEFDIIILDSPPVLPVVDSRYLAQIADIVVMIVRFANTTQTEFRDAATQLSEVIQPGVRLLAALNRNASPSRRSYYGSG
YAGYYGDEKA
>gnl|bykdb|A0A0P8KHX8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Citrobacter freundii] (length=720 residues).
MTEKVKQSAAPVTGNDEIDIGRLVATVVEARWWVLGITAAFALCAAVYTLFATPIYSADALVQIEQNTGNSLVQDIGSAL
SNKPPASEAEIQLIQSRLVLGKTVDDLNLDIGVTKDTFPIFGAGWDRLMGRQNETVNVTTFTLPKAMNEQTFTLNVLNDK
SYQLVSDGGFSVRGQVGKVLEHDGVTMLVEAIHASPESQFTVSKFSTLGMINTLQNNLMVTETGKDTGVLSLTFTGEDRE
KIRQILDSITRNYLQQNVERKSEEAAKSLAFLARQLPEVRNHLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLFTKAHPAYRTLLEKRQALEDEKSKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITE
ASTVGDVRIVDPAIAQPGVLKPKTALIILGSIILGLMLSVVGVLLRSLFNRGIESPQALEEHGISVYASIPLSEWQKARD
NVQTIKGVKRYKQSQLLAVGNPTDLAIEAVRSLRTSLHFAMMQARNNVLMLTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGKGDISSSAKPTSIPHFDLIPRGQIPPNPSELLMSERFGELIAWASSHYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLGRFEQNGIQVKGVILNSIFRRASGYQDYGYYEYEYTSDSK
>gnl|bykdb|A0A0P8LAD7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Enterobacter kobei] (length=720 residues).
MTEKTRPSAAPTSGSDEIDIGRLVGTVIEAKWWVLGITAVFAAAAVVYTLFATPIYSADALVQIEQNTGNSLVQDIGSAL
ANKPPASDAEIQLIQSRLVLGKTVHDLGLDISVTKNTFPIFGAGWDRLMGRSNDTVKVTDFVLPKGAGDQTFTLTVLGPK
QYQLTSDAGFSARGEVGQMLTKDGVSMMVSAIHAQEGGEFTVTKFSTLGMINNLQNNLTVTENGKDTGVLSMTFTGEDKD
QIRDILNSITRNYLEQNVERKSAEAAKSLAFLAKQLPEVRARLDDAENKLNAYRQDKDSVDLPLEAKSVLDSMVNIDAQL
NELTFKEAEISKLYTKRHPAYRTLLEKRRTLEEEKAKLNDRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITE
ASTVGDVRIVDPAITQPGVLKPKKALIVLGSIILGLMLSIVGVLLRSLFNRGIESPQALEESGINVYASIPLSEWQKSRD
SVKTIKGVKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAKNNVLMLTGVSPSIGKTFVCANLAAVVSQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILLGQGEISQSAKPTSIPRFDLIPRGQIPPNPSELLMSERFTQLIEWASKHYDLVL
IDTPPILAVTDAAVVGRHAGTTLMVARYAVNTLKEVETSLSRFEQNGIEVKGVILNSIFRRATGYQDYGYYEYEYKSDSK
>gnl|bykdb|A0A0P8WJR6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas fluorescens] (length=741 residues).
MQQTPALTSHDDDEIDLMGLLGTLVDHKWLIAGITAASMVVGTAYAVLATPVYQATALIQVEAKKNDMLGFSDINNMLGK
ESPSATEIELIKSRAIIGKVVDNLSLDITVEPNRFPVIGDFIARRFKPDAVNTVATPWFGMNSFAWGGETLKIFQLKLPQ
ELLSKTLTLVTGENDHFTLLDEDDNVLVQSQVGQAYDQDGIQLQVEVLQANPGTTFSIVRDPRLTSILKYQKVLDVSERG
KESGMIGLALESEKPAEAIQILNEIAKLYVRQNVERTSAEAAQSLEFLKDQLPQVRKDLEKAETALNKYQIRSKSIDISL
EAKAILDQIVALDTSISELKLQQAEMDRKFTRQHPAYRALLSQLAELTAKQDGLAKKVEGLPSTQQELLSLTRDVKVSTE
IYTQLLNKSQELDVMRAGTVGNVRLIDTADVDLRKPVKPKKALIVLIATLFGAFLATALVLFRKALNRGVENPDQIEQLG
LPVYASIPFSSLQKSEESKILRGSRGRANKATPILASSHPTDLAIEGLRSLRTSLHFAMLEASNNRLMVSGPSPKVGKTF
VSANLAAVIAQTGQRVLLIDVDMRKGYLHKVFGTPAENGLSDLLVKRCDLATAINKTEFEHLDVIGRGQIPPNPSELLMH
ANFSAFLDQVSAQYDLVILDTPPLLAVTDAAIVGRQSGTSLIVTRFALNPVREIELTMRRFAQNGIDLKGAIFNGVEKRA
SAKYGYGDYGYYNYEYKSESV
>gnl|bykdb|A0A0P9AB72 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Variovorax paradoxus] (length=752 residues).
MNSFASAQAPSGPAVAPSREDDENIINLSEYLDILIDRKWLVMAITTIAVALGVAYTLLATPVYQSNLLVQVEDSAPDAK
NFLGDTANLFDVKTPATGEIQIIRSRMIMGGAVDATRLYIDARPRYIPIVGEWLARRAKGLSEPGFLGMGGYVSGTEAIS
ISKFDVPSSLEDQKPFTITVQSGDQYVLTHPDLDEPLTGTVGKLLSQQVQGGAVVLVVSRLNGKPGAQFTVSRASVLVTT
EELQRRVQLSEQGKQSNVISATLEDSDRDRLRRILDEIGVQYVRQNVERKAAEAEKTLEFLDKQLPNFKKQLESSEDVYA
DFRNKNGTIAFDEEAKAVLGQAVQLQTKLLESEQVRRELLSRFTESNPKVRVVDGQIVAFRHELDSIERRVSAMPVLQRD
ALRLERDVRVNGELYKSLLNSSLQLRLVKEGKVGNVRLLDKATEPKRPVKPQKPLIVGLSLVLGLLSGVALAIIRSKMAS
GIHNPQEIEDRLGLSVYSVVPQAVEQDALLQLIATGAGGAQVLAVTAPESLAIESLRNLRISLQLAMLESGSNRVLVTGA
TPGVGKSFVSSNYAVIMAQAGKRVLLIDADLRKGHINKSFGLPRQGGLADILAGDIAFEKAIHDQVLPNLDVLTTGNYPF
NPANMMLSSALGDILDVASQRYDLVVLDSPPVLVAADAAAVSAHVGAILLVARDGLTQIGELGESVKRLAHANQRVSGVV
FNGMDLSRRHYGSYGYKYGGYRYTEYKYKQAD
>gnl|bykdb|A0A0P9HTY3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. alisalensis] (length=738 residues).
MTVMNHPSLDYYQDSRIDLATVLRLLFDHKALILCTVSLFFLLGLAYAVLATPVYQANAMIQIEAKKIGIEGIPEVNNKP
LSVSQATIEIELIKSRTLLGEVVDTLQLNVLQTPELFPVIGPYLYRTFSPERTGELAQPWFGLTQYAWGGEKIEVFQLDV
PEYLLGEPLTLIAGKPGQFSLYDEERNLLLSGATNRVVEGKGIKIRIAALQARPGTEFIVSRQRTLSSALAYQERLKIME
AGRDSGIIYLSIEDQDAQKANRIIDEISRLYVRQNVERSSAEAAQRLQFLRSQLPMVRKQLEESEVALNNFQTSAKSADL
SIETKGVLDQVVGLDSMLSELKLKRVELERLYTREHPTYRSLMSQMNQLEEQKKALLKKIEALPMTQQELLRLTRDMQVT
SQTYSLMLNKSQEQDILRAGSIGNVRVIDHANANTEKPVKPMKKLIVLIATLIGALIAVMIIFVRQAFYRGVESAEVIEG
LGMPVYASLPYSRQQDRLEKNSKSAPGRPATRLLSAAVPDDLAIESLRSLRTSLHFAMLEARNNILMISSPTPGAGKSFV
SSNLAVIIAQTGKRVLLIDADMRRGYLHRIFGLQPKHGLSDTLAARRRCADVITPTRIRHLDLISCGFAAPNPSELLMHD
NFHKMLAELAPLYDLILVDTPPILAVTDATLVGRQAGTCLMVARFGMTTVKEIEACKRRLGQNGILIKGAIFNAVVRKAA
TSAYDSAAYGYDYKSAPR
>gnl|bykdb|A0A0P9JUS7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. berberidis] (length=753 residues).
MTVMSRPNLDYYQDARIDLATVLRILFDQKALILWTVGLFFLIGLAYAVLSTPVYQANAMIQIEPRKIGIEGTPEVSGKP
LSVSQATTEIELIKSRALLGKVVDDLQLNVLQKPDLFPVIGPYLYRTFAPPQDGALAEPLWGLSHYAWGGEKIEVFQLEV
PEHLLGEKLTLTAGKPDQFALYDSDHNRLLGGAVNRVIEGNGVKIQIAALLARPGTDFTVSRQRTLGTALVYQNRLKIAE
AGRDSGIIYLSIEDQDAQRANRILDQISRLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESEAALNAFQTSSRSVDL
SIETKGLLDQVVHLDSMLSELKLKRVELERLYTREHPTYRSLMSQINQLEQQKQGLLKKIETLPMTQQELLRLTRDMQVT
SQTYTLMLNKSQEQDILRAGNIGNVRVIDNADSNIEKPVKPMKTLIVLIATLLGALAATVIIFVRQAFYRGVESAEVIEN
LGMPVYASLPYSRQQERLEKRGKNTQGKNMPGEERHGKDRQSVQVSRLLSIAAPSELAIESLRSLRTSLHFAMLEARNNV
LMISSPTPGAGKSFVSSNLAAIIAQTGKRVLLIDADMRKGYLHRLFGLQPKHGLSDTLAARLRCTEVINPTRIRHLDFIS
CGFAAPNPSELLMHDNFHKMLAELSPLYDLILVDTPPILAVTDATLVGRQAGTCLLVARFGMTTVKEIEACKRRLGQNGI
LIKGAIFNAVVRKATTSDYDCAAYGYNYHPAPR
>gnl|bykdb|A0A0P9KXD8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. antirrhini] (length=753 residues).
MTVMSRPTLDYYQDARIDLATVLRILFDQKALVLWTVGLFFLIGLAYAVLSTPVYQANAMIQIEPRKIGIEGTPEVSGKP
LSVSQATTEIELIKSRALLGKVVDDLQLNVLQKPDLFPVIGPYLYRTFAPPQDGALAEPLWGLSHYAWGGEKIEVFQLEV
PEHLLGEKLTLTAGKPGQFALYDSDHNRLLGGAVNRVIEGNGVKIQIAALLARPGTDFTVSRQRTLGTALIYQNRLKIAE
AGRDSGIIYLSIEDQDAQRANRILDQISRLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESEAALNAFQTSARSVDL
SIETKGLLDQVVHLDSMLSELKLKRVELERLYTREHPTYRSLMSQINQLEQQKQGLLKKIETLPMTQQELLRLTRDMQVT
SQTYTLMLNKSQEQDILRAGNIGNVRVIDNADSNIEKPVKPMKTLIVLIATLLGALAATVIIFVRQAFYRGVESAEVIEN
LGMPVYASLPYSRQQERLEKRGKNTRGKNMPGEERHGKDSQSVQVSRLLSIAAPSELAIESLRSLRTSLHFAMLEARNNV
LMISSPTPGAGKSFVSSNLAAIIAQTGKRVLLIDADMRKGYLHRLFGLQPKHGLSDTLAARLRCTEVINPTRIRHLDFIS
CGFAAPNPSELLMHDNFHKMLAELSPLYDLILVDTPPILAVTDATLVGRQAGTCLLVARFGMTTVKEIEACKRRLGQNGI
LIKGAIFNAVVRKATTSDYDCAAYGYNYHPAPR
>gnl|bykdb|A0A0P9LU78 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas cannabina] (length=738 residues).
MTVINHPSLDYYQDSRIDLATVLRLLFDHKALILCTVSLFFLLGLAYAVLATPVYQANAMIQIEAKKIGIEGIPEVNNKP
LSVSQATIEIELIKSRTLLGEVVDTLQLNVLQTPELFPVIGPYLYRTFSPERTGELAQPWFGLTQYAWGGEKIEVFQLDV
PEYLLGEPLTLIAGKPGQFSLYDEERNLLLSGATNRVVEGKGIKIRIAALQARPGTEFIVSRQRTLSSALAYQERLKIME
AGRDSGIIYLSIEDQDAQKANRIIDEVSRLYVRQNVERSSAEAAQRLQFLRSQLPMVRKQLEESEVALNNFQTSAKSVDL
SIETKGVLDQVVGLDSMLSELKLKRVELERLYTREHPTYRSLMSQMNQLEEQKKALLKKIEALPMTQQELLRLTRDMQVT
SQTYSLMLNKSQEQDILRAGSIGNVRVIDHANANTEKPVKPMKKLIVLIATLIGALIAVMIIFVRQAFYRGVESAEVIEG
LGMPVYASLPYSRQQDRLEKNSKSAPARPGIRLLSAAVPDDLAIESLRSLRTSLHFAMLEARNNILMISSPTPGAGKSFV
SSNLAVIIAQTGKRVLLIDADMRRGYLHRIFGLQPKHGLSDTLAARRRCADVITPTRIRLLDLISCGFAAPNPSELLMHD
NFHKMLAELAPLCDLILVDTPPILAVTDATLVGRQAGTCLVVARFGMTTVKEIEACKRRLGQNGILIKGAIFNAVVRKAA
TSAYDSAAYGYDYHSAPR
>gnl|bykdb|A0A0P9PV70 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. delphinii] (length=748 residues).
MTVMSRPTLDYYQDARIDLATVLRILFDQKALILWTVGLFFLIGLAYAVLSTPVYQANAMIQIEPRKIGIEGTPEVSGKP
LSVSQATTEIELIKSRALLGKVVDDLQLNVLQKPNLFPVIGPYLYRTFTPRQDGALAEPLWGLSHYAWGGEKIEVFQLEV
PEHLLGEKLTLTAGKPGQFALYDSDHNRLLGGAVNRVIEGNGVKIQIAALLARPGTDFTVSRQRTLGTALVYQNRLKIAE
AGRDSGIIYLSIEDQDAQRANRILDQISRLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESEAALNAFQTSARSVDL
SIETKGLLDQVVHLDSMLSELKLKRVELERLYTREHPTYRSLMSQINQLEQQKQGLLKKIETLPMTQQELLRLTRDMQVT
SQTYTLMLNKSQEQDILRAGNIGNVRVIDNADSNIEKPVKPMKTLIVLIATLLGALAATVIIFVRQAFYRGVESAEVIEN
LGMPVYASLPYSRQQERLEKRGKNMPGEERHGKDNQAAQVSRLLSIAAPSELAIESLRSLRTSLHFAMLEARNNVLMISS
PTPGAGKSFVSSNLAAIIAQTGKRVLLIDADMRKGYLHRLFGLQPKHGLSDTLAARLRCTEVINQTRIRHLDFISCGFAA
PNPSELLMHDNFHKMLAELSPLYDLILVDTPPILAVTDATLVGRQAGTCLLVARFGMTTVKEIEACKRRLGQNGILIKGA
IFNAVVRKATTSDYDCAAYGYNYHPAPR
>gnl|bykdb|A0A0P9T5N3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. maculicola] (length=753 residues).
MTVMSRPTLDYYQDARIDLATVLRILFDQKALILRTVGLFFLIGLAYAVLSTPVYQANAMIQIEPRKIGIEGTPEVSGKP
LSVSQATTEIELIKSRALLGKVVDDLQLNVLQKPDLFPVIGPYLYRTFAPPQDGALAEPLWGLSHYAWGGEKIEVFQLEV
PEHLLGEKLTLTAGKPGQFALYDSDHNRLLGGAVNRVIEGNGVKIQIAALLARPGTDFTVSRQRTLGTALIYQNRLKIAE
AGRDSGIIYLSIEDQDAQRANRILDQISRLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESEAALNAFQTSSRSVDL
SIETKGLLDQVVHLDSMLSELKLKRVELERLYTREHPTYRSLMSQINQLEQQKQGLLKKIETLPMTQQELLRLTRDMQVT
SQTYTLMLNKSQEQDILRAGNIGNVRVIDNADSNIEKPVKPMKTLIVLIATLLGALAATVIIFVRQAFYRGVESAEVIEN
LGMPVYASLPYSRQQERLEKRGKNTQGKNMPGEERHGKDSQSVQVSRLLSIAAPSELAIESLRSLRTSLHFAMLEARNNV
LMISSPTPGAGKSFVSSNLAAIIAQTGKRVLLIDADMRKGYLHRLFGLQPKHGLSDTLAARLRCTEVINPTRIRHLDFIS
CGFAAPNPSELLMHDNFHKMLAELSPLYDLILVDTPPILAVTDATLVGRQAGTCLLVARFGMTTVKEIEACKRRLGQNGI
LIKGAIFNAVVRKATTSDYDCAAYGYNYHPAPR
>gnl|bykdb|A0A0P9WJB4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas amygdali pv. mori] (length=728 residues).
MTVMNRPSLDFHQDSRIDLAAVLRMLFDHKALILWTVSLFFLIGLGYAILATPVYQAXXXXXXXXXXXXXXXXXXXXXXT
TEIELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLFGLTQYAWGGEKIEVFQLEVPEHLLGE
KLTLIAGKPGQFSLYDNEHNLLLGGTINRIVEGNGVKIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGI
IYLSIEDQDAQRANQILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTSARSVDLSIETKGV
LDQVVSLDSMLSELKLRRVELERLYTREHPTYRSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTYTLM
LNKSQEQDILRAGSIGNVRVIDNADTNVEKPVKPMKTLIVLIATLIGALVAMTIVFVRQAFYRGIESAEVIESLGMPVYA
SLPHSRQQERLEKRDQDSKDSRLLSIAAPGELAIESLRSLRTSLHFAMLEARNNVLMISSPTPGAGKSFVSSNLATIIAQ
TGRRVLLIDADMRKGYLHRLFGLQPKHGLSDTLAARLRCTEVIHQTRVRHLDFMSCGFAAPNPSELLMHDNFNKMLAELS
PLYDLILIDTPPILAVTDATLVGRQAGTCLLVARFGMTTAQEIEACKRRLGQNGILIKGAIFNAVVRKATTSDYDYAAYG
YNYHPAPR
>gnl|bykdb|A0A0P9YGJ3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. ribicola] (length=738 residues).
MTVMNRPSLDYYQDTRIDLATILRMLFDHKALIIWTVSLFFLAGLAYAILATPVFQASAMIQIEPKKVGIEGTPEVNNKP
SSVSQATTEIELIKSRALLGKVVDDLKLNLVQTPDFFPVIGPYLYRTFKPEYDGALAEPLFGLTQYAWGGEKIDVFQLEV
PEALLGEKLTLVAGNPGQFSLYDSDHNLLLSGAINRIVEGNGVKIQVAALHAHPGTEFTISRQRTLTSALIYQNRLKITE
AGKDSGIIYLSIEDQDADKANKILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPMVRKQLEESEVALNNFQTSAKSVDL
SIETKGVLDQVVKLDSMLSELKLKRVEIERLYTQEHPTYRSLMSQMSQLEQQKQGLLKKIEALPMTQQELLRLTRDMQVT
SQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTNVERPVKPMKTLVVLLATLVGALVAVTIIFVRQAFYRGVESAEVIEN
SGMPVYASLPYSRQQDRLEKTTKGGGAPKESKLLSIAAPNELAIESLRSLRTSLHFAMLEARNNVLMISSPSPGAGKSFV
SSNLAAIIAQTGKRVLLIDADMRKGYLHRIFGLQPKHGLSDTLAARLKCTEVINHTQIRHLDFISCGFAAPNPSELLMHD
NFNKMLTELSPLYDLILVDTPPILAVTDATLVGRQAGTCLLVARFGITTLKEIEACKRRLGQNGILIKGAIFNAVVRKAT
TSDYDCAAYGYNYHPVNK
>gnl|bykdb|A0A0P9YL31 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. primulae] (length=738 residues).
MTVMNRPSLDYYQDTRIDLATILRMLFDHKALIIWTVSLFFLAGLAYAILATPVFQASAMIQIEPKKVGIEGTPEVNNKP
SSVSQATTEIELIKSRALLGKVVDDLKLNLVQTPDFFPVIGPYLYRTFKPEYEGALAEPLFGLTQYAWGGEKIDVFQLEV
PEALLGEKLTLVAGTPGQFSLYDSDHNLLLSGAINRIVEGNGVKIQVAALHAHPGTEFTISRQRTLTSALIYQNRLKITE
AGKDSGIIYLSIEDQDADKANKILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPMVRKQLEESEVALNNFQTSAKSVDL
SIETKGVLDQVVKLDSMLSELKLKRVEIERLYTQEHPTYRSLMSQMSQLEQQKQGLLKKIEALPMTQQELLRLTRDMQVT
SQTYTLMLNKSQEQDILRAGSIGNVRVIDNADTNVERPVKPMKTLVVLLATLVGALVAVTIIFVRQAFYRGVESAEVIEN
SGMPVYASLPYSRQQDRLEKTTKGGGAPKESKLLSIAAPNELAIESLRSLRTSLHFAMLEARNNVLMISSPSPGAGKSFV
SSNLAAIIAQTGKRVLLIDADMRKGYLHRIFGLQPKHGLSDTLAARLKCTEVINHTQIRHLDFISCGFAAPNPSELLMHD
NFNKMLTELSPLYDLILVDTPPILAVTDATLVGRQAGTCLLVARFGITTLKEIEACKRRLGQNGILIKGAIFNAVVRKAT
TSDYDCAAYGYNYHPVNK
>gnl|bykdb|A0A0Q0BAT8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. tomato] (length=753 residues).
MTVMSRPTLDYYQDARIDLATVLRILFDQKALILWTVGLFFLIGLAYAVLSTPVYQANAMIQIEPRKIGIEGTPEVSGKP
LSVSQATTEIELIKSRALLGKVVDDLQLNVLQKPDLFPVIGPYLYRTFAPPQDGALAEPLWGLSHYAWGGEKIEVFQLEV
PEHLLGEKLTLTAGKPGQFALYDSDHNRLLGGAVNRVIEGNGVKIQIAALLARPGTDFTVSRQRTLGTALVYQNRLKIAE
AGRDSGIIYLSIEDQDAQRANRILDQISRLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESEAALNAFQTSARSVDL
SIETKGLLDQVVHLDSMLSELKLKRVELERLYTREHPTYRSLMSQINQLEQQKQGLLKKIETLPMTQQELLRLTRDMQVT
SQTYTLMLNKSQEQDILRAGNIGNVRVIDNADSNIEKPVKPMKTLIVLIATLLGALAATVIIFVRQAFYRGVESAEVIEN
LGMPVYASLPYSRQQERLEKRGKNTQGKNMPGEERHGKDSQSVQVSRLLSIAAPSELAIESLRSLRTSLHFAMLEARNNV
LMISSPTPGAGKSFVSSNLAAIIAQTGKRVLLIDADMRKGYLHRLFGLQPKHGLSDTLAARLRCTEVINPTRIRHLDFIS
CGFAAPNPSELLMHDNFHKMLAELSPLYDLILVDTPPILAVTDATLVGRQAGTCLLVARFGMTTVKEIEACKRRLGQNGI
LIKGAIFNAVVRKATTSDYDCAAYGYNYHPAPR
>gnl|bykdb|A0A0Q0CU07 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. viburni] (length=748 residues).
MTVMSRPTLDYYQDARIDLATVLRILFDQKALILWTVGLFFLIGLAYAVLSTPVYQANAMIQIEPRKIGIEGTPEVSGKP
LSVSQATTEIELIKSRALLGKVVDDLQLNVLQKPDLFPVIGPYLYRTFTPRQDGALAEPLWGLSHYAWGGEKIEVFQLEV
PEHLLGEKLTLTAGKPGQFALYDSDHNRLLGGAVNRVIEGNGVKIQIAALLARPGTDFTVSRQRTLGTALVYQNRLKIAE
AGRDSGIIYLSIEDQDAQRANRILDQISRLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESEAALNAFQTSARSVDL
SIETKGLLDQVVHLDSMLSELKLKRVELERLYTREHPTYRSLMSQINQLEQQKQGLLKKIETLPMTQQELLRLTRDMQVT
SQTYTLMLNKSQEQDILRAGNIGNVRVIDNADSNIEKPVKPMKTLIVLIATLLGALAATVIIFVRQAFYRGVESAEVIEN
LGMPVYASLPYSRQQERLEKRGKNMPGEERHGKDNQAAQVSRLLSIAAPSELAIESLRSLRTSLHFAMLEARNNVLMISS
PTPGAGKSFVSSNLAAIIAQTGKRVLLIDADMRKGYLHRLFGLQPKHGLSDTLAARLRCTEVINQTRIRHLDFISCGFAA
PNPSELLMHDNFHKMLAELSPLYDLILVDTPPVLAVTDATLVGRQAGTCLLVARFGMTTVKEIEACKRRLGQNGILIKGA
IFNAVVRKATTSDYDCAAYGYNYHPAPR
>gnl|bykdb|A0A0Q0DLE8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas syringae pv. theae] (length=748 residues).
MTVMSRPTLDYYQDARIDLATVLRILFDQKALILWTVGLFFLIGLAYAVLSTPVYQANAMIQIEPRKIGIEGTPEVSGKP
LSVSQATTEIELIKSRALLGKVVDDLQLNVLQKPDLFPVIGPYLYRTFAPGQDGALAEPLWGLSHYAWGGEKIEVFQLEV
PEHLLGEKLTLTAGKPGQFVLYDSDHNRLLGGAVNRVIEGNGVKIQIAALLARPGTDFTVSRQRTLGTALIYQNRLKIAE
AGRDSGIIYLSIEDQDAQRANRILDQISRLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEESEAALNAFQTSARSVDL
SIETKGLLDQVVHLDSMLSELKLKRVELERLYTREHPTYRSLMSQINQLEQQKQGLLKKIETLPMTQQELLRLTRDMQVT
SQTYTLMLNKSQEQDILRAGNIGNVRVIDNADSNIEKPVKPMKTLIVLIATLLGALTAMVITFVRQAFYRGVESAEVIEN
LGMPVYASLPYSRQQERLEKRGKSTPGEERHGKDNQAAQVSRLLSITAPSELAIESLRSLRTSLHFAMLEARNNVLMISS
PTPGAGKSFVSSNLAAIIAQTGKRVLLIDADMRKGYLHRLFGLQPKHGLSDTLAARLRCTEVINQTRIRHLDFISCGFAA
PNPSELLMHDNFHKMLAELSPLYDLILVDTPPILAVTDATLVGRQAGTCLLVARFGMTTVKEIEACKRRLGQNGILIKGA
IFNAVVRKATTSDYDCAAYGYNYHPAPR
>gnl|bykdb|A0A0Q0GG97 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudoalteromonas sp. P1-25] (length=735 residues).
MNYQDEKELTHGPSVDFLYYLNVFLSVKWRILGFAVVVTLLSIMVTLTIVPKYIATATLLIESEQAQAISFDEVYGLSSA
KEEYYLTQFEVIKSDSIAREVIQKLNLQSHKDFTQKPSLVDEIKNSVKSSIPFLNVKDKTTFSEKEVADRKMLGLLSTFK
SKLWVTPIRKTQLVRISFESSDPKLAALVANTVSEVYIESQMRAKMGVTQEASNWLNSRLSKLRSQLDDSELRLQNFRED
QQLVDIEGIAGLATQELEQISQQLVEARNEKNNLESINRVISEYGNNNLELLGSMPEITSHQVVQNVKREVVIVERKLSD
LSEVYGPKHPKIISAKAELATVKNNLNKQIKGLVTGIEKELNRITRTVSALERDLVKIRAEYQDITRKETKYNQLKREVE
TNRNIFNTFLSRSKETEVTSDFSSAAARFTDRAYAPKDPAKPNKKLIVVLAFVASLGFAVVMSFIFDALNDTVKTKNDVE
GKLAQRMLGLLPNVPMPKKSVFPIHAYLDDNYRRFAESVRTFRTSLLLTQLDRDHKVIAVTSSSPGEGKTTTSANLAMSL
AQMGKVLLIDADLRKPSIAKRFDIPVFHPGLSNLIIGTEQFSECVHVDGQSGVAIMPSGQIPGNPLELLSSSRFNEVLDV
LKTKYDHIIIDTPPTQAVSDALVISQSADSVIYVVKSDVTRIKPIKAGIERLFESKAHVAGIVLNKVDMSKNKDEHSHGY
YDYYDYSQKPEQPTS
>gnl|bykdb|A0A0Q0GIF4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudoalteromonas sp. P1-25] (length=738 residues).
MTAQPSNKSKNTTQPTQEIDLMALLGALLDRKYFIVGITALFMFVGVVYAVLSTPIYQATAMIQVENGSASVPGFDDVGG
VFESTSAAVTEIELLKSRSIIGEAVDTLKLDITAEPKLFPFIGNRIYRNFTPMSEGDLAEPSFGAGSYAWGGESINIFRF
DVPRSAINKEFTLVAQNNNSVSLLNDDGEEILAGKVGEELTNGKFNLTVRELNAHAGTEFIITRKDRLNTILNLQKEISA
EEEVKSSGIIKLSLENKDPTFAEKVLDKVAAIYVRRNVERNSAEAQKSLEFLEVQLPEIKKQLEYAEQRFNNYQIKQQSI
NISLETQGVLEQVVKLETKLQELNLKRLELGRKFKKNHPTYQGMLEQIEAVNKQKKELVSKVGNLPETQQELLRLKRDVE
VSNQIYTLLLRKTQELDIVRAGTVGNVRVIDHAEVNTSKPVKPKKTLIVIVITFLGGLFSVIVVLIQKAINRGVEDPAEI
ESLGIPVYASVPHSDHQDKLTGFAKTRKNKAAKAKTILALDNPADLSIEALRSLRTSLHFAMMEAKNNIIAISGPSPGVG
KSFISVNLASVLAQSGKKVLIIDADMRKGYLQTQFDLMWDDGLSDYLSGRLNLAQVTKTTKVEGLNVITRGQIPPNPSEL
LMHSNFSKLVEEVSAAYDIVIIDTPPILAVTDPAIVSAHTGTTLLVARFGQNHLREIELTRNRFEQNGIDIKGLVFNGVV
KKASNAYGYYGYYNYEYK
>gnl|bykdb|A0A0Q0NSN1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudoalteromonas sp. P1-26] (length=746 residues).
MNAQPTALAANKNQNRSQESQSQEIDLLALLGALLDRKWFIVIVTAVFAIIGVAVAVLSTPIYKATALVQVEESSPSVPG
LDDMAGMFESSSEAVTEIELLKSRSVIGEAVDTLKLNIIAEPKLFPIIGGKVYRSFVAESEGDIAEPFLGLSSYAWGGET
INVFRFNVPKAFEGEAFELVIGENKSYELFNPEGDSVLKGVVGKEQAAGYYELTIRDLNARPGTEFTLVKNNRYRTIIEL
QEEIGASEKGKDSGIIAMGFEHKDAVHAAKVLDKVADIYVRRNVERNSAEAKKSLDFLEVQLPEVKRQLEQSEQRFNDYQ
KQRNSVNISLETQGVLEQIVELETTLQELELKRLELSRKFKREHPAYQGVLKQIESVKSEKDELTSKVGNLPETQQELLR
LTRDVEVGNEIYMLLLSKTQELDIVRAGTVGNVRVVDAAAVDTTEPVKPKKALVAVVATLLGGFLAVAIVLIQKAMHRGV
EDPTEIESIGLPVYASVPYSDFQDKLTGFNRARKVKDKPKSILAVDNPADLSIEALRSLRTSLHFAMMEAKNNIIAISGP
SPGVGKSFISVNLATVLAQSGKKVLIIDADMRKGYLQTQFGMKWDDGLSDLLSGRLNLEQVTKKSQVEGLDVITRGQIPP
NPSELLMHSNFSKMVEEVSGKYDIVIVDTPPILAVTDPAIVSAHAGSTLLVTRFGQNHLREIELTRNRFEQNGIDVKGVV
FNGVVRKASNAYGYYGYYNYEYKSDK
>gnl|bykdb|A0A0Q0PCA3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Shewanella sp. P1-14-1] (length=738 residues).
MIQNDNQATSFLQQPMDQIVDFKKMFKPLFRYKWRILTFSVLVSVLVSFFLLSMTPIFSATSTLLIESEQAKAIKIDEVY
GINSGQQEYYLTQFEIIKSRTIAERVFNDLDLINHPTFNQPPSLLSQLKSNLKFVPKEQAGEFNVDENAVKQRLIEGFSK
NISVSPVRNTQLVKISYESPDANLAALVSNAIGDTYILSQLEAKSGMTHKANVWLGGRLEELRLKLDESENRLEEFKINN
GLIDVEGVTALDAKELESLRDEITLARSRKAQADSFMSVVQRYGATDISRLESLPEVTSHQSIQNVKREVVLVERKVSEL
EQVYGPKHPKMIAAYAELATVEKNLHRQITRLVQGIEDEAKTAAQKLQDLQAQFNDSKGSYQNLSSIDTDYRRLVREIDT
NQQLFESFLARQKETEVTGDFDSPIARFTDRAVVPLLPVKPKKKVLVLLTFFASLVFGGVVVLLLEALNDTVKSNEDVEK
LLAQRALGYIPKANKKASFEDINFAFYDKNLPLHSEAVRTIRTSISLMSIGSDLNTIEVTSSVPNEGKTNVSMNLAFAYS
TMEKVLLIDADLRKSSLGVRFGLPTYQPGLANLLAKTDTVENCIISDIKPNVDIMPAGAIPLNPQELLSSETFADLLAEL
KKSYTKIIIDTPPVHAVSDALVISSKCDAVVVVVKSANTRIDAIKMTLAKINQARGKVVGVVLNQFNTKEAKHYNGDYGY
YQAYGQDYAIKQDNEKAS
>gnl|bykdb|A0A0Q0XN84 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas endophytica] (length=742 residues).
MQQAPVTKPHEREDDNDEIDLMGLLGTLIDHKWLIAGVTGVFMAAGVAYALLATPVYQANALIQVEPKKNDPLGFSDVSS
LLGKESPSATEIELIKSRKNIGATIDNLQLDIEVEPNYFPIIGSFIARRFKADAENKIADPMLGMSSYAWGGEKIKIATL
ELPRDQLGKNLTLISGKDGSFTLVDEDDNLVTAGKVGEAIENSEIKILVEELVANPGTTFSVVRYPRLTSILTYQRNLDV
IERGKESGMIALALESTEPEKAIQILDEIARLYVMQNIDRTSAEAAQSLGFLRDQLPQVRRDLEKSEDALNAFQIRSKSI
DISLEAKAILDQIVALDTSISTLKLQQAEMDRKFTPQHPAYRALMGQLAELTNKQKRLANQVQGLPTTQQELLSLTRDVK
VSTEIYTQLLNKSQELDVMRAGAIGNVRLIDSADVDLRAPIKPKKTLIVLIATILGAFIATASVLFRKALNRGVENPDDI
ENLGLPVYATIPFSSLQKAEDDKSPKGRGTRVTPLLASSHPTDLAVESLRSLRTSLHFAMLEAENNRLMISGPSPRVGKS
FVSANLAAVVAQSGQRVLLVDVDMRKGYIHKMFGIPADNGLSDILAKRCTLETATHKADIDNLYVIGRGQIPPNPSELLM
HKNFTDFLEYVSENYDLVILDTPPFLAVTDASIVGRQSGTNLIVTRFELNSAREIELTMRRFAQSGIHLKGAIFNGIERR
ASAKYGYGAYGYYNYEYKSDNA
>gnl|bykdb|A0A0Q1AVE5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Desulfuromonas sp. SDB] (length=843 residues).
MPEDNQQQSNEFNLMKNSIIRAAIRYRWLIFAIFFITTLGAMVSSSRLVDIYSATATLRFQSETGQATRSLGIWNQMMYY
NYRWDMDPIADQIALIRSRSVAEGVVRRLNAYYYLVNKSFKNSHSVNLDVLWLNENHRYSNYWFKFQKDSTFEVFAEETI
YIASGKIGDTLNFNFASVYLTLNYPDTGTVIFGFIPIEKAAEGMRGRLSVSGIEQTNILAITVSDPNPHRAREVVNAFAR
EIVSFDVQRSRGAARSVREFIEQQLLITNTSLEEAERNLRSIQEKYGWLTASREEMRVEQQLADLVGQRVAAMITVKELE
QKLWSLKSELQGQGAFNIYSDAQTIPELSSNPALNAIQEQINKYEIEKAELLGSYTENHPRIRQIDSIVQFLKGELVTSI
QDNLSQYGSGPIDQVWSNLASQYIMTEVELASARALLGALEAAIEDIRTELDSLPEEIAMFERAYRQVEVEKQTYTTLLV
KLQEAKISEATQVGNVSLVDTALTPTRPIGPNRKKNIIIGAFVGLLLGFGLAYLLEKLDTTIRDVEEIEDYLGLNVLGIV
PNITEKEIDQHRKIMEGGEEESEQMIGENIQSHLITHAAPKSPISEAYRTIRTNIQFSSVTKPTKTLIISSALPKEGKST
TVANLATTFAQQGLKTLVVDTDLRKPVMHHVFDSPRTPGIVEYLLKINQLDEVVRNTGIENLDLISCGTIPPNPSEVIAS
ENMNSFIDTVKQQYDIIIFDSSPLLAVTDASLLSTKTDGTILVIRAEKTDREAAKAALKLLKNVKSEIKGSILNNVVIGA
KYGYNYYYRYYYQYYYGHGATNKFRKRKSLRQNWWIKIKEFFN
>gnl|bykdb|A0A0Q1W291 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter baumannii] (length=728 residues).
MNQQNTNTEDTIDLKELFFSLIAQWKLIALCVILSVVCALLYLRVTPDTYSVDALVQVEDSKGASAALLGDLSQMIEQKS
PAQAEIEILKSRLVLGSVIKDLHLNIQVSSTENTFTHRLLSNPEYKTEYNTKSVIFKDGLKSFDIHQFDIPAYYLDKNLL
LNFDKQSLRLTDPASEEVILTVPLNQANHVAGPHGLWKVAIFTKDQFDATYNIKIQSIPAAVDALSANYSVAERGKLTGI
LGLSYQGQDQEHITKVLNAILATYSAQNIERRSAESAQTLKFLDEQLPDLKKQLDDAERQFNKFRQQYNTVDVTKESELY
LTQSITLETKKAELEQKQAEMAAKYTAEHPAMREINGQLTAINKQIGELNSTLKQLPDVQRQYLQLYREVEVKTQLYTAL
LNSYQQLRIAKAGEIGNVRIVDTAIEPIKPVKPKKLLVLALAIFVGGFIGTLIALLRNMLRTGIKDSGQIENEMDLPVYA
TVPRSPIQESRIKILKKKKSIPILAVKNSDDIAIESLRSIRTAIHFALANAKNNIIMIAGPSPEVGKSFISTNLATIFAQ
GNKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQADLQKVLHKTQVANLDVITRGKSPTNPSEILSSNQFKELLEQLQ
SQYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSQMKELELTVNRFEQAGVKVNGFILNDIQRASAGYGYGYNYAY
AYKAQKED
>gnl|bykdb|A0A0Q2YHQ7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Escherichia coli] (length=720 residues).
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITAVFALCAVVYTFFATPIYSADALVQIEQNSGNSLVQDIGSAL
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMAGQVFTLNVLDNK
NYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHARPGSEFTVTKYSTLGMINQLQNSLTVTENGKDAGVLSLTYTGEDRE
QIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVRSRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQL
NELTFKEAEISKLYTKVHPAYRTLLEKRQALEEEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITE
ASTVGDVRIVDPAITQPGVLKPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARD
SVKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVNWASKNYDLVL
IDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLNRFEQNGIPVKGVILNSIFRRASAYQDYGYYEYEYKSDAK
>gnl|bykdb|A0A0Q4BD73 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Novosphingobium sp. Leaf2] (length=730 residues).
MSNRTLDAPADEYSAAPVKRLLPDPSDIFSLFFRHRTVCAVAFALTLAAAIAITLALPRTYTATSALLLEPREAQPVKVN
DRGFVAPADDNLIDTAVQIIRSPTLTLDVVRSLHLDRVPEYGGADAASTGSDAQAAFSPDTVQVTQAERRAASVLLGSSN
VKRVGVTYLVEISASSRDPQMASRVANALARRYIDLDAAKKQLRNSESAQYVQGQATTLRKQAVADDGALQAYMIRNNLM
SAEGATMAEQEVSGLNRQIADAQAQLAEQRGKLNAALSQIARGGGGADIGAALASETVRQLRQQESEASAKLAQLDARYG
NLHPDVVQARDELADVRRQLAGELARIVSGLRADVQIASSRLASLLASRSRAKGSLEQNNSAQVGRLELERRAEASRAIY
SAYLTRAKETAQAGELPNADATIASVARVPGAPSSPNYRIAAIAGLGMAVLVACAATFLAEYFESTVATRSDIENGLQSV
YAGAVPSLASATRNNPERTSPQDYVVLKPMSLFAESLRNLATYLGLLGGPDGRVVTITSPLPREGKSTTAMCLARVLAMS
QKRVVLVDADVRHHSASNALLPDRQDEALFKVLRGLITLDEALARDDRTNLQILSTLGPAAPEDVITEPAMARLIAALRQ
RFDLIIIDSAPVLGIAETRIVSRLADTTLVIARWRTTPLKAVRTALDLLGQNGGRVAGVALSLVNIREYASAGLTDAFGY
HKKFKGYYAD
>gnl|bykdb|A0A0Q4BP08 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Novosphingobium sp. Leaf2] (length=730 residues).
MRVEQQLQGQTMDHEASLIYDLDDDASASGLGFDLRAVIAALRRNLKWVLAIIGAAIVAGIVLTLMITPQYVAFSRVLVN
QQADEIIQGSDVSGGNESFDADRFLQTQVDILKGRSLAQRVIASGKLVNDPRFFNALGGSQTAQGNAAARMKQAVDLLSN
ALTVNLPTNSRIVSISITSRDPGYSAKLADLYAENFIQANLNQKFESSAYAREFLMSQLEETRARLENSERDLNRYSRAA
GLIRVAGQGGAANSDSTLSVTNEALVQTNGSAGSATTDRIAAEDAWRTIANEPLLNIPQVQANPVVQDLLKQKAALEGSL
ANERTRHLEDYPTIKTYKAQIAELDRRIKTVGTSIKRSIYLNYQAVKAKEDSLNSRVGNLQQNALNEQDQGVHYNLLKRV
ADTNRALYDALLARYNQISATAGATSNNISLIDRAEVPDRPASPKMFVNLLVAFVLGCLAAAVFVYLKETFDDTIRVPSD
VERKLALPLLAVIPVQEEGSTADSLGDPKSSISEAYHSLVVNLRYSTTHGFPKVLVVTSAGQSEGKTTSAYAIAADMARL
GRRILLIDADLRRPTLHRRMGAQAPGLTEALVSDVPVSSLVLPSDIENLSYLTALPMPPEPALLLSGDRMGQLIAELAQM
YDSVIIDCPPMLGLSDTVAIAKLSDGVLFLLDASGFHRGAVKTALRRLKLINAPILGIVLNKFDPKSGGSEQEYYGYNYY
SYGRDEEKTV
>gnl|bykdb|A0A0Q4DFL7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. Leaf10] (length=734 residues).
MNLVSPNPSGSMMVAGTASTAEGIPAVREYLRIAMRWRYVILGTVAACVLSGLIVTLLMTPKYTATATIEISREASQVTN
FQGVERETSVADQEFYQTQYGLLQSRSLSERVATQLRLVDDPKFYERFGMASDELAFQRVNGRYPAAGRAVRQRVAGEIL
RKNLQITPTRLSRLVDIRFTSPDADFSAKVANAWSDNFIQVNLERKVQATSYGRDLLQRQLAQQKERLDDSQRQLVSYAS
QERIINLPAQQGASGSTTERSIVADDLAALNGALSQATAERIAVEARYREVGRAGASTEALRNQAINTLRQRRAELSAEY
QRLMTQFEPEYPAARAVQSQIDQIDRSIAGEERRVSGSLAADYRSAVERERGLQGRVEQLKASYLDLRRRSIQYNIFQQE
VDTNRALYEGLLQRFKEIGVAGGVGVNNVSVVDPADVPQRPSSPRLLINLAIALLAGLGLGAILAFALEQIDEAIADPAE
IERRLGLPLLGSVPKVTGQTPKEALIDRKSDLVDAYLAVQTNLAFTTEHGVPRSLSVTSTRPAEGKSTTALALATTLARA
QRKVILVDGDMRSPSVHHLGGVDHDRGLSNFLAGQEELESLLFRMDDLGFVAMSAGPIPPNAAELLTGNRLSVLLDRLLE
TYDHVVIDSPPVMGLADAPLIASKVEAVIYAVESHGIRSSLVKTALARLASANAHIVGGVLTKFEARKAQYGSGYEYGYG
YGRDRAATVKAEQD
>gnl|bykdb|A0A0Q4E805 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. Leaf208] (length=741 residues).
MNVIPSNLQPGNVTKAGSLPASRLADSERPPLVQQYLRIILRWKYVIIGVTVACIVLGLIITLLMTPKYTATATVEIARE
SSQVTNIQGVDRDTSIADQEFYQTQYGLLRSRALSERVASQLRLVDDANFFKMFGGKGQSAAFIQKDGRYTAAGRAERQR
LAGEILLRNVSINPTRLSRLVDIAFVSPQAALSARVANAWAENFIQTNLERKVQATSYGRNLLERQLQLQKQRLDQSQRQ
LVTYASEQEIINLPAQNSGSNGSATSERSIVADDLAALNSALTQATADRIQAEARYRAGGGGGASTEALGNVAINNLRQR
RAELAAQYQQLMVQFEPGYPSARALKSQIDQLDSAIGREESRVSGSIQSNYRAATGREEALQARVNQLKLSYLDNRRRSI
QYNIYQQEVDTNRALYDGLLQRYKEIGVANGVGVNNISVVDTADEPQKPSSPRFLINLLVSLLGGLALGAIAALALDQMD
EAFADPGEVERKLGLPLLGSVPKIGDNREPRDELLDRKSDLVDSYLAINTNLSFATEHGAPRSFSVTSTRPAEGKSTTAL
ALATMLARAGKRVILIDGDMRSPSVHYFGNVGHERGLSNFLAGEDTIEPLTFQMSDLGLTAMSAGPIPPNAAELLTGSRL
ATLIDRLLGQYDHVVIDSPPVMGLADAPLIAARVEGVVYAVESNGIRANQVKTALGRLAASNVRIFGGVLTKFEARRATY
GYGYEYGYGYGRSKDDAKDGI
>gnl|bykdb|A0A0Q4EAE9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. Leaf208] (length=725 residues).
MSASVSGLVPKRKGSKMDMAGSHVTDEQFDRETGAKLIDLKRIFATIRRRQWWIVGAMLVVLALTAIAYVAAPRRFTASA
VLALDRRVDELMAGQDTQASLPTDSPTVDTAVQVLTSTRLAEEVVDRLGVSTVARPTGGQPVTTVGARSAAISKVRGGLQ
VKRTGLSYAITVGFDSTDPQLAASIPNAVVDQYILDQRGDKEGARGREGKLLADRISQLRGQVIQAESAVARYRAATNLI
DVQKDSTAVQQEISVLNTQLAGAQADQAAAQARLSALRSSSTQSEASNLLRELRSQQAQLSAQRADLAGRYGSLHPDLAK
IERQLADIDRSIAAETSRVRSGAQSDVQVASGRSSAIRSSLSRAEGGLAAGNAASVQLAELQRNADSVRGLYQTLLDRYR
QSVAGQGTDQSNAYVISRATVPNSATSPMLTLFAGGGLLAAILAAALLVLVLEFFENGLKSRQDVETELGVPVMGSVPDL
KTVPGVSMPRNDPMGPANYLVEHGGSVFGEAFRSIRGALRIGHADQIIRSLAVTSALPGEGKTTTAICLARSAALAGQRV
VLVDCDVRRRASSRTMVGQVNSGLTEVLKGEIALDAALIRDTVSGAYILAQGTSKTSDYDLLVAPVMQKLVTDLCNQFDL
VVLDTAPVLPLAEARVVAAMADGVLFVTRWRHTPANASRLALDMLGRAGAHVQGAALTLVNMKEQARSGYGDEMMYYNKF
KQYYA
>gnl|bykdb|A0A0Q4FIY0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. Leaf17] (length=736 residues).
MNVATMNPGEADVSLPVQQSHPQTVADVPLIRQFLRIATRWRWIIAGIAAGCVLLGLIITLLMTPQYTAIATVEIAREAS
KVTNFQGVDRETSTVDQEFYQTQYGLLRSRALAERVAVQLRFVDDPKFFELFGLVKEAPEFQLVNGRYPASGRKERQRIA
GEALLDNLTVKPASLSRLVDIGFTSPEAGFSARVANAWAENFITTNLERKVQATSYGRQLLEKQLAQQKERLDRSQRQLV
SYASEQQIINLPAQGAPGGTTTVERSIVADDLAALNSVLSQATADRIQAEARVQASGAAGASTEALRNPAINSLRQRRAE
LAAEYQRLMVQFEPGYPAAQAIQSQIDQLDRSIGREESRVSGSVQADYREAVERENALAARVNQLKASYLDNRRRSIQYN
IYQQEVDTNRALYDGLLQRYKEIGVAGGVGVNNVSVVDSAEVPQRPSSPRLILNLVIALLVGLLLGAATAFALEQMDEAI
ADPAEIERRLGLPLLGVVPKVDDGVAPRDELLDRKSVLVDAYLAISTNLGFTTEHGVPRSLCITSTRPAEGKSTTALALA
TMLARSGKRTILIDGDMRSPSVHHLGGVDHDRGLSNFLAGDDNIDALVFPMRDLAFTAMSAGPIPPNAAELLIGNRFETL
IHRLLERYDHVVVDSPPVMGLADAPLIASRVEGVIYAVESHGIRSTLVKTAIGRLSSSNARIFGCVLTKFEARKAHDGYG
YGYNYGYGYGRQDAKA
>gnl|bykdb|A0A0Q4G5K7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. Leaf20] (length=720 residues).
MPVSPRPIDSERTPLIQQYLRIALRWKYVIIGVTVACVVLGLVITLLMTPKYTATATVEIARDANQVTNFQGVERQTNSV
DQEFYQTQYGLLRSRALSERVATQLRLVDDPDFYTMFGISSDGPAFELSNGRYSATGRAERQRVAGEVLQQNLSVTPARL
SRLVDISFTSPRASFSTRIANAWAENYIQTNLERKVQATSYGRNLLERQLALQKQRLDETQRQLVTYATQQQIINLPSQG
SGANGAVTSERSIVADDLAALNTALTQAITDRIEAEARYRAKKGGTPAEALSNVAINSLRQRRAELAAQYQQLMVQFEPG
YPSARAMKSQIDQLDRAITREESRVSGSIEGAYRIAAARENSLQTRVNQLKSSYLDNRRRSIQYNIYQQEVDTNRALYDG
LLQRYKEIGVANGVGVNNISVVDIADEPQRPSSPRLFLNLLISLLAGLALGAATALILEQMDEAFGDPGEVERRLGLALL
GSAPKVANNSSPRDELLDRKSDLVDAYLAISTNLGFTTEHGAPRSLSVTSTRPGEGKSTTALALAIMLARAGKRVILVDA
DMRAPSVHHLGNVGHERGLSNFLAGEDAIEPLTFSMVDFGFTAMSAGPIPPNAAELLTGNRLARLIERLLEDYDHVVIDG
PPVMGLADAPLIAARVEGVIYAVESHGIRASQVKTALGRLAAANVRIFGGVLTKFESRRATYGYGYDYGYGYGRETKGEG
>gnl|bykdb|A0A0Q4GIY3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. Leaf20] (length=724 residues).
MNGDTRMAAKTNTLSDELHEGESDARLIDLHRIFGIARRRRWWIVATVVIILVLTAVAYTMVPRRYMGTASIALDRRADQ
IIAGQSPNQELPTDSPTVDTAVEVLTSPSLAARVVDTLNLQREPGFGQAIDGPVLSPAAARSRAISKVQSGLAVKRTGLS
YAIDTSFTWTDPKHAAAVVNALVDEYIASQRDTKVDSRTNDNKLLRERLSRLRDEVIRAETAEAQYRANTNLIDVQKDST
AVQQELSFLNTQLATAQADQAAAEARLRAARGGGGNAAADFGSPVIRSLRQQQAQLSAQRADLAGRYGPLHPDLAKLDRQ
YADVNNSIRDETRRTLAGLVADARVSAGRTSAIRSSLDRAQGGLQAGNRASVQLNELQRNADSARGLYQAFLDRYRQSVA
GEGTDKSNASVISRAMVPGGPVFPNAAVFGAGGILASLLAAVGVVLLLELLESGFQNRRQVEARLHVPVIGTVPDLATIP
GARISKRDPMAPANFLVENQGSLFSESFRSIRSALKIGRPDQVVRSLAVSSALPGEGKTTISICLARSAALAGAKVVVID
CDVRRRTFSRSVTNDTAVGLIEVLDGTAQLDKALLHDTASGAYILPQSNTKSMNYELVASQAMFSLIQSLSERFDLVLLD
TPPVLPLAEARAIAAMADGVLFVTRWRKTPANASELAVDMLAREGAKIYGVALSQVNLKQQSRAGFGDEMSYYHRFKGYY
AEAG
>gnl|bykdb|A0A0Q4GM02 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. Leaf20] (length=741 residues).
MVALIKSFQGDDNGGAIMPYVAPTPPRSQTDRIDLRALAAIFRRRVGIFLTVLVAVIVTALVLTTLQVPRYTATASIALD
VKQDQITPVGQTDRSLPSTVPSDAYVDTQISVIGSQTMAMKVVDRLGLDHRRQFTRREPATGLRGWLSPDAGGPIEPAVA
RAAALRYLLGNVTGRRVGETYALDIVAESEDPREAADIANAYAIEYTQGALREHRAANERNLRFLSGRLREVQADAQAAT
NAVQRYRNSNGLLTSTTASLNEQEISSYNQAVASAQAQSAEDEARLATARTQLRGGSTGGDIGEALGAPVISNMRGTQSA
TATRLAELTTRYGSAHPEVRQARSQLAEVNGQIQAEIGRIISNLDAKRRVSAQRLSSLRSSLGSAQGGLAVRNEALPGLN
DLEKRAATSEALYESYLNRYKELSAREGTEQADASVLTPALTPTRASSPNVLLNLILGIVLGIGLGIAVAFVTEMGFAGI
TTGDDIEQRLGVRYLGSIPLLGSVMRRGKQPPVMAILNDPRSAFAESFRSLRASLQFAQAGPARVIAVASALPQEGKTTT
AICLGRSMAMAGERVVLVDCDLRQHGVSRFLRREHDAPGLTEVLRGEATLEQAIIVDESTSMAVLPVSTRGDLDAELVTG
EQMDRLLDDLRSLYDVIVIDTAPVLPIADARLVLGKADTTVFVVRWRKTPDHAIRAAFRMLPASHVALAGVVLTRVDMRK
QARFGYGDETFYYPAYKNYYA
>gnl|bykdb|A0A0Q4HL74 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. Leaf22] (length=731 residues).
MNLVTPYSRDASIGIRTQKPPENVPIIRQYLRIALRWRYVILGAVAACVLLGLIVTLLMTPKYTASATVEISREASQVTN
FQGVERETSVADQEFYQTQYGLLQARSLSERVATQLRLIDDPKFYERFGVSSEVPAFQLVNGRYPAAGRAIRQRVAGQVL
RDHLNISPTRLSRLVDIRFTSPDAEFSARVVNAWSEAFIQTNLERKIQATSYGRNLLQRQLAQQKERLDESQRQLVAYAS
QQRIINLPAQQNGDGSTAERSIVADDLASLNAALSQATAERIATEARYREIGRAGSSSEALRNQAINALRQRRAELAAEY
QRLLTQFEPEYPTALAIQSQINQLDRSIAGEERRVSGSLEGDYRSAVERERGLQARVEQLKGNYLDLRRRSIQYNIFQQE
VDTNRALYEGLLQRFKEIGVAGGVGVNNIAIVDQAEVPQKPSSPRLLINLAIALLAGLGLGAALAFALEQMDEAIADPAE
VERRLGLPLLGSVPKVEGSTPREALLNRKSDMVDAYLAVQTNLAFTTEHGVPRSLSVTSTRPAEGKSTTALALATMLARS
GKRVILIDGDMRSPSVHHLGNVSNDRGLSNFLAGQEDIMQLTFEMSDLGFTAMSAGPIPPNAAELLTGHRLSLLIERLHE
RFEHIVIDSPPVMGLADAPLIASRVEGVVYAVESHGIRSTLVKTALARLASANAHIFGGVLTKFEPRKAHNGYGYDYGYG
YGRDGTGAKEG
>gnl|bykdb|A0A0Q4I3V6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. Leaf226] (length=749 residues).
MENEQVTTAIQVYGGGNAMPISPYTPQASEVAQDRIDARALVAMFRRRLGIFLLVFLSILIIGLALTFRQTPSYTAVAQV
SLNVKQSALTPAGVGERPDLDRAEPSANFVDTQVEIIRSEAFARRVASALALPTDPRFTSLQEPRGIRTWITSWFTAPPK
VARPTAAEAEAAAITYVQDGVTATRLNSTYALHISFSDTDPAMAARIVNEFARQYTEGSLAKKQVENRDSTAMIARRAED
LRARWQAADAAEQRYRIQHNLTSTQGLSLTEQEISTYNQAVAAARAALAEDQARLSTARAQLRSGSRGDDVGEALGSSVV
SGLRANQSALSAQVAELTTRYGARHPDVLRANSQLAAIDKQISNEIARVISNLAAKTRVSEGRLASLSGTLSGAQAELAG
NNAATVELNNLAQNNKTARSTYESYLTRYQEQLARLGTEQADASVLKLAAIPDTPTSPNILLNLILTTVLGFGFGLVAAF
LTEMAFTGLTTGDDIEQRLGVRYLGAVPLLASVTKSAKSPPSAIAAEPRSAFAESIRSLRASITFAAHAPAKVIAITSAL
AQEGKTTTSICLARSMGLAGEKVVLVDCDLRRHGVSRFLRTEADRPGLMQVLRGEATLEAALVEDTATGMMVLPIAADDD
FDGDLMIGDKMDGLLDALRDRFDVIVLDTAPVLPIADARLMLGKADVAVFVARWRKTPDHAIRSALRLLPLDRIHLAGIA
LTKVDIRKQARFGYGDSTYYYHDYKGYYA
>gnl|bykdb|A0A0Q4IAM8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingobium sp. Leaf26] (length=708 residues).
MAPLTHPAGNAAGLNARLSASARYGWLVLRRHRVILFVTMALSLLAGAIIILTSTPDYRATASVEVEDVPAGAAGSATAQ
RAGNANDTESLMQTELEVLRSRALAEEVSRSLALVGTPTFFKGMDRERPTQGVGTLSQRQVEQDMVVRLLRENLEVQLPG
KSRVLRISFVSSDPVLSARIANSYADSLIRADLKRGFESGVQARRFLLGELDGARNDLSRAERDLAVYAARNGTMMPVDE
KAGEGDNPARPSAPPASPEGSVATRLAQLNGYRAQAVADRIAAQKRWESARQSRADTLPEVLGNGAMQQIIAERAQARAV
LAEERQFRKDAHPEMREARARLVALDEQADSMANSIRASLREQYDVARRGEDQIAKEIAQLEEQARVEQGRGVQMGIMER
SVDTYRMLHDSLLQRYRDMASQAGFQAGRIQPLDRAAVPTRPFSPRIGRILSLACLGGMALGLLLVAARHMFDDAVTSAD
TLAERVGLPLLGAVPVTGDNPQPPEIFTPIASSLLLASADGLPRSILVTSAQEGEGKSLTLHALALALAGLGKSVLVVDG
DMRRPAQHRLFRLSPARGISEVLTGQAKVAEVIMPTAVAGVALLPCGTLPPNPSELLSTSALDGLLAAVRDGYDTVLIDA
PPLLGLTDAHLLAAKAQASLLVIEWGRNHHGGLRSAVETLRRSGGAIIGGILTKQQGRALDYDYHRGG
>gnl|bykdb|A0A0Q4ILD5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. Leaf25] (length=739 residues).
MQQATGGFDTAPDRTIGPRDTGRHAAAAGDDPSLLPDAEDEAGFDPRAIWAVLYRNRLVMILIVALALVLGVVSIMVTPR
IYQARSSVQIDQQVAKVLGTEDSEPATAGGDADRFLQTQVDVINSRAMAKRVSDSLGLAANDAFLESMGGRAKLPVPGER
RIDQVLDTLQNNLNVDLRRNSRVVGVQFKSRDPALAARIANSYANNFIESNIQRKFSTSAYSREFLQNQLGLAKGRLEAS
ERSLINYARSAQLIDASTGARRTGQPDGPQSLVTANLVQLNESYATAAAARVQAQQRYEQARATPLLSLPDVLSNPAAQE
MLQRRAELNGQLNQLRERLKPDHPTVIQATAQLDALNAQLNQLAGSILASIRNQYLTAQRQQDAIDRQVSGLKSATLAEQ
DRGVQYNIFKREVDTNRQLYESLLQRFKEVSAEAGVATNNITLVDSAEAPRRPTSPRPLVNMALALVAGVFLAGLYAFGR
ERLDDAIRDPRDVETKLHLPLLGVVPEQEEGDPLVALRDTKSEIAEAYYAIRTSLELSSNQGLPRSLLVTSSQMAEGKST
TSYALARDFASIGHKVLLIDADLRRPSLHRLMNMSAADKGLSTVLARMTPVEDAVVSTDTDNLSFLPAGPLPPDPANLFA
GTVPADLLAKLGERYDLIVLDGPPVLALADATALASSAAATVIIAEAGGAHYGQVRNAITRLVRAQGHVLGCIVTKYNRR
KSGYAATGNYYRYDYRAKE
>gnl|bykdb|A0A0Q4IV31 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. Leaf25] (length=725 residues).
MDLPGAVPHVPAREPHGRPSIVAEILSIVRRRRLLIAAIVAAMLTIGLVYTLLAPRKYTAAALIEIQRERGSFIEVEGAQ
KSDSLADQEFYQTQYGLLQSQSLAERVANDLRLYDNVEFLTTAKILDTDAANQSRRALSSEERRSRTTAAASYLLRNFEI
EPERFSRLVTIRFTGRDPALAKRVIDAWSADFVRMTLARRYEATAYARSFLEQRLQQLRGRINESERQLVAYASQQGIVN
LPANSGGAGGQAEGERSLIADDLASLNQELSRAVADRVKAQSRTGSSDGAVSEAIANPAISTLRNKRAELAADYAKMMVQ
FEPGYPPARALQRQIQQLDQSINREERRVQQTLSEEYRAAASREEALQSRITGLKTGLLDFRRRSIQYNILQREVDTNRQ
LYDALLQRYKEIGVAGGVGVNNISVVDGAQLPTRPSSPKLLLTMAAALLAGLIVAGGVVFVLEQMNHGINDPEQVEEVLG
VPLLGTVPTVPGSNMTEMLADRKTPISEAYLSIQTNLRFATDQGFPQILAITSTRAAEGKSTTAFALAHAMARLGGRVLL
IDADMRSPSVHHLIDCTNAYGLSDFLAGRDDIDALIHRFADAPAVMTAGPQPPSAAELLSGSGLKRLVQVLRERFDHVVF
DMPPVMGLADAPLVASAVDGVVFVMQAGETHSTMAKAAIGRLSDAHARVFGAVLTKFDPKRATFGYGYDYGYGYGYGNTA
DAKGG
>gnl|bykdb|A0A0Q4IW22 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. Leaf25] (length=710 residues).
MKVSNAAAGYETRLADVVRTAKDVIRRRYLTLAAITLAVTAIGVFLTLRITPTYQGVAKIQIDPSRNPLTRNQSEANAQL
ASEAIETEVTNLGSMDLVRTVVRRLNLVNHPQFRGIWQARAEKTGPVSDTEKVEMVAAAVRSDVSVSRDKLTYILLVRYS
SPDADIAAKVANAMATAYLDNKVGSRIGTAERQSKWFESRMADLVQEVRVADERVAQYQAQAGIVRGASNNSGTITDQQV
GPLSVQLASAESIAAEARSKQTSAQQQVSRGTLDTVSDVRNSATVQDLRRQRALLMQASAEMEGRYGNRHPDYLKVRDQL
EGLDKQLAEESRRVVSSLRSDADAADARAASLRSSMRALEERQANNARASVIAASLQRDADSKHAAYDRLSQLALESRQA
AQNSIAQAQIIEAAQTPRAPSWPNKPLLFMVSFLVGLAAGIAVITTQELMVSGLRTVEEVEEKLGVPLLAAIPNVRKNTR
PANLLIEKPTSQFAEALRNARASILGVREKDRPQIIALTSALPSEGKTTTSLGLARTMAISGDRTILVDADVRRAMLRNI
LDTSSTGPGIVEVLHGEVDLDQAIQPSGVENLDQILVQKPYFSSENMFGSGQMQTMLDELSKRYDTIILDLPPLVGLADG
RFIAALADAVVLVIKWDTTPADAVISAADHLKSDGANLVGAMFTMVDQSSKAAGAYYYYTKQYSSYYQTT
>gnl|bykdb|A0A0Q4IY60 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. Leaf230] (length=743 residues).
MGSVDVSQGALTPNDRRNFGSAPGSNFAEREDFSVPEGEGDEPAIDLRAVWATIFRNRYMMIAIVGVALMLGIASALLMP
RKYTAQSSIQIDQQVAKVLGTEDSEPQVAGSDADRFLQTQADVLNSRAIARRVSDSLALSANDEFLKRMTGARQIEIKPG
DASLADQVVDVLQKNLTIDLRRNSRVVHIIFTSRDPALAAEIANSYATNFIEGNIQRKFSASSYSRRFLQNQLGLAKTRL
EGSERDLIAYARSARLIDASAGARQQEADNAPRSLVTANLIQLNADSATSEANRLRTRARWEQARRAPLMSLPEVQANEA
VQRLSQKRAEDIASLSEVRRRLKPDHPVVIQALAEIATLDQQIRQLAEVTRKSIENQYLTAERQNRALIQQVTALQGATL
AEQGRSVRYNILRREVDTNRQLYEGLLQRYKEVSAEAGITTNNVSSVDTAEQPRRPTSPRPLLNVALALIAGLALAMLYA
FGRDYLDDSIRDPQDVEQKLHIPLLGVVPDTRGDSPLDALNNPKSEIAEAYHAIRTSIELSSNQGPPRSILVTGSSKSEG
KSTTSFALARDFAGLGRRVLLIDADLRRPSLHRTLGITLPEIGLSSVLARMTERGASILPTAFPGLSFLPSGRLPPDPAT
LFAGTAMQDLLAALEADYDVVIVDGPPVLALADAAQLTAAAQATVFVAEASSAHFGQARNAVSRLLRAGGTVIGCVMTKY
NAKKAGFGQSYDYYRYRYDDASK
>gnl|bykdb|A0A0Q4IZ35 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. Leaf230] (length=740 residues).
MNVIMSDLQYGFAGNGTTMAPQSVESERPPIIQTYLRIALRWKYVIIGVTVACIVLGLIVTLLMTPKYTSTATVEIAREA
SQVTNIQAVERDTSVADQEFYQTQYGLLKSRALSERVATQLQLVDNPDFFKMFGTKDKNPAFDLTNNRYTSAGRAERQRV
AGEILLQNLSVDPTRLSRLVDIAFTSPQAAFSARVANAWAENFIQTNLERKVQATSYGRNLLERQLRLQKQRLDESQRQL
VRYALQQKIINLPAQTGSTAGGPTAERSIVADDLAALNTALTQATADRIEAEARYRSGSAGGTSSEALGNVAINNLRQRR
AELAAQYQQMMVQFEPGYPAAQALKSQIDQLDRAIGREESRVKGSIEGAYRAGAARESALQAKVDQLKLSYLDNRRRSIQ
YNIFQQEVDTNRALYDGLLQRYKEIGIANGVGVNNISVVDTADEPQKPSSPRLFLNLLISLLGGLALGAVTAFALEQMDE
AFGNPSEVERKLGLPLLGSVPKVDEDREPRDDLLDRKSDLVDAYLAISTNLGFTTEHGAPRSFSVTSTRPAEGKSTTALA
LATMLARANKRVIIVDGDMRSPSIHHFGNVGHERGLSNFLSGEEGIEPLTFQMPDLGLTAMSAGPIPPNAAELLTGTRLT
TLIDRLLEDYDHVVIDSPPVMGLADAPLIAAQVEGVVYAVESHGIRATQVKTALRRLEAANVRIFGGVLTKFQARRAGYG
NSYEYGYGYGRAKDDAKGQG
>gnl|bykdb|A0A0Q4IZF8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. Leaf230] (length=706 residues).
MKVVNAAEPETRLSDVIRTVRDVIRRRILILLGITAVVAAIGIILTLRITPVYQGVTRIQIDPSRNPLARTANDAQAQLA
SEAIETEVSVIRSLDLARVVVKRLNLLNDPEFGGGPPPEGKPALSPAAKLDVVARSVNSHLDVARDRLTYIMAIRFNSES
ADKAARIANAFATGYLDTKVGNKIGTAERQTAWYQKRMDELAADIRVADERVAQYQAQAGIVRGASNQTGTIVDQQVAPL
SLQLASAESFAAEARSKEQSAKQQVRRGALDSISDVRQSATIQDLRSKRASLSQTLEDVRGRYGERHPDFIKVRDQVAGI
DAELSKEMGRVVRSLDADAGAADARAASLRQSMTQLEQKQAGNARASVIAASLQRDADGKHDAYEKISQMALESRQAAQN
SIAQAQIIDNAEPPQSPSWPNRPLLFLLSLIAGFGVGIAVIVTQEMLVTGMRSIDEVESELGVPLIAAIPNIRQDHPADI
VVDKPTSQYSEALRNARASLLGVRGQPRPKIIALTSALPGEGKTTTALALARVMAMNGDKTIIVDADVRRAQLRMITQTK
ADGVGLVELLHGDVTLDEAIEPSGLQNLDQIIIHKPFFSSENLFGNDLMPKILEQLSERYDTIILDLPPLVGLADGRFLA
ALADAVALVIRWNNTPKHAVTSAAAWLKSDGANLVGSMFTMVDTSSQAVGSYYYYSKQYSEYYQEA
>gnl|bykdb|A0A0Q4JA44 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. Leaf28] (length=748 residues).
MASPGAAGPTNLTVQPDQRRDLASMSQAGNYGGYGNGGAGGRELSLALLWRVAVEWRWLILAATGTGIAGAVLITLLTPL
LYRSTAALELNPPEVEIMADEGSKGGRQSSMRGDANFVGTQLALLGSRALAERVAQNLNLAADPAIVGEVGDRTRNTASA
ADFVQSGTQVRLLPQSMIVNVSFVARDPQTAAKVVNGVADAYISTNLERRYQSSSYARDFLQKQIATTRRDLERSERQLT
AYAQAQRLISTGGSEEGGDTNSLTGSSLVALNSALAATQARRIAAEQRYREAALGGATTEGSVNAVPLRGQIAALDAEYQ
QKLQTFRPDYPEMVALKARIDALRKSVVSETRTANSDRLGTLRQEFQAARAEEDRLRSQVSGLSGSVLEQRGRLIQYNIL
KRDVDTNRTLYDALLQRYKEIGVAGGIGTAVASVVDRGIVPGNAFSPSLYKNLMIGAVLGLIAGMLAAIALEFINDTIKT
PDDVRDKLQLPFLGGIPNAKTAKPIEELRDTLSPVSEAYLSTASAMQFVTEGGAPKTLLVTSTRPAEGKSTSAWALAYSF
TRLGKSVLLIDADMRRPAFVTGRDNIGLSHILTNTGSLKEHVLHTDVDGLWIMPSGTIPPSPPELIASARFASLLADVAA
TFDVVVIDGPPILGLADSPLLSSIAQATLMVIESGRTRTRAAIEAQNRLRTAGAHMVGAILTRYQPQASYGYGYGYGYGY
GQSKDQYRYVAGGNEKKRRIMLTMHDET
>gnl|bykdb|A0A0Q4JBL2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. Leaf28] (length=728 residues).
MNRMIEQGVGAADATAPRTMTPHLQERSAPSALAEILSVIRRRRTLIAVIISALLVVGLLFSLLATRKYTASAVLEIQRE
TGSFVKVEGATSSDNIADQEFYQTQYGLLSSKSLAERVANDLALYSNTDFLKAAGIVEDDDAATPTTAISAQDRRNRTSA
AAAYLLARFKVEPERFSRLVTIEFTGTDPALTKRVIDTWSTDFIRMTLARRYDATSYARNFLEQRLVQLRSRINDSERQL
VDYASRQGIVNLPASTTGGERSIVAEDLANTNGELGRAVADRVRAQSRLNNGGAVDEALGNSTINSLRQRRAEQASDYAK
MMAQFEPGYPPARALRQQMAQVDRSIAQEVSRVQRTLQESFASAERRETEFQQRMKTLKSGVLDFRRRSIQYNILQREVD
TNRQLYDALLQRYKEIGVAGGVGVNNISVVDTAELPTRPSSPKLLLNMAIALVLGIGLSALAAFLLEQIDQGITDPGQVE
GALGVPLLGTTPKLAGDPVTLLGDRKTAISEAYLSVQTNLGFSTHRGFPASLAVTSSRAAEGKSTTAFAIAQSLGRTKRR
VLLVDADMRSPSVHHLLNLSNDRGFSNYLTGEDDLDNLIVRAADEPMAIMTAGPQPPSAPELLSGDRFRTLIGELLARYD
HVVFDIPPVMGLADAPLIASAVEGVVFVIEASGTHVSMAKVALGRLQNANARIFGTVLTKFDTKRGLFGSGYEYGYGYGY
GDTAKKPA
>gnl|bykdb|A0A0Q4JGB5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. Leaf28] (length=719 residues).
MDDFRSSQTAEPRSKGRLAATIGDPMDSIRHAFATVRHRKWLAIGVFAIILALVLAYGFTRTKLYTASAGMVVNSRELNV
SEKDKEVLPGLSTAETAVATEVEIMRSSAVALGTVRALNLVANPVFAASISKLPGADREAAATGLVIGGTKILRPGESSV
VSIAYTAPDPMLAKAVADQIGHQYLAVKEKSRRAAVEQVGRGLGTELDNLRVQLEATDTEVARYRTQHDLFDSQGATFTQ
QELSLYKQQQAAAQAALADAQAKLSTARGQTRKGDTGGVGAVLQSPVIQQLRNQRALLATTYADLQGRYQPDHPDLIRTK
DQVEALDSAIGAETSRQLANLNANAQIARDQVANAAGIVARTTGTLASDNTASVQLSQLQRKADGLRATYQALLERKNLI
SSQALVADEDARIFSPAALPQRPTSPNKPLILMIGLVLATIVAGAAVWIAEAFDRKLSSSADIERKLGLPHIANIPEIAS
IARPGEEGISPIDFPVERPLSLYAEQLRAVRLALVRKGRSGMTSVGITSARPSEGKTTLAISLARTSAMAGSRTLLVDAD
LRRASVSRVMGLPPHAGMVQVLRRTATLDEALIHDPVSGMYVLPAGDTTENRQDLFAAANIGALLAEAEKRFDLVIFDAA
PALAVTDARLLLRQVDEVLMALRWNDTPSQSAAATLKRMRALDIEPLGVIATRVDMRQLAVFGHGDVDRDHADYGAYYA
>gnl|bykdb|A0A0Q4JW75 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. Leaf30] (length=735 residues).
MHIVPSSMQANAASMQLQTVVKSNPEREAMPIIRQYLRIAMRWRYVILGSAVACLLLGLIVTLLMTPKYTATSIIEISRD
SSQVTNFQSIERETSVADQEFYQTQYGLLESRSLSERVATQLRLVDDPEFFSLFGIKSEDPAFRQANGRYAAQGRATRLR
ISGEVLRAHLDIQPTRMSRLVNISFTSADGAFSTRVANAWADAFIQINLERKVQATSYGRNLLQRELALVKERLDESQRQ
LVGYASAQRIINLPGQANANGTTSERSIVADELSGLSTALTQATADRITAEARYQQRGRGGASSEALQNQAINSLRQRRA
ELASEYERLMVQFEPGYPQARAIKSQMDQLDRSIVREEGRVSGSLEADYRQALERERSLGARVEQLKSSFLDLRRRSIQY
NIFQQEVDTNRVLYDGLLQRFKEIGVAGGVGINNISVVDPADIPQKPSSPRLLLNLVIALLAGLGLGVAIALGLEQIDEA
IEDPGEVERRLGLPLLGSVPKVEGMSPKEALLDRKSDMVDAYLAIQTNLGFTTEHGVPRSLAITSTRPGEGKSTTALAIA
TMLARAQKKVILVDGDMRSPSVHHLGGVDHARGLSNFLAGQDDISTLTFEMADLGFTAMTAGPIPPNAGELLTGSRLPLL
IERLLETYDHVVIDSPPVMGLADAPLIASRVEGVIYAVESHGIRSSLVTTALGRLAAANAHIFGGVLTKFEARKAHYGYG
YEYGYGYGRDAKSNS
>gnl|bykdb|A0A0Q4KIR3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. Leaf34] (length=736 residues).
MQYERTPDAMRDLDGPLIDVGGGGKSNFSLSHLLAILKKRKWLIIGSVVGALLLGIVITLLMTPQYTSVSVVEIQRETRN
FTNVDGVDSRSPSAVDSEFYETQAGLLRSVALAGSVVTDSRLQDSAAFFTMFKSSKAKNWFDNGKLVPRASTRDERVREA
SEILLDHIKILIQRQSRLATISFTSPEVGFSKKIVDSWAAHFVQATLDRRYAATAYARKFLEDRLSQLRIRIDQAERQLV
DYAARQDIVNLPSEVASTPGSGAAPERSLVAENLVALNKELATATGERIEAQSRLGAKGGDVQEALSNSGISQMRAKRAD
LSSEYAEMIQKFDPAYPPAQALRAQITTLDQSIGREEGRVRSTLQETYNAAQERETALASKVDGLKSSLFDLRRRSTQYN
ILMRDVDTNRQLYDALLQRYKEIGVAGGVGANNIAVVDAGDLPDKPSSPKLLLNLAFALIGGLIVGASLAFALEQLEDSL
SDPAEVAELLRVPLIGVVPQVSEEPLAALLDVKSPLSEAYFSVQTSLALATMNGFPRSLVITSSRPNEGKSLTSFGLAKT
LAVQGRRVLLIDADMRSPSVHYMLDLEATPGLSSLLTNAASIQDTVQQTSIANLSVIAAGPTPPSAAELLSGGRFKDMVV
ALLETFDHIVIDAPPVMGFADSPLIASQVEGVCFVIEAHGTNKSSARTAISRLRSADTTIFGAIVTKFNSKRAFSGYGYD
YGYGYGYGESATKAKR
>gnl|bykdb|A0A0Q4KL98 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. Leaf33] (length=749 residues).
MASIGAPGPTNLAVSPDTRRDLAPLPPEGGYGNYGNTTGARELSLSLLWRVLVEWRWLILASVGAGIAAAVLITLLTPLK
YRSTASIELNPPTVEVLGDEGGKTGRQSAAANDAAFMGTQLGLLQSRALAERVAQDLNLANDPAVVGESKNRAANAEIAA
SIVQGGTNVQVQPQSRLVTVSFSARDPQLAARVVNGIADAYIATNLERRYQSSSYARDFLQKQIATTRRDLEKSERQLVA
YAQQQRLITTGSADDAGDTNSLTGSSLVALNSALAATQAKRIAAEQRYREAVLGGATTEGSANAAALRTQIAALNAEYQQ
KLQTFKPDYPEMVALKARIDALRASVISETRTANADRAGSLRQEYQAARAEEDRLRAQVASLSSSVLDQRGRRIQYTILQ
REVDTNRTLYDALLQRYKEIGVAGGIGTAVASVVDRGVVPGGAYSPNLYLNLMIGAFLGMIVGMLSAIALEFINDTIKTP
DDVRNKLQLPFLGGIPNAQEAKPIDELKNALSPVTEAYLSTTTALQFVTEGGAPKTLLVTSTRPAEGKSTSAWALAFSLT
RLGKQVLLIDADMRRPAFVTGRDDIGLSHILTNTSSLSEHVLQTEIENLWIMPSGPIPPSPPELIASARFAALIADATST
FDHVVIDGPPILGLADSPLLSSVAQSTLMVVEAGRTRTRAAVEAQNRLRTAGARLAGCILTRYQPQASYGYGYGYGYGYG
QSKNQYSYVADKNDKRRRILLTTRDDAES
>gnl|bykdb|A0A0Q4KY77 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. Leaf38] (length=736 residues).
MQYERTPDAMRDLDGPLIDVGGGGKSNFSLSHLLAILKKRKWLIIGSVVGALLLGIVITLLMTPQYTSVSVVEIQRETRN
FTNVDGVDSRSPSAVDSEFYETQAGLLRSVALAGSVVTDSRLQDSAAFFTMFKSSKAKNWFDNGKLVPRASTRDERVREA
SEILLDHIKILIQRQSRLATISFTSPEVGFSKKIVDSWAAHFVQATLDRRYAATAYARKFLEDRLSQLRIRIDQAERQLV
DYAARQDIVNLPSEVASTPGSGAAPERSLVAENLVALNKELATATGERIEAQSRLGAKGGDVQEALSNSGISQMRAKRAD
LSSEYAEMIQKFDPAYPPAQALRAQITTLDQSIGREEGRVRSTLQETYNAAQERETALASKVDGLKSSLFDLRRRSTQYN
ILMRDVDTNRQLYDALLQRYKEIGVAGGVGANNIAVVDAGDLPDKPSSPKLLLNLAFALIGGLIVGASLAFALEQLEDSL
SDPAEVAELLRVPLIGVVPQVSEEPLAALLDVKSPLSEAYFSVQTSLALATMNGFPRSLVITSSRPNEGKSLTSFGLAKT
LAVQGRRVLLIDADMRSPSVHYMLDLEATPGLSSLLTNAASIQDTVQQTSIANLSVIAAGPTPPSAAELLSGGRFKDMVV
ALLETFDHIVIDAPPVMGFADSPLIASQVEGVCFVIEAHGTNKSSARTAISRLRGADTTIFGAIVTKFNSKRAFSGYGYD
YGYGYGYGESATKAKR
>gnl|bykdb|A0A0Q4LBA4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. Leaf42] (length=731 residues).
MPGGVDNSPENAARWLPTSQKVTARPQGLSLLTQGWNILRRRKWLIAAAIGIALIVGIVVTLLATPQYTATSVIEIQRET
RNFTMVKGADSNDNASMDTEFYQTQYGLLESKSLAERVVNQLRLADDATFFETFGSGQSKEWFANGRPVAAASTRDQRIR
AASAILLDRIQITPERLSRLVRISFSAPDAAFSKKVVDAWGAQFIQQTLARRFDTTAYARRFLEQRLAQLRVRIDESERK
LVDYAARESIVNLPGETSANGTTTERPLVVDDLSTLNRELAQATADRIRAGSRLNSSTGGQSAEALQNTTITQLRTQRAS
LSSEYAKLMVQFEPQYPPAVALRRQIALIDQTIAREEGRVGGSLRSVYDAATTRENELRSRVKELEQSVLNFRRRSIQYN
IFQRDADTNRQLYDALLQRYKEIGVAGGVGVNNISVVDEAELPIRPSSPRPLLNLATALLVGLALGAIVAVIIEQVDDRL
RNPADITALLDIPLFGTIPKLRDGNAHEALRDPKSVLSEAYLSLQTSLAFSTSHGVPKTLSVTSSRPAEGKSTTSDALAR
ALARSGRRVLLIDGDMRSPSVHHLFDAENRVGLSNYLSGDDRIETLWRPTDVAGLWIMTAGPKPPSAAELLTGNRLGELL
SKLGTSFDHIVVDAPPVMGLADAPLIGSATEGTVFVVDMQATRRTIARVALDRLLTSQTHVLGAVLTKYDQRGTAASYGY
DYSYNYGEQTA
>gnl|bykdb|A0A0Q4LPK1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. Leaf42] (length=710 residues).
MKVSNAAAGYETRLADVVRTAKDVIRRRYLTLAAITLAVTAIGVFLTLRITPTYQGVAKIQIDPSRNPLTRNQSEANAQL
ASEAIETEVTNLGSMDLVRTVVRRLNLVNHPQFRGIWQARAEKTGPVSDTEKVEMVAAAVRSDVSVSRDKLTYILLVRYS
SPDADIAAKVANAMATAYLDNKVGSRIGTAERQSKWFESRMADLVQEVRVADERVAQYQAQAGIVRGASNNSGTITDQQV
GPLSVQLASAESIAAEARSKQTSAQQQVSRGTLDTVSDVRNSATVQDLRRQRALLMQASAEMEGRYGNRHPDYLKVRDQL
EGLDKQLAEESRRVVSSLRSDADAADARAASLRSSMRALEERQANNARASVIAASLQRDADSKHAAYDRLSQLALESRQA
AQNSIAQAQIIEAAQTPRAPSWPNKPLLFMVSFLVGLAAGIAVITTQELMVSGLRTVEEVEEKLGVPLLAAIPNVRKNTR
PANLLIEKPTSQFAEALRNARASILGVREKDRPQIIALTSALPSEGKTTTSLGLARTMAISGDRTILVDADVRRAMLRNI
LDTSSTGPGIVEVLHGEVDLDQAIQPSGVENLDQILVQKPYFSSENMFGSGQMQTMLDELSKRYDTIILDLPPLVGLADG
RFIAALADAVVLVIKWDTTPADAVISAADHLKSDGANLVGAMFTMVDQSSKAAGAYYYYTKQYSSYYQTT
>gnl|bykdb|A0A0Q4LRF1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. Leaf42] (length=740 residues).
MMQQATGGFDTAPDRTIGPRDTGRHAAAAGDDPSLLPDAEDEAGFDPRAIWAVVYRNRLVMILIVALALVLGVVSIMVTP
RIYQARSSVQIDQQVAKVLGTEDSEPATAGGDADRFLQTQVDVINSRAMAKRVSDSLGLAANDAFLESMGGRAKLPVPGE
RRIDQVLDTLQNNLNVDLRRNSRVVGVQFKSRDPALAARIANSYANNFIESNIQRKFSTSAYSREFLQNQLGLAKGRLEA
SERSLINYARSAQLIDASTGARRTGQPDGPQSLVTANLVQLNESYATAAAARVQAQQRYEQARATPLLSLPDVLSNPAAQ
EMLQRRAELNGQLNQLRERLKPDHPTVIQATAQLDALNAQLNQLAGSILASIRNQYLTAQRQQDAIDRQVSGLKSATLAE
QDRGVQYNIFKREVDTNRQLYESLLQRFKEVSAEAGVATNNITLVDSAEAPRRPTSPRPLVNMALALVAGVFLAGLYAFG
RERLDDAIRDPRDVETKLHLPLLGVVPEQEEGDPLVALRDTKSEIAEAYYAIRTSLELSSNQGLPRSLLVTSSQMAEGKS
TTSYALARDFASIGHKVLLVDADLRRPSLHRLMNMSAADKGLSTVLARMTPVEDAVVSTDTDNLSFLPAGPLPPDPANLF
AGTVPADLLAKLGERYDLIVLDGPPVLALADATALASSAAATVIIAEAGGAHYGQVRNAITRLVRAQGHVLGCIVTKYNR
RKSGYAATGNYYRYDYRAKE
>gnl|bykdb|A0A0Q4M1R0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Serratia sp. Leaf50] (length=725 residues).
MSSVISNKPATPDSDEIDLGRLIGELIDHRKLIISVTAVFTVLAIVYALFATPIFQADAMIQVEQKQGNALISSLSQILP
DSQPQSTPEIALLQSRMVLGKTVDDLNLQANVEQKYFPLFGRGWARLTGEKAGQLGISRLYLESVDGKTPKVTLTVEDAT
HYRISGKGVEHEFRGTVGQLLSEKGVSLMVDSIKAAPGTQFDVIYQSRLDAINGLLKVFTVADQGKDTGMLNLTLSGDNQ
VQIKDTLNSISDNYLAQNIARQAAQDAKSLQFLSTQLPQVRGDLDTAEDKLNAYRRKSDSVDLSLETKSALDQIVNVDNQ
LNELTFREADVSQLYTKSHPTYKALLEKRQVLEQEKGKLNKRVSGMPATQQEVLRLSRDVDSGRAIYMQLLNRQQELSIA
KSSAIGNVRIIDDAVTQPQPIKPKKVIVVLIGMVLGALLSIGIVLLRVFLRRGIDSPEQLEELGINVYASVPVSEWLNKQ
NVARTGKLKSKKQVEWGSFLALENPADLAIEAIRGLRTSLHFAMLEASNNILMISGASPNAGKTFISSNLAAVLAQGDQR
ILFIDADMRKGYTHKLFNTGFENGLSDILAGKATIAQCVKPISSVNFDFISRGQLPPNPVELLMHKRFKELLDWASANYD
LVMIDTPPILAVTDAAVVGRYSGTTLLVARFEQNTAKEIEVSVKRFEQSGVEVKGCILNGVVKKASSYYGYGYSHYGYSY
SDKKD
>gnl|bykdb|A0A0Q4M3V0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Serratia sp. Leaf50] (length=727 residues).
MSPAPSQKKIVSSSHEISPGRLIGELVDNRRLIICITTTITLLTLVYILFATPVYQADAVIQVEQKEGNAILESLNQMLP
DSTPQSAPEISLLQSRMILGKTVSDLNLQTVVQQLYFPIFGRGWARMMGHAPGQLAISRLYLPADGSSAPKVILSIIDAN
HYLISGKTFKTKGRVGELVEDSNISIKVDKIDANPGDEFSVKYISEFDAIDNLQNNYSVSEQGKDSGMLSLVLTGTDNLL
LKRILDDITSNYLAQNIDRQAAHDAKSLDFLKVQLPKVRSDLDTAEDKLNQYRQQKDTIDLPMEAKTVLDQIVNVENQLN
ELTFREAEISQLYTKDHPTYKALLEKKQTLKEEKERLNSKVSTMPDTQQQVLRLSRDVESGRTVYMQLLNRQQELDIAKS
SAIGNVRIIDIPLTRPKPVKPKKILLLAMAVVFGGMFAVGFVFIRLMLHKGINSSESLEEHGINVYANIPISEWHLSRLR
SSSKYNDVKKTNISKATRGLLALENPADLAIEAIRNLRTSLHFAMIETDNNLIMISGASPGVGKTFISSNLAEVISQIGR
KVLLIDADMRRGNLHAIFAQDVGLGLSEILTGKAEIDEAVKIARGSNFDYISRGRIPSNPAEILMSRRLEDLLSWASKHY
DYVIIDTPPILAVTEAAIIGQYVDTTLLVARFEENTAKQIEVCINRLAQTGVKVTGCILNGLEKKQGSYYTYGYDNYGIA
YSSQKEA
>gnl|bykdb|A0A0Q4MB57 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Serratia sp. Leaf50] (length=733 residues).
MSEKQDATLAKIEKNSNNLDLGRLYGAILDDRWLVAITVAVMMVFGVIFYFFATPIYSTDAMVQVESTGGNALLSDISKF
LPNAEPKSDAQIKLIKSKLVQFKTIKDLNLDIEHQEHFFPIFGKGWARMTHQQVSSLSINKLDVPSNMLNQLLVFTVTGP
NTYTLSFNDKTLLQGTTGQEQSANNITINVDTLNAAPGSVFTVRKVPMRDAYDRLVDSLSVQDAGIDTGVIQLGIKGENP
ERDQAVLNSIASNYLLQNVERNSQEAANSLAFLKQQLPMVRSELDSSEDKLNAYRMQRDSVDMNLEIRSSLDTMVNLDNS
LNQLTFKEAEISQLYTPEHPTYRALIDQRKVLENEKTALNKKISQLPQTQQELMRLTRNVDSQQEIFMQLLRKQQELGIN
KASTVGDVRIVDHATSEIAPVFPKFGLIEVMAAILGALMAVIFIIMKIMMRRGIEGARELEEQGITVYANVPFATNLSRL
ASIPFINTLGGKNKKAKKSREVLAITDPADLTVESLRSLRTSLHFAMIEAKNDILMITGAVPQAGKSFISVNLAAVIALT
GKKVLLIDADMRRGSAHEYFGFNPRVGLSTVLSGQQSIEEVLHETEIPELQVITRGRTPPNPAELLTSKRFEDLLEWANQ
NYDLVVIDTPPVLSVTDASIIGQIVGTTMMVARFELNTVKEIEVSIKRLEQSGVSVKGCILNAIVRRSANYYSQNYSYDA
FYTYEYKRHIDKD
>gnl|bykdb|A0A0Q4NJY0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Erwinia sp. Leaf53] (length=721 residues).
MPSVSSNKPNTSQSEEIDLGRLIGELIDHRKVIITVTAIITAITIIYAIFATPIYQSDALIQVEQKQGNAILNSLSQVFP
DSQPQSAPEITLLQSRMILGKTVDDLNLQAKAERHYFPIFGRGLARLKGEKPGSISFGRLYLPSESVDGSEFTVTIIDET
HYLAEGEGFSYKGTVGELAGDKNVSLMINQIDAAPGAVFNVSYISRLKAIENLKKNFSVMDNGKDTGILTLSFTSDNPAT
ATKILENISNNYLEQNIDRQAAQDAKSLQFLDKQLPQVRSDLDQSEGKLNLYRQQKDSVDLSLEAKSVLDQIVNADNQLN
ELTFRESEISQLFTKSHPTYKALIEKRQVLEQEKAKLTKRVSAMPATQQEVLRLSRDVESGRAVFMMLLNRQQELSIAKS
SAIGNVRIIDNAVTNPIAVKPKKSLIVIIGFILGLMLSTGLVLLKVLLRRGIESPEQLEERGINVYASVPVSESSVKNTQ
GKLRGKKAKHDTTHFLAIENPADLAIEAIRGLRTSLHFAMMEAQNNVLMISGASPNAGKTFISSNLAAIIAQTGQRVLFI
DTDMRKGYAHKLFATNNDNGLSDILSGSVVVEKAIKKVSGAGFDFISRGQVPPNPAELLMHARFGELITWASTHYDLVII
DTPPILAVTDAAIIGNYVGTTLLVARYEENTAKEIEVSVKRFEQSSVVVKGCILNGVVKKASSYYGYGYNHYGYSYKDSK
D
>gnl|bykdb|A0A0Q4NLV8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Serratia sp. Leaf51] (length=712 residues).
MQKLQGVVKPIRGEDYLVDVRYLWGVLLDSKVLIVVLTAAGVVLALMWGIISPPVFQAEALIQLEKEGTENIFSKLYGLQ
PDDTSSASTEIVLIKSRSVLGKSVEDMGLDIEIEQEKFLNLAKAGARLLGQKNVQVTVPVFNVPEERLDQPFSLTILDEG
RFSLAGDNVAMHGRFGEALNAEGMTIVVSQSDASPGTRFTLTKINPFKAIKNLEKNLNVVESSKDTGMLRLSLLGEDPKT
IRRILSSISDNYVHKSIDKKSESARKSLTFVQHQLPLIKAQLEKAESRLNLFRKERGSIDLPMEARTILDSGVGIDSQLS
ALKVEQSDLSKRYTPAHPAFRALLEKKQALEKAKAALGNKISAMPETQQNVFRLTRDVQSAQDIYMLLLNKQQELNIDTV
STVGNVHIVDAAEVLPQPIYPKNRQLALTGAVLGLVLSIALVFIRNVFRRGISGSDQLRQMGFSVFSSIPYSKKQQGERS
GVSEPLLAISAPDDSAIEAIRSLRTSLYFQLKQAENKILMLAGATSHIGKSFISSNLAVVFAQSDLRVLLVDADMRRGYL
HNIFNVGYAPGLSELLSSGLAFGQAIHHTRVSNLDVMTRGTAPSNPSELLLTPRFPAFCQWASEHYDVVIFDTPPVMAVG
DAMIIANYSGVNLMVARFEVTTPDELDISLTQFAQEGYEVNGVVLNATHRRAAQFFRHGHYENYQYAMNKKS
>gnl|bykdb|A0A0Q4NLX7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Serratia sp. Leaf51] (length=726 residues).
MSPVISKTPASPDSDEIDLSRLIGELIDHRKLIIAITSVITVLAIIYVLFATPIYQADALIQVEQKQGNAILESLSQVLP
DAQPQSAPEIALLQSRMILGKTVDDLNLQAVVKQKYFPLLGRGWARLTGDVPGKLSISRLYVPSGGGDVPKLVITVIDKN
NYRVEGDNIDIKGVVGSLLNEKGISLLVNDIQAPAGSRFNVYYLSRLRAINDLLDAFSVTDQGKDTGILNLSLNGDNQEL
ISAILNSISQNYLDQNIARQAAQDAKSLDFLDQQLPQVRTDLNTSEDALNTYRRQKDSVDLSLEAKSILDQIVNVESQLN
ELTFREAEISQLYTKDHPTYKALLEKRQTLLKERDRLNKSVSAMPATQQEVARLSRDAESNRAIYMQLLNRQQELSIAKS
SAIGNVRIIDTAVTEPKAVKPKKVLIVLIGLILGALISVGLVLLRVFLRKGIDSPEQLEEKGINVYASIPLSEWLTRNNK
SDKKRSLKAKRKTSATNFLAVENSADLAIEAIRSLRTSLHFAMMEAKNNVLMISGPSQSAGKTFISSNLAAVIAQANKKV
LFIDADMRRGYAHKLFKVDIDEGLSSILSGKTSPDKAVKSVPSVNIDFISRGELPPNPAELLMHPRFETLMTWASEHYDL
VIVDTPPILAVTDAAIIGRYVGTTLLVARFEMNTVKEVEVSIRRFEQSGVEVKGCIINSVIKKASSYYGYGYSHYGYAYA
DKEHDD
>gnl|bykdb|A0A0Q4P025 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Devosia sp. Leaf64] (length=712 residues).
MDEQEIDLRAILGVLRRHVRLIVLVVVTVLVITGGVVYSLKPEYTATTLVYVDTARKDLLDPEALAAGSSAADNARVDSE
VEIVRSIPTLLRVIQDANLLNDPEFMPKLGLRQELMAFLRLAEPTLPTGEEALNNLVERLRGAISVQRRGLTYLISINAE
AASPATAARIANATADAYIALQIQSKTQSVLNSLDVLEPRISEATSRLAQSEGAFDTFVEDNVARLSAGDSSNIEALRQQ
LAQATSERQRLGSIVDTANQSLQQLNYEQLASSLQSEAVAGLEQQRTDLLNRINSLEPNSTDAVDLRGSLAQVEQRLQTT
AQQEIQGLQQQVSTFQDEASGLRDQVRQRFLGSDLPPDVLTSIYELQQNSTLARTNYERLVARVNDLRAQADLQVADSRV
VAQATPPNAPSFPNSRLILVLAGLAAVGLGVGLAFVVDNFVGGFTSTDQLETVTRREVITGIPLQRPNKRDDGHIASAAD
LVVTSPLSHYSESLRRVRLRLDQLLAAPRADGRQRRGKVILVTSSLPVEGKTTTALALARTYGVAGQRVLIIDADLRKPS
LHKQLNVESTSGLHEYLAGEISPEESKSIINRDPQSGISVVLSANQSNLPTEHLLTSKTFVQLIEAATQAFDIVVIDTPP
AGVVVDGVYLMQFADVILFLTRYASTTQREVLNALKTIDRSKVEDTPLVLAMTQEPGNARSYNYKYSSYYAD
>gnl|bykdb|A0A0Q4QQY3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. Leaf242] (length=743 residues).
MASPGAMGPTNLTVQPDQRRELAAISKESGYGGYGTTNSGRELSLALLWRIAVEWRWLILAAVGTGLALAVLSTLLTPLK
YRSTTSIELNPPQVEIMANEDSKSGRQSSTRNDTNFVGTQLALLGSRALAERVAQNLNLAANPAIVGESTDRTANTETAA
RFVQGGTQVKLQPQSMIVSVSFVARDPQIAAKVVNGITDAFIATNLERRYQSSSYARDFLQRQIATTRRDLEKSERQLTS
YAQQQRLISTGGSEEGGDTNSLTGSSLVSLNTALAATQARRIAAEQKYREAALGGATTEGSSNAAPLRAQIAALDAEYQQ
KLQTFRPDYPEMMALKARIDALRASVVSETRTANSDRIGTLRQDFQAARAEEDRLRAQVSGLSGSVLEQRGRLIQYNILR
RDVDTNRTLYDALLQRYKEIGVASGIGTAVASVVDRGLVPGGAFSPNLYLNLLIGAVLGFVVGMLAAIALEFINDTIKTP
DDVRNKLQLPFLGGIPTAKSAKPVEELKDTLSPVAEAYLSTASAMQFVTEGGAPKTLLVTSTRPAEGKSTSAWALAYSFT
RLGKSVLLIDADMRRPAFVTGRDNIGLSHILTNTGSLSEHVLHTDVEGLWIMPSGTIPPSPPELIASARFASLLADASAT
FDVVVIDGPPILGLADSPLLSSIAQATLMVIESGRTRTRAIVEAQNRLRTAGAHMVGAILTRFQAQASYGYGYGYGQTKD
QYRYVADDNDKKRRIMLTMHDEP
>gnl|bykdb|A0A0Q4URF3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. Leaf257] (length=708 residues).
MNPLVPVDQDSAKIIDFGAVLNAVRRRLIPILITMIIVLGLTALSYKMVTPRYSAEGQVGIQRTNEEIVNAQEDQRVQPL
TTDSSSVDTEVAQILSPETLGRVVDRLGLAKNPNFVGTDPLSPADARNAAIRAIAGGLTATRDGTSYAINVNYLSTDPVM
AAKIVNTTIDEYLTRQQVEKRDERNKEIALLASRINEARGQLQGAETEVARFRAATNLVDIQNQSTNAQQSIAVLNQQLA
DAQAQQAVAEARNTARSASSAGAGSAVVSPVLQQLRTEEATLSAQQASLSERYGDRHPQVLETNQRLQETRRQIAAETAR
VRQSLSAEADVARRRTSSIVSSLDAQKGQLLQGNAASVRLAELERKATTLKSLYEALLERYQQAIARQGTERSAGYVIAR
AVAPTAPVSPKKVVFAGGGLLAALLAAAMVAAGLELAENGFSTRRQVERALGLPVLASVPDLRTLKRDRIKSPTPATISQ
HLIDHPGSVYSESYRSIRTALKVGREEQAARVVAISSALPAEGKTSTSFSLARSSALAGLSTVLVDCDLRRQATSRQMEG
AIQYGLADLLRGEATLDQVLVRDSASGAFLLPQRPSTAENDYDLIASSAMQQLVDQLRERFDLVILDTAPLLAIADSRAI
ASMADVALVAVRWRKTPAPAVRLALDHLAMAEARIGGIIMTMVDLKAQSRAGAGDELRYYKKYSSYYS
>gnl|bykdb|A0A0Q4WAM0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhizobium sp. Leaf262] (length=782 residues).
MHHKTFKSNMNFQDQSKDSDTFIDLDRLWAAVLRRANVIAACVIATMILAGAYLVFATPVYTAMTQVLLDESLSRYAEDE
TPVPAAQVIDNRIASAVEILKSKEMALTVVDKAALDQNDTIINPPMSPADLVKSSVKGIVDLLTPSSTPASEEAIRNGRR
EKAAAVIQQALTVERVGRSSVIAISIRSTDRQLATQIAKTYANSYLTEQLNANFDATERASVWLQERLTDLNQRSQAASL
AVEKYKAANNIVSSRGELMSESQLSDLNGQLIAAQADAATASARYTQYKSITDQGPDNAVNNAIVSARDTDNSVIQDLRK
RYIAISDRERGVVQQFGKDHPQAVALEAEKGDLARQIFQELQQLTGSFKNDFDVTQSRVQSLRESIDRVAGRNSEANMTM
VKLRELEQQAAALKTLYESYLGRFEEASQKQSFPIAKARVISEAGLPTSPSSPKKTMTMALSIVLGLMLGGGVAAVLEFR
DRYFHTGNDVRDNLRMRFLGYLPFIGEKGVDTGKSETGAATPEIPDSNIEDIGQVSFQKMLRLAVDSPRSSFTETLRNVK
LTADVVIQEKQCRVIGVISCLPNEGKSVVALNLAGLIATTGKRTLVVDADIRNPGLSRMLTTRQSAGLVEVVLDEVPWTK
AVKVDSRTKMGILPVSTSNQFAHSSELLASSGMRKFMDSAREACDYIIVDLAPVVPVIDAKAFASQVDGFVFVTEWGKTP
IQMVQNLMSHEPQIASKTLGIVLNKTDMTELQRYAGPGGSEHYHDQFSAYYGDAKKPVTEPA
>gnl|bykdb|A0A0Q4YQC9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Methylobacterium sp. Leaf104] (length=748 residues).
MLKLLDQTRPMPEEPQERPAKKLDLKDMVMILRRQWPVILACTLVGMFLAVGYVATSAPRYTASVKLLIDTRKNNVLSKQ
EVNFGGPVDAGAVESQVEILKSEGVARSVIRDQQLLKDPEFVGSGSPSLIGSLLSLFSWDDSEPAVRSQEDIERDAIQAF
VRRVTAKRVGLTYVIQVDVQTTNPEKSARLANAIADAYMVGELDAKFQATRRASRWLQERITELKAQATQSDLAVQAFKS
ENNIVDTSRGLMSEQSLADVNSQLIQARAVTAEAKARLDRVREISNGNLPDATVADALRNDVINRARAQYLDAARKEADW
SAKYGPQHSATVNLRNQMEELKRSIVDEVRRIAQTYESDYNIARAREVSLETSLSKLVDQAGTSSQAQVKLRELESSSQT
YRNLYDSFLQKFEEATQQQTFPITDARVITPATEPSGKSGPKTMLIVPAGTIAGFMMGVVAAIGLELLNSFFRTPAEIKQ
QTGLECIGILPSVPDSGASLPSAINVTSKVALGKGSRFRHVVDTPFSRYTEVLRNVKVSIDIARLGREVRVIGLISSLPK
EGKTTVAANLAELVAQTGHRVLLIDGDLRNPTLTRNLTPHAEVGVVEVLRRAVGLADGVCRDTETGLDFLPAVVPQRIPN
TAELLSSMAMAQLLSDARGTYEYVFVDFAPIMSVADAKAAAHLIDAFVYVVEWGKTSQHAVVEALSNAGAIHERTLGVVL
NNADIAALKRLEFYKGRYYSDYYHEEAA
>gnl|bykdb|A0A0Q5CSU1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhizobium sp. Leaf306] (length=752 residues).
MQGDDVDLERSVQGIDFDAVLAIARRQWMIVAAAVAAAIVLGLAYIFTAVPLYTSNVSVLIDQGNREVVQQLSTIGGVVD
DEGSVLSQVELLKSDTIAMSVVDKLDLTNDAAFASAGGSVIGTMVGTLRSLANVSSWFVVEPETSDQVEAKRRTAANTLL
WNMEISRVGRTYVLSISYTSPSSSLSAKIANAIGEAYLVDKLNSKYEATRRASGWLQDRIAELRQKALDSDLAVQKFRSS
NGLVAAGSVLVADQQLSELNSALIVAQSDTAKAEARLQRIAQIIASGQGDAIVTDVLDSSISNELRQKYLDASKREAQIS
DRLGVNHIQAIRLRSEMTEYNRLMFEEVNRIAESYKSDLNVAKAREKSLTDSVAQATGISATASETQVQLRELEREADTY
KNMYQTFLQRYQEAIQQQSFPVTEARIITRAAAPDSPSHPRKPLVLALFVIIGAAVGSGLGAFREFRDRFFRTGEQVRDV
LNLEFLGIAPIVAPAKAVDAPDSSDGRGIGQVRKTHAVSNYVIDHPLSAFAETLRSAKIAADLALTGKSCKIIGVVSSLP
GEGKSTIAVNFAELLAGQGNRTVLIDGDLRNPGATRAIGRHAESGLLEVLIDNRDPQSLFLRNDRTKLAFLPAVVRHRIP
HSSELLSSARMRQVLADISNTADYIIIDLPPLGPVVDARAIAGRIDGFIFVTEWGKTARRVVRQVLASDPYVRDKCLGVV
LNKVDQERMKLYRAYGSSEYYYSRYSQYYQEG
>gnl|bykdb|A0A0Q5D3V5 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhizobium sp. Leaf306] (length=779 residues).
MDQVNYRPMNIFPNEQKETDTFIDLDKLWSAAMRRLGVIIICVVAMVALAAAYLFTAQPKYTAATQILVDDNLSRYAEEE
TEGQTAQQIDNRMSSSVEILKSKALALSVVDKGKFAENDLIVDPPKSPVDLAKDMVKSVVSLVSSGGPLPSEDQVRAGRR
EKAAAILQQSITVERVGRSSVISLSVRSPDPVLSAQLAKTYASSFLTEELNANFDATERASVWLQERLNDLNIRAQQASL
TVEQYKRDNGLVSPRGELMSAQQLSDLNTQLISAQAEVASAQARYNQYKVIIDKGSEAAVANAVVANRDTDNTVLQNLRQ
RYTMVNDREKGVVEQFGADHPQAVALRSEKQDLAQQILRELQQLTGSFRNELDVASSREQSLRASIESVAGRNQDANVSM
VQLQELQQRADALKTLYQSYLQRFEQASQLQSLPIAKARVISEAGVPISPSSPRKTLTMALSVVLGLLLGGALAALLEFR
ERFFRTGADVQDKLGVRFLGYLPKIGSAQTDDNGSDKPADAIDGQILPEGDPIALRRKMRVAVEAPRSQFAETLRNAKLA
ADIVLQGRKCSVIGVVSCLPGEGKSMVAANLAGLISSNGVRTLVIDGDLRNPGLSKMLASEPDVGLIDVVLQKVPWTAAA
RVDRRSRLTILPMTTRSRQLAHTSELLASTGMSQFLESIKDTFDVIIVDLAPLIPVIDAKAFEPYVDGFIFVTEWGVTPV
KAVQSVLQSEPQIAAKTIGVILNKTEMGELRKYADPGAPERLHSSYSSYYKDAIPGVPR
>gnl|bykdb|A0A0Q5E7X8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Methylobacterium sp. Leaf125] (length=723 residues).
MPSGGFEIATYVKIAQRQWPTILAVAVPLVMLALIYVLTAQPKFTAYATLLIDTRKNQLLSSQQQVVGDQVFDSTGVESQ
VEILKSDSIALAVIRDLKLVDDPIFADGGLIRSIINLFGSDEPATAAEKEQATVAAFERNLQIKRVGLTYAIEISYTSID
PVKSAAIANAIADAYATTELESRYEATKRASKWLQDRIRELREQATVAEAEVQKFRADNNIIDTGRGLLTEQQLGDVNSQ
LVSARAATAEAKARLDRINQVSKEDIPNATVTDALRDDVITRLRAQYLDLSARQADFSNRYGATHASVQNLVRQMTEIRR
SIRDEVNRIAETYKSEYEIARTREKSLQDSLASLVTSAGTTGQAQVKLRDLTSSAQTNRNLYDTFLQRFMEATQQQNFPV
TDARLISAATPPKRKSSPKTIIILPGALALGLLLGFAAALGREKLGARVFRTAADVESETQVECLGILPNAARLPAAPIP
ATAGLLRNAMARQAVDAPFSRFSESLRAVKVAADISAMNRQSRVIGIVSALPNEGKTTVVANLAGTIAASGRSVLVIDGD
LRNPSLTRLLAPEAREGLIEVLSGSRSVADVVQVDSETGFRLLPAVLNKRMWQTAELLSSEAMASVFEAARRQFDYVLID
LPPVLPVVDVRAVSSMIDCFVMVVEWNKTSRQAVAEALDGTEFLRDRLLGVILNKASPAQLQRLEGYKGAYYTSYYHERP
EAA
>gnl|bykdb|A0A0Q5EMS0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Pseudomonas sp. Leaf127] (length=737 residues).
MTVMNRTSLDTPQDTRIDLATLLRTLLDHKRLILWMTGVFMLIGVLYAILATPVYQASAMIQVEPRKVGIEGIPEVSNKP
MSASQATTEIELIKSRALLGKVVEDLRLNVETEPDRLPVIGPWLFRTFAPEYAGQLAEPLFGLEGYAWGGEKLDVFQLEV
PEALLGEKLKLVAGKPGQYALYDPDGHLLLNGTVGRSEGQGIKIQVATLNARPQTGFTVIRQRNLSTALAWQERLKITEA
GKDSGIIYLLLQDPDPLKANAVLNEVSRLYVRQNVERSSAEAAQRLEFLRSQLPMVRKQLEASEAALNTFQTSSRSVDLS
IETKGVLDQVVELDKQLSELKLKRVELERLYTREHPTYRSLMSQISQLEAQKQGQMRKIDALPQAQQELLRLTRDMQVIS
QTYTLMLNKSQEQDILRAGSIGNVRIIDNADSNVEKPVKPMKKLVVLIATLLGALLAVAIIFVRQAFYRGIENPEVIESL
GMPVYASLPYSRQQERLDKAATGHGAPRESRLLSTRAPEELALESLRSLRTSLHFAMLEARNNVLMITSPLPGAGKSFVS
ANLAVIIAQTGKRVLLIDADMRKGYLHKVLGVQSRHGLSDTLAARLKCLEVINRTEVRHLDFISCGFAAPNPSELLMHDN
FNKMLSELSPLYDLIIIDTPPILAVTDGTLVGRQAGTCLLVARFGLTTTKELEACKRRLNQNGILIKGAIFNATIRKAST
AEYDCTTYGYSYHPVRK
>gnl|bykdb|A0A0Q5F715 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhizobium sp. Leaf311] (length=782 residues).
MHHKTFRSNMNFPESSKDADTFIDLDRLWAAVVRRANIIAACVIAAMALAGLYLVMATPVYTAMTQVLLDESLSRYAEDE
SPVPAAQIIDNRIASAVEILKSKEMALTVVDKAKLDSNETIVNPPMSPVDLIKASVKGVVDLLTPNSPPASEDAMRNGRR
EKAAAVIQQALTVERVGRSSVIAISIRSIDRQLATQIARTYANSYLTEQLNANFDATERASVWLQERLTDLNQRSQAASL
AVEKYKAANNIVSSRGELISEGQLSDLNGQLIAAQADAATASARYTQYKSIVDQGPENAVNNAIVSARDTDNSVIQDLRK
RYIAISDRERGVVQQFGKDHPQAIALASEKGDLSRQIYQELQQLTGSFKNDFDVTQSRVQSLRENIDRVAGRNSEANMTM
VKLRELEQQAAALKTLYESYLGRFEEASQKQSFPIAKARIISDAGLPTSPSSPKKTMTMALSIVLGLMLGGGVAAVLEFR
DRYFHTGNDVRDNLRMRFLGYLPFIGEKGVETTRAETGAATPDVPDTDIEDNGHVSFQKMLRLAVDSPRSSFTETLRNVK
LTADVVIQERECRVIGVISCLPNEGKSVVALNLAGLIATTGKRTLVVDADIRNPGLSRMLTTRQSAGLVEVVLDEVPWTK
AVKVDSRTKMGILPVSTSNQFAHSSELLASSGMRKFMDSAREACDYIIVDLAPVVPVIDAKAFASQVDGFVFVTEWGKTP
IQMVQNLMSHEPQIANKTLGIVLNKTDMNELQRYAGPGGSEHYHEQFSAYYGDAKKPAPEPA
>gnl|bykdb|A0A0Q5FA12 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhizobium sp. Leaf311] (length=748 residues).
MHQQGSFLDVESVIAIARRQWKIVAISVAVAAVLGIVNILTAVPLFTANVSVLIDRGNGQLADQLSSIGSAGGSLMEDES
SILSQVEIFKSDTIASAVVDKLDLTNDAVFMADDRSAMVQLIGTLRSLLNVSQWFVSASAVADDAAAKHFAAERKLAENL
DVSRVGRTYVLNVQYTSPSPELSSRIANTVGDIYLVDKLNSKYEATRRASDWLQNRIAELRQKALDSDLAVQRFRTTNNL
VSAGSVLVSDQQLSELNSALIVAQSETSKAEARFQRIQQIIASGQTDAIVTDVLGSTISNELRQKYLDASKREAQISARL
GPDHVQAVRMRSEMSEYQRLMFEELNRIAESYKSDLDVAKAREKSLSDNVSQATGISASANETKVQLRELEREAETYKNL
YQTFLQRYQEAVQQQSFPVTEARVITRASPPKSPSHPKKTLILALFIVMGGAVGTGLGAFREIRDRFFRTGDQIRDTLKL
EFLGMTPMISGQRLPAFSGSKLPAGELFKTNSVSNYVVDNPLSSFAETLRSAKLSADFGMVGKECKIIGVVSSLPGEGKS
MTSINFAQLLADQGNRTILIDCDLRNPGATRAIGSHAEAGLLEAVLENIDPRKLLLQDPKTGLAFLPTVIKHRVPHSSEL
LASPAMRNILTHLSHNTDYIILDLPPLGPVVDARAMASRVDGFLFVVEWGKTARHLVRQLLRDEVEIRNKCLGVILNKVD
QRKLKLYRSFGSSEYYQSHYTKYYQDAA
>gnl|bykdb|A0A0Q5FXC4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Acinetobacter sp. Leaf130] (length=727 residues).
MNQNTNTEDTIDLKELFFSLIAQWKLIALCIILSLVCALLYLRVTPDTYSVDALVQVEDSKGASAALLGDLSNMIEQKSP
AQAEIEILKSRLVLGSVIKDLHLNIQVSSTENTLTHRLLSDTDYKTEYTKKSVLFKDDLKSFEIREFEVPAYYLDKNLFL
NFDKQSLRLTDPETEEVILTVPLNQANHVAGPHGLWKVAIFTKDQLDPTYNIKNLSIPATVNALSLNYSVAERGKLTGVL
GLNYQGQDKEHITKVLNAILATYSAQNIERRSAESAQTLKFLDEQLPDLKKQLDDAERQFNKFRQQYNTVDVTKESELYL
TQSITLETKKAELEQKQAEMAAKYTADHPAMREINGQLSAVNKQIGELNSTLKQLPDVQRQYLQLYREVEVKTQLYTALL
NSYQQLRIAKAGEIGNVRVVDTAVEPVEPIKPKKLQVLILSLFLGSFIGTLIALLRNMLRTGIKDSGQIENELDLPVYAT
VPRSPIQESRVKILKKKKNIPILAVKNSDDIAIESLRSIRTAIHFALASAKNNIIMIAGPSPEVGKSFISTNLATIFAQG
DKRVLLIDADMRRGYMHKYFDVDVKPGLSELLSGQADLQKVLHKTQVANLDVITRGKSPTNPSEILSSNQFKELLEQLQS
QYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSQMKELELTLNRFEQAGVKVNGFILNDIQRASAGYGYGYNYAYA
YKAQKED
>gnl|bykdb|A0A0Q5H012 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Aureimonas sp. Leaf324] (length=752 residues).
MAAHDTAASKAGKGSSGEFLNVERILAMVRRQIGIVIAAVVVGIAVGLVFLITAVPTYTASTDILIDKGQSKLVDELASA
SGVFQDEAEMLSQVELLKSQQIASAVVDQLKLDQNDAFLAGSPSLIRSARAAVGKLIAVMRPELPVEEADMAARRREAAI
DILQGGLDVQRVGRTYVLRLTYESPDPALAANIATAFGSAYLDDQLQAKYTATRRASTWLQDRIAELRQQSYDADLAVQK
FRNENGLLQTGTGLVSQQQLSEINTQLTAARAQTAQSKAQLDQIEQIIKDGRTDALVNDALVSTTINTLRAKYLDAARRQ
SEIASKLGPDHIQAVRLRAEMQEYERLIFGELRRIAESYRSTYAVSQERERSLEASLSEVTAVNADDNTLQVRLRELERE
AEAYRALYDDFLQRYQQTVQQQSFPITDARVISTAQVPDKPSAPRTPLVLALFAVMGAAAGAGIAGFREYRERFFRVGSQ
VRSELDMEFLGFLPILDPADAKTGEQKATPSQIWGPGALATHVRRHPMSSFAETLRNIKVAADLGMPDIPCKVIGVVSCV
PGEGKSSVAASFGNLLALQGMRTLLIDGDIRNPGLTRSLQRKPELGLVEVMLEQAEVDDVVLRDEPTPLALLPTVMRSRV
TNTSDLLASASMGRLLQRFRGQFDYIVVDLPPVGPVVDAKAFAQRVDAFVFVVEWGKTSRQLVRSAIASNPVFQTKSLGV
ILNKADSKKMRLYRSYGSPEYYASRYESYYRD
>gnl|bykdb|A0A0Q5ME60 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Brevundimonas sp. Leaf168] (length=730 residues).
MTHYDTAIGGPGQPADDAIDLHALIAAFRRRLGLFTAIAAGVFLIVLALMLGQPPVYTATASLQINTRKEQVVAGQAVLS
ALDAEAAIVDTEVEVLKSPQLAAQVVQTLDLIRDPEFNARLRSSPLTRRLPRATPAATDPQIERQQVIDAVRRRLTVRRV
GLTYSMAVSVTSESPIKAARIANAFADAYLQSQLTAKFDANAQANTFLGARLEDLRRQVEAADAAVSAYRIENGLLSAQG
ATLTEQEISAYNQQLALARAQQAEQDARLRTARAQMAAGSNGDDVGEALSSPVVQNLRAQRAAISTRVADLSVRYGPLHP
DMIRARQELSDIDAQIQAEIRRVVSNLDAQAQVARQRAASVQSSLDAARGALADNNAASVRLRELEGEAEAARAIYRAFL
DRYRETSAQTGVEQADARIVSRATPPTAQSAPNLMISLALGLMLGAAAGNGAVIIANATQTGLSGPDDIERRLSVAAVGA
VPLASSVATAEDQTLHPIDLVVQRPLSVFAEAFRALRTSITPIVSVVGEPSARIVAVTSALPGEGKTTTAVCLARVAARS
GGRVLLIDGDPRRRGVTRMLGLNPDHGLAEVLHGAAAWRNVSVLDPDSGAQVLPLSGSGLSADDLFGAPPMNALLNELRQ
AFDLIVIDTAPVLVLADARILAVKADTVILLARWRKTPARAVAAAIRILSQSGVRLSGVTLSQIDVRAEAGLGYGQADYD
YRAYRKYYAA
>gnl|bykdb|A0A0Q5NZQ1 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia sp. Leaf177] (length=798 residues).
MSTYEMLEHSPAQAKDDEFVLRDLVRMITDQIWWVLGIALGILLAAVLYAKLSTPIYSADALVQVDTPNTAAPANNQGSL
SAALAPTGGSLHADSEIEIIKSRAVIEPVVDQFNLNFSTASNVMPFIGRITPLFARNGHPLPALFGLDTYAWGGEAFKVD
SITVPAAMQDQRLTLRALGNGRYALLDADNHELLQGLAGSMAKGNGITLLVSQLVARPGTEFYVTRASQLEAVQAFGSGM
QVGEKGKDTGIIQISYSGSQPLYITQVANAIAASYLKQRTERAQEEANRMLTFLNNELPRVRDELHASETALAQYQTTAG
SFQPTQEAQTYLSGGLDYERQIAALRMQRVQLLQRFTDGADEVRAVDAQLAALNVEKSRFDNQFKTLPGSERQAVSLQRE
AKVNSEIYVALLNKTQELSISRAGTVGNVHIIDMALVPSQPVKPKAALIIAAGGLLGVIAGVVFAFVRRSFFAGVDDPEL
VERRFNLPIFGAIPFSTEQARLDRVRLDRPMALPSSSAKGGMKRLGTQTVGDSMGTTLGLSTKTPVAMALQNATVLPAAN
VGKQPLLSTTHPFDTSIEGLRGLRATLQFALVDAPNRVIAITSPAPGDGKSFLAANLAALLAESGKRVLLIDADLRRGRL
AHYLGKSSNGGLTELLTGQTDFEMAARETGVNGLHFIGSGAHPPNPSEILTSSRFASLLQAFEKQFDLVIVDTPPLLAVP
DAAVIASLAGSTVLVMRSGAHSEKNIADALKKLKRARARIVGGVLNAMPAKSGGRKGTYDYAYAYTYSSDPSAVDVKH
>gnl|bykdb|A0A0Q5P3B8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia sp. Leaf177] (length=748 residues).
MLNLMRDHIWEILVATVVVVALAVAYIFIAPPVYSADVLIRVDAPEQNQLGIALQNQETLPPPAPAPSAEMAVMRSRSVL
EPVIEKYRFDVSVTPHTFPLLGDIADKFATPGEPSAPWLGLKSFAWGGERVQVGSLDVPQSLEEEKLKLIALDGGRYELR
GPSNELLVSGMVGVPENANGVSILMKQLVARPGTSFEVIRWNDLDAVKRFADTIKVSDKVKDSGLIEIEYADKSPAKATE
VTNALAAQYLAAAVASRQSNDTKTLAFINGELPRLLTDLRKSEEALKSYRSTANSMQPTAEAQSFLQGGIDFDRQIATLQ
LQRTQLLERFTPTSRWVQNVDTQLAQLNKAKGEFDGRFRSMPSSERQSVDLIRAQKVAETIYLGMVQKAEQLTVRRASTS
GGAHVVDSAVRPHRPVKPNRPAVLGGGVVLGLLTGVFLVFMRRHVMIGVTDPRFVERRLSVPVLGEVLFSHQQMRLDPSS
AGVPKKALPPAMKPGLPFPRAEPVGDFSDGGTLDSMGSRVLAARFPHDPSVEALRAVRTALTRDLAHAPNNIVMVTGPTP
SAGKSFVAANLAVLHAETGSRVLLIDADMRRGHLASFFKQRNRGGLAEVLSGRLPVRNALRSVGVEGVSFLSCGVRPTNP
AALLMQSGFKELLDRLSKQFDLVIVDTPPFLAVTDASIIASEAGSSLLVLRSGMQSEEEISDTVRKLARAEGRIAGAVFN
GIPLKRSNRGYGYATNYASDHGDVETVH
>gnl|bykdb|A0A0Q5P8E6 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia sp. Leaf177] (length=743 residues).
MAINFENRYADVVSTGDELRLSDYLAAILGSWRIIVMVTLAVLLLGTAYAFIAPPVYRADAMIQVTESQAGANNNNNANA
VQTVSQMFDAKSTTAAEIELLRSRLVVEDTVNKLHLDITARPRYFPIVGGLIGDILGARNGQAPVSWLSGFAWGNESISV
PKFDTPKEAYDKTYILTAGEGGSYVLSDPDGIAILNGKVGQEANGSSALGPVSLLVEQMNGEPGAKFELTRASTLGTVDA
LQKRLTVAETTLQSGIIALSLEGHDAKLTSQIVNNIARRFVQQDMDTRSAEAGKTLAFLEQQLPELRTQLDQAEQKYNTF
RNKQGTVDLGEESRLLLQQVVDNKTKLMDLQQQRAELSQRFTANHPSVAALDAQIGALQAAQGSLTKNVSVLPDTEQTAL
RLLRDVRVNTELYTNLLNSAQQLRVAKAGQVGNVRVVDFAEAADDPVRPKRLIVILISLGTGLVLGIIVAFIRKSLFGGV
ERPEEIENRLGVRVFAIVPRSNQQLRLQQKVGSRSQGLHVLAATSPEDAAVEGIRGLRTSLQLQMADARNNVVMLTGSRP
DAGKSFLSVNLATLVASTRKRVLLIDGDMRRGDVHSHFGVRHMPGLSDVLMGSDIEAAVLHDVLPGVDLLTKGSLPSHPS
ELLMSDRMHEVLEFLKHKYDLVIIDTPPVLAVTDATVIGKHAGTSLLVVRHGRNQVEEIGETMKRLQHGGVNMKGVLLTD
VPQSKLMSGSSYTNYYGYESIPE
>gnl|bykdb|A0A0Q5PG86 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. Leaf343] (length=709 residues).
MVLAPPPLLQYWQIVLRWKWIILGIIAAAFTVGLIVTLLTSPQYSATSRIEISREQKKFTNVEGVDSPISDRDLEFYQTQ
YSLLQARSLAERVARTLRLSTNEEFFAAHGVDLSGSLFTSGAAQKSGAAETARREKMAVDLLLDHIAVSPVRGSSLVDIR
YVSGSPTISAQIANSWTQQFVAQSIDRRFASTTDARQFLEGRLADLRVKLETSERDLVNYAAQKGIVALGRTKDADGRTQ
VDRTLVSSDLEALNAALATATAERIAAESRAHQQSGGANADALSNPTINDLRQKRTEIAAEYAKLMVRFEPDYPSAKELA
QQLRTVDAGIAREESRVLNSRSSDYQSAVLRENALRRRVEQLKSGLSRQQQDSIQYNIYQREADTNRQLYDGLLQRYKEI
GVAGVGANNIAIVDPARVPDSPSSPNFLINLALALVAGLGLAAIATFALNQIDEGLRDPTQVGRILQVPLLGSVPTSEGS
DTLTELQDTKSALSEAYLSIRSNLAFSTDHGIPRALMVTSTRASEGKSTTSFALAMVLGRTGKRVLLLDADMRSPSMHSF
AGLPNVTGLSNYLAGADNWHETLLETPSRGVTLMPSGPTPPSAAELLSSDRITTLIRQASEQFDHIVIDSPPILGLADAP
LLTRAVEGIVFVVEADGVPIRGIKTSLARLQAVHAHVFGVVLTKLQSRLSSYGYGYGYSYGYGSNDRDA
>gnl|bykdb|A0A0Q5PIA4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia sp. Leaf177] (length=748 residues).
MRQASAGEPGFDHTEQARIASILDALIQYRVMIIVTTVIFVVLGVAYAFLSPSIYEASVLIKVDDSAGGASRQDGNEIIN
NISPGFDEKSSAESEMQVIGSRFIVARAVEARNLSVYVKPHYFPVIGEWLARRADSLSEPGLMGTGGYVWGNESVKVSAF
EVPQKMLGENYTLKALSDGSYSLSGPGLPEQGATGRVGELANFETGRGPIALRVDALNGRSGATFDLKRESRQLTIDHLQ
KSVKIKEQGAKSSVLKVSLESPDAVRASDTINEIGRQYEQWNAARKAVIAKNSLDYLQSQLPTMARQVREAEDAYNNYRN
GHALLDMNEEARLLLQRSADATTQMIDLQRRRDTLMATFSRTYPTVISLDKQIAAAQRYIDDLSLQVKAMPTEQQGAMRL
MRDVRVNTDLYTALRNNIEQLRVIQAGKAGSAQLIDIADVPERPVKPVKWLVILVSTVFGMFAGIGLALARDYIFRGVTD
SREIEVATGLNVVATIPQSAKQEMLDRKMKEKSYENLLLASIDPKDPSIEALRILRSALQFALIGARNNVVMLTGPLPGI
GKSFLSVNLAALFASGGKRVLLIDADLRKGRVHRYVGLTPGVGLSDVLADTCALDAAIAQDVLPRLDVLQTGPYPADPSE
LVMLPRFREIVSTVSARYDVVIIDVPPVLVVSDAGIMVPAAGLLFLVARFADTRSGELEESIKRLAQTGAKVNGVLLNGT
NMNTTDYALARRYGSRSYAAYDYGGPSH
>gnl|bykdb|A0A0Q5PJH9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Burkholderia sp. Leaf177] (length=741 residues).
MVSTPAHSYQGKTEEEDVVLGQLLQVIIDDIWWLIGIAAFIVIAASAYCYVAKPVYSADAHVRVEQSDNTSQALTQTQTG
AAIGNSSGALPTDAEIEIVKSRGVVAPVVAQCKLNFSVTPMTVPLLGSLAGRLATPGKPSKPWLGMTSYAWGGEQAAIDS
IEVVQPLEGQKLTLTALASNRYSLATPDGRQLLEGTVGTMESGNGVNINVSKLVARPGTRFTVIRANDLDAIASFQSGIT
VAEQGKATGVIQISLENGDPARAAEIANALADSYLHQHIESKQADAEKMLAFLKSEQPRLKGDLEHAEAALTEYQSKSGS
INASDEAKVYLEGSISYEAQISGLKLQIATLNQRYNSAHPALIVAQQQLSQLEAERARFGERFRNLPASEVKAVSLQRDA
KVAEDIYVLLLNRVQELSVQKAGTGGNVHIVDAALRPGAPIKPKKVLIMSAAVILGLILGTGFVFLRRAMFKGIVDPDKV
ERLAGLPLIGLVPLSGEQVKLDAEAKRTERDRDRVLPILATMRPNDVCVEIMRSLRTSLQFTLMEARNHTVMLTGPASGV
GKSFLAVNLAVLLAASGKKVLLIDADMRRGKLERSFGLERANGLAELLAGTIGLEQAIRSTRTPLLSFMPAGKRPENPSE
LLMSPRLQQYLDGLGRVYDVVFIDTPPILAVTDASIIGKLSGTNFLVMRSGAHNEMEISDAIRRLRTAGIPLAGAIMNGM
AQRSRGYNRGHYSAVEDYLNV
>gnl|bykdb|A0A0Q5RG60 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. Leaf357] (length=745 residues).
MASSGPAAPTNLTVTREQSRDVAVPFAGAGYGGYGTAKSSRELSLALLWRVLVEWRWLILAAIGIGLAGAVLVTLLTPLK
YRSVATIELTPPEIEVISGEGSKGGRQTSAMRDVNFIGTQLGLLNSQALAERVAQDLNLASNPKVVGKGTDRTQNTKIAA
SVVQSGTKVKLRPQSQLVDISFTARDPQLASVIVNGITDAYVSTNLERRYASSSYAREFLQRQIVNTRRELEKSERQLTA
YAQQEGLITTGSSDTGGDTNSLTGSTLVALNNALGATQAKRIAAEQRYREAVLGGATTEGSANAAPLRAQIAALDAEYQQ
KLQTFRPEYPEMVALRARIDALRASVTSETRTANSDRVGSLRQEYQAAQGEENRLRAQVAGLSSSVLDQRGRRIQYTILQ
RDVDTNRSLYDALLQRYKEIGVASGIGTAVASVVDRGPVPSGAFSPNLYLNLAIGAGLGFILGMLAAIALEFINDTIKTP
DDVRDKMQLPFLGGIPNAKLAKPIDELKDPLSPVTEAYLSTATALQFVAEGGAPKTLLMTSTRPAEGKSTSAWALAQSFT
RLGKTVLLIDADMRRPAFVTGKDEVGLSHVLTNGSSLSEHVLQTEVEGLWIMPAGTVPPSPPELIASARFASLLADAAAT
FDHVVIDGPPILGLADSPLLSTMVQATLMVVESGRTRTRAVVEAQNRLRTAGAHVIGAILTRYQAQASYGYGYGYGYGQN
KDQYRYVADSNDKKRRIMLTTKNGD
>gnl|bykdb|A0A0Q5URR7 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. Leaf198] (length=743 residues).
MASPGAVGPTNLTVQPDQRRDLAPLAPESGYGGYGTTNNSRELSLSLLWRIAVEWRWLILAAIGTGIAAAVLITLLTPLK
YRSVATLELNPPEVEIMADEGNKGGRQSSGRNDTNFVGTQLSLLGSRALAERVAQNLNLAADPAIVGESTDRTANTEIAA
GFVQGGTKVKLQPQSMIVIVSFVARNPQLAAKVVNGITDAYIATNLERRYQSSSYAREFLQRQIATTRRDLEKSERGLTT
YAQQQRLISTGSSEEGSDTNSLTGSSLVSLNTALAATQARRIAAEQKYREATLGGATTEGSANAAPLRAQIAALDAEYQQ
KLQTFRPDYPEMVALKARIDALRASVVTETRTANSDRVGTLRQDFQAARAEEDRLRAQVSGLSGTVLNQRGRLIQYNILK
RDVDTNRTLYDALLQRYKEIGVAGGIGTAVASVVDRGLVPGGAFSPNLYLNLLIGAVLGFVVGMLAAIALEFINDTIKTP
DDVRNKLQLPFLGGIPTAKSAKPVEELKDTLSPVAEAYLSTASAMQFVTEGGAPKTLLVTSTRPAEGKSTSAWALAHSFT
RLGKSVLLIDADMRRPAFVTGRDNIGLSHILTNTGSLSEHVLHTDVEGLWIMPSGTIPPSPPELIASARFASLLADASST
FDVVVIDGPPILGLADSPLLSSIAQATLMVIESGRTRTRAVVEAQNRLRTAGAHMVGAILTRFQAQASYGYGYGYGQTKD
QYRYVADDNDKKRRIMLTMHDEP
>gnl|bykdb|A0A0Q5WCK0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhizobium sp. Leaf371] (length=733 residues).
MLGIARRQWRVVAAAAFLAALAGLLYVMTAVPLYTADISVLLDAEKNQLVEELSMSGAGLEDETALLSQIEVLTSETIGL
AVVDKLKLGEDPIFMAEPRSILGTVLAPVRALMNIPKWFASNQVEDDAQARRAQAQLILSRNMSVDRVGKTYVLRIGYTS
PSPQMAARIANAIGDAYVVDKLNSKYESTRRASAWLQERIVELRQKALETDLAVQKFRTANGLVSTGSQLVSDQQLSELN
TALITAQAETAKARARLDRIQSIVSSGQSDAIVTDVLDSSVSTELRKKYLDSAKLEGEISKKLGPNHVQAVRLRAEMAEY
KRLMFEEVNRIAESYRSEVDVAAAREKSLQDSVSKATNISATANETQVQLRELERESDTYRTLYQTFLQRYQEAVQQQSF
PVTEARIISSASAPEKASFPRKPLVLALFVVMGAAAGTGVGAFREFRDRFFRTGDQVRDILKQEYLGAAPLVIESKQPRN
ALQVGEVNPRLINKQSSISDYVLDNPLSAFAETLRSAKIAADLSILSNKCKVIGIVSTLPGEGKSTVSTNFAELLASQGN
RTVLIDADLRNPGTTRMLARHAQAGILEILLDDKAPQDVLLSNPRTKLAFLPAVIKHRVPHSSELLISPAMRGLIAKLSQ
HFDYIIVDLPPIGPVVDARAMASTIIDGFIYVVEWGQTARRVVRHTLNTEPQIASKCLGVILNKVDNEKMKLYRSYGSSE
YYHSRYSQYYQEG
>gnl|bykdb|A0A0Q5YC84 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Bradyrhizobium sp. Leaf396] (length=772 residues).
MDMLVSRPSINHAAGEASGSMSALIEQLTGLARRQYRVFLIVPAAALTIGLLYLLLTPAQYTATATLLIDSTTLRVLQNQ
LQPQGDVPLDTLQVGSQVEILASRKLGLDVVRNLRLADDPEFAVSSSWNPFASSGGASLEDREQHALDEFLAHRAISRTD
KTYALNISYSSKSPAKAAKIANAIAEAYIDDQLGAKYATVTRAGAWLQDRINELRSKATAADRAVLEYKEKNKIVDLGGA
GSTAGGAGTFSRLIGEQQLYELNSQLAAARGATSEAKARLDRIEQVRKMDVGEGTVADTLKNDVITRLRNQFIDLSAREA
NISGRYGTDHTAAANLRDQMEEIRRNIAAELGRIAGSYRSDYEIAKTREENLERALAALVSEGQLTNRDRLGLAELESSA
KVYHTLFDNFLQRYMESIQQQSFPITDARIISPAVAPTKKSKPVTSLVLAISLSLGIMASIGIAALREAVDGVFRTSRQV
EQELGARCICIVPQVSEPVAGFMRTGAVAAPELSSVPALPGPSSDTSEAASASPHSFAFGDALKRRAVDDPISVFTEAFR
AIKVSAWLQANVRQTKVIGVTSAMPAEGKSTVAANLANLMADAGRLVVLIDADLRNPTLARSLSPRPQAGWLDVIGGKLD
LTEAIGREPTTGLALLPLLLTEAPVHSDEILASQGFRDLLERLRQSYDYIIVDLPPLAPVVDVRATVPAIDSFVFVVEWG
ATSVKTVRRHLLPETELHDRLLGVVLNKANPRLLQRFEHPGIYQNGYYMRGA
>gnl|bykdb|A0A0Q5ZBV9 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Ramlibacter sp. Leaf400] (length=750 residues).
MNAPHPLQQQLAHAAVQPMEEDEFRLLEYWDIVVDNRWLIAAITLVAALLGVGYALLAKPIYESNLLIQVEDSGSSAKSF
LGEAATMFDVKTPASAEIEIIRSRMIVGQAVDATRLYIAASPRYVPVIGEWFARRATGLSDPGVLGIGGWVRGAERIEVE
RFNVPASFEGDEFRVTVGKEGSFTLEHPDLPKPATGKVGTELRFGDAGGEFVVKVAELAGKPGAQFTVIGQSRLKVVEAL
QDDLKLLEKGRQSGIIEVSLQDSDREKLTTVLNEIGRQYVRQNIERKAAEAKKTLDFLDRQLPDLKKQLEQSEDAYNRYR
NKQGTVALDEEAKLILAQSVDLQAKLLEAQQKRVELAAKFTAEHPSIKTLDAQIASFDKEIAGLNSRVRSLPTVQQDALR
LERDVKLNNELYNQLRNNALQLQLVREGKIGNVRLLDAAVVPERPVKPRKGLTVMLAIALGLIGGALIAFARAALFRGIR
SAQEIEAQLGLNVLSTIPKSELQLAVAERVRTKQPGLHVLATASPHDIAVESLRSLRTALQFTMLDAANNRILVTGATPG
VGKSFVSVNLATLLASTGKRVLLVDADLRRGHINQYFGLPRKGGLSDVIVGERALSEAIHKAVVPGLDLLTTGTLPPNPA
ELVLNPAFSKLLKETGELYDLVLVDSAPVLAAADTLSLAPHFSTVLLVARAEVTQPGELHETSRRLVNAGKAPTGVLLNA
IDTTRRHYGSYSYKYGGYRYRAYSYGNTAN
>gnl|bykdb|A0A0Q6AAN2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. Leaf407] (length=740 residues).
MMQQATGGFDTAPDRTIGPRDTGRHAAAAGDDPSLLPDAEDEAGFDPRAIWAVVYRNRLVMILIVALALVLGVVSIMVTP
RIYQARSSVQIDQQVAKVLGTEDSEPATAGGDADRFLQTQVDVINSRAMAKRVSDSLGLAANDAFLESMGGRAKLPVPGE
RRIDQVLDTLQNNLNVDLRRNSRVVGVQFKSRDPALAARIANSYANNFIESNIQRKFSTSAYSREFLQNQLGLAKGRLEA
SERSLINYARSAQLIDASTGARRTGQPDGPQSLVTANLVQLNESYATAAAARVQAQQRYEQARATPLLSLPDVLSNPAAQ
EMLQRRAELNGQLNQLRERLKPDHPTVIQATAQLDALNAQLNQLAGSILASIRNQYLTAQRQQDAIDRQVSGLKSATLAE
QDRGVQYNIFKREVDTNRQLYESLLQRFKEVSAEAGVATNNITLVDSAEAPRRPTSPRPLVNMALALVAGVFLAGLYAFG
RERLDDAIRDPRDVETKLHLPLLGVVPEQEEGDPLVALRDTKSEIAEAYYAIRTSLELSSNQGLPRSLLVTSSQMAEGKS
TTSYALARDFASIGHKVLLVDADLRRPSLHRLMNMSAADKGLSTVLARMTPVEDAVVSTDTDNLSFLPAGPLPPDPANLF
AGTVPADLLAKLGERYDLIVLDGPPVLALADATALASSAAATVIIAEAGGAHYGQVRNAITRLVRAQGHVLGCIVTKYNR
RKSGYAATGNYYRYDYRAKE
>gnl|bykdb|A0A0Q6AEQ4 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. Leaf407] (length=731 residues).
MPGGVDNSPENAARWLPTSQKVTARPQGLSLLTQGWNILRRRKWLIAAAIGIALIVGIVVTLLATPQYTATSVIEIQRET
RNFTMVKGADSNDNASMDTEFYQTQYGLLESKSLAERVVNQLRLADDATFFETFGSGQSKEWFANGRPVAAASTRDQRIR
AASAILLDRIQITPERLSRLVRISFSAPDAAFSKKVVDAWGAQFIQQTLARRFDTTAYARRFLEQRLAQLRVRIDESERK
LVDYAARESIVNLPGETSANGTTTERPLVVDDLSTLNRELAQATADRIRAGSRLNSSTGGQSAEALQNTTITQLRTQRAS
LSSEYAKLMVQFEPQYPPAVALRRQIALIDQTIAREEGRVGGSLRSVYDAATTRENELRSRVKELEQSVLNFRRRSIQYN
IFQRDADTNRQLYDALLQRYKEIGVAGGVGVNNISVVDEAELPIRPSSPRPLLNLATALLVGLALGAIVAVIIEQVDDRL
RNPADITALLDIPLFGTIPKLRDGNAHEALRDPKSVLSEAYLSLQTSLAFSTSHGVPKTLSVTSSRPAEGKSTTSDALAR
ALARSGRRVLLIDGDMRSPSVHHLFDAENRVGLSNYLSGDDRIETLWRPTDVAGLWIMTAGPKPPSAAELLTGNRLGELL
SKLGTSFDHIVVDAPPVMGLADAPLIGSATEGTVFVVDMQATRRTIARVALDRLLTSQTHVLGAVLTKYDQRGTAASYGY
DYSYNYGEQTA
>gnl|bykdb|A0A0Q6AN58 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. Leaf407] (length=710 residues).
MKVSNAAAGYETRLADVVRTAKDVIRRRYLTLAAITLAVTAIGVFLTLRITPTYQGVAKIQIDPSRNPLTRNQSEANAQL
ASEAIETEVTNLGSMDLVRTVVRRLNLVNHPQFRGIWQARAEKTGPVSDTEKVEMVAAAVRSDVSVSRDKLTYILLVRYS
SPDADIAAKVANAMATAYLDNKVGSRIGTAERQSKWFESRMADLVQEVRVADERVAQYQAQAGIVRGASNNSGTITDQQV
GPLSVQLASAESIAAEARSKQTSAQQQVSRGTLDTVSDVRNSATVQDLRRQRALLMQASAEMEGRYGNRHPDYLKVRDQL
EGLDKQLAEESRRVVSSLRSDADAADARAASLRSSMRALEERQANNARASVIAASLQRDADSKHAAYDRLSQLALESRQA
AQNSIAQAQIIEAAQTPRAPSWPNKPLLFMVSFLVGLAAGIAVITTQELMVSGLRTVEEVEEKLGVPLLAAIPNVRKNTR
PANLLIEKPTSQFAEALRNARASILGVREKDRPQIIALTSALPSEGKTTTSLGLARTMAISGDRTILVDADVRRAMLRNI
LDTSSTGPGIVEVLHGEVDLDQAIQPSGVENLDQILVQKPYFSSENMFGSGQMQTMLDELSKRYDTIILDLPPLVGLADG
RFIAALADAVVLVIKWDTTPADAVISAADHLKSDGANLVGAMFTMVDQSSKAAGAYYYYTKQYSSYYQTT
>gnl|bykdb|A0A0Q6CX52 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Aureimonas sp. Leaf460] (length=739 residues).
MASDHGGSSFVDLDHIFAMVRRQLWVVLVGLVIGAMVGVAYLLSAVPLYTATSDILIDKGQSKIVDELASASGVFQDEAE
MLSQVELLKSDQIADGVEKRLSLSENAVFMAGNPSVLRSAILGIKSLVALVTGDDALDLDEEATTREEAKALLQKNLTVE
RVGQTYVLRLGYTSVDPELAARITAAYGEAYLDDQLQAKYEATRRASGWLQDRIAELKEQSYNADLAVQQFRNDNGLIAS
GEQLVSQQQLNQINSQLIESQAQTSESKARLDQINAIIATGRTDSVVGDALSSQTINTLRDKYLDTARRETEIRGKLGSG
HVQAVRLRSEMKEYERLIFGELRRIADSYQSNYTVALEREKSLEASLARVVSVNASDNTMQVKLRELERESETFKSLYDN
FLQRYQQTVQQQSFPITDARIITPASVPDKPSAPKTPIVLAMFMALGVAAGTGSAALREYRDRFFRVGAQVRTELETEFL
GYTPIVKSQTTRTDAVVPSLWAPGGMAAYVRQHPMSGFTETLRNVKVAVDLAMPDLSCKVIGVVSCMPTEGKSTISANLG
CLLAMQGAKTLLIDGDLRNPGLSRMMAKKPDAGVVEVVLGQAPANATILADSDEKLSLLPTILKRRVANTAEILASPSMA
NLLTGFRSEYDYVVVDLPPLGPVVDAKAFAGRVDAFVFVIEWGRTSRMLVRNILMNNPVFHEKCLGVILNKADNSKMKFY
RSYGSPEYYASRYNSYYTD
>gnl|bykdb|A0A0Q6D496 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Aureimonas sp. Leaf427] (length=739 residues).
MASDHGGSSFVDLDHIFAMVRRQLWVVLVGLVIGAMVGVAYLLSAVPLYTATSDILIDKGQSKIVDELASASGVFQDEAE
MLSQVELLKSDQIADGVEKRLSLSENAVFMAGNPSVLRSAILGIKSLVALVTGDDALDLDEEATTREEAKALLQKNLTVE
RVGQTYVLRLGYTSVDPELAARITAAYGEAYLDDQLQAKYEATRRASGWLQDRIAELKEQSYNADLAVQQFRNDNGLIAS
GEQLVSQQQLNQINSQLIESQAQTSESKARLDQINAIIATGRTDSVVGDALSSQTINTLRDKYLDTARRETEIRGKLGSG
HVQAVRLRSEMKEYERLIFGELRRIADSYQSNYTVALEREKSLEASLARVVSVNASDNTMQVKLRELERESETFKSLYDN
FLQRYQQTVQQQSFPITDARIITPASVPDKPSAPKTPIVLAMFMALGVAAGTGSAALREYRDRFFRVGAQVRTELETEFL
GYTPIVKSQTTRTDAVVPSLWAPGGMAAYVRQHPMSGFTETLRNVKVAVDLAMPDLSCKVIGVVSCMPTEGKSTISANLG
CLLAMQGAKTLLIDGDLRNPGLSRMMAKKPDAGVVEVVLGQAPANATILADSDEKLSLLPTILKRRVANTAEILASPSMA
NLLTGFRSEYDYVVVDLPPLGPVVDAKAFAGRVDAFVFVIEWGRTSRMLVRNILMNNPVFHEKCLGVILNKADNSKMKFY
RSYGSPEYYASRYNSYYTD
>gnl|bykdb|A0A0Q6FEL3 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhizobium sp. Leaf453] (length=774 residues).
MNQRPLPLNTVSPIRTDDSDSFIDLNRLTAILARRSRMAAVCVIVSFALGGAYLLTATPVYTSQAQILLDDNLSKYAEET
PASPQSAQQADTQISSAVEILKSGELALRVTDSEKLAENDTILNPPQSVMSMVKSAAKSLIGVFSSRPEISEAALKNGRR
ETAAAYIQQALTVERVTRSSVIAVSFKSTDPQLAARITRAYANAYLSDQLNANFDATERASVWLQERLTDLRQRAQAAAL
DAEKFKAANGLTSTRGELMSEQQLSDLNSQLIVAQADSASASARYSQFKSILEQGAENAINNATISSGQTDNSVIQDLRT
RYLAVSKREQVIAQNFSADHPQAVALRAEKAELSGQIYRELEQLTANYRNEFEVAKSREASLRKSIEGLVGNNSQANQSL
VQLRELEQRATALKTLYESYLGRYEEAAQQRSFPIAKARIISEAGVPVAPSSPKKTMVLALSIVLGLMAGAVIGGFQEFR
ERFFRLEDDIRSILGHKSLGYLPFIGKNTNTLWHKTRGRISKADVEVANADASIPLTKMTRIAIESPRSAFAETLRSAKL
ASDVILQGRANRVIGVISALPGEGKSTVAANFAGLLAASGKRTLLIDADLRNPAISEMISPPAKTGLVEAVLGEADWTAG
LRVDPQTKLAILPTASREHLHHTNELLASQGMETLIANARKVFDYVIVDLAPLAPVVDAKAFSPFADGFLMVVEWGKTPT
RLVRDVLQSDPQFNAKILGVMLNKTDMDELGKYSDFGAAEKYRKSYEKYYIEKT
>gnl|bykdb|A0A0Q6G4R0 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Rhizobium sp. Leaf453] (length=652 residues).
MSNPNADNSRIESEVAILKSDSVLLNVVRENNLVTDSEFGIKVSLKDKILSWLRIPLPPAPTGDEALARVLDAFKSAVRV
NREGLTYVINVGVVSTDPVKAATLANSLGEIYISEQLNAKVASTLTNRDTIQKQVEAANAAMVASENDFDSYISENIERL
EKQSNAVGLTDLKAELSKINDDRTSELRRITTLQASLQSQDFSSLVNELGSQALAELQSQREDLAKRIASTTSDSPESIN
LRAELAKVDNSLSSAATQEVDNLQKAVENYQKQADDVRKKIRSTVLDSNLPMEVLAQMFSMQKSSEIARQQYQTLLSRKT
ELESQASLQLPDSRVVSAALVPTSPSFPNNKVILGMSLLFAIGFGTGLAILREYFIGGFVSENQIEAVLKVPLSAIAPRQ
ATGDEHHKLASPTSSLADLMVTAPLSLFSESVRRLRLTLDQQERKHTGVKSQDADEGAIIMVSSALPNEGKSTMALSLAR
AYALTGKRTLLIDCDLRKPSVNKQLNLEPNHDFIDYLRQDRSSATLTSLIMRDPLSNLTVLLGGRRSDIATDELVMSEKM
GRILSSARKHFDYVILDTPPVEPVVDGLYLARHADMIVFVIKWASTPQSSAKRAVAALKENKNPDAGIVTLLNQQDRAKM
SGNYSYSGYYTE
>gnl|bykdb|A0A0Q6JRN8 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Sphingomonas sp. Leaf339] (length=704 residues).
MAWQSIDLRSLWSVVYRNRYILIGALAVCVTLGIIITFLSTPIYRATARIQIDMESAQIIKGGDVQPQSGVGDADRYLET
QVDILESRTLAREVATQLGLLRNNAFLEQMGMKQSESAEASPAVDRARLEQVLGVLDANLKVKLPVDSSVVNIAFDSPDR
NLSARIANSFAENYITSNLSRKYDTSSYARQFLEGQLRQTRQRLEESERALIDYARGARLIDTSSGGGTGSGSLTASSLV
QLNQSLSQTVAARIAAEQRWLQAQSTPLMNLAIVQQNGAISALVQQRAQLRAQYQQNSLRYDANYPTQRELQTQIDASTA
QITRLATELRDGIRQDYVIAQRQEAGLEKQIAGLKNMTLAEQDRSVRYNILRRDLDTNRTLYDGLLQRYKEISAAAGITA
NNISIVDRADPPGGTVRPRPLLNLALSIVAGLLLGAGLAFLRENFDDAIRSTSDVERMLGLPAIGVIPKLKEEMNVREAM
NDRKSDMSEAYAALRSALQLSTSTGAPKSLIFTSSGPAEGKSTSALAIARSFAQIGHKVVLIDADMRRPSQHKRFEVDNQ
KGLSNVLASQASLEDVLIKTDQPGLDLVTAGPIPINPAELIAGPGMLKLVNQCEQTYDMVVIDSPPVLGLADAPTLASDV
GSMVFVVEANRVHGRRANDALGRLSGSNARILGVLLTKFDAKAIGYYSSDYGYIYSYGNRPAKD
>gnl|bykdb|A0A0Q6MFW2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Aminobacter sp. Root100] (length=797 residues).
MNYASFPFNNRIPASREGPREGSDFIDLERLLAMAKRQAKVVGVGAVVGLLLGLVYLQTTPPTFTASTRVLIDEGMNKMV
DEVSATPVNMQTDAAILSQIEIIKSARLAAVVVDKEKLDQNPSFMQPPKSLLSTLVGYARGFLQIFRSAPDVAGGTELTE
AQRKAMAAAARKEQAVAMLQANIIAERSGRSYVISMGYSAHDPQLAAAITRAYADAFVADQLDASFDATEKAAVWLQGRL
EELRSSSQKAALEVEKFRAENGLAAARGETIAEQQLSDLNAQLILAQADTAKARARYEQYRTIVESGPEAAVGNSTLSAE
VAGNPLISDLKKRHSGVTKREQEISAGFGPNHPQAVALRKEQTDLANQIFRELSQLSETYRNEFEVAQSRETALRNSVSE
ATGQNSSANQAQVRLRELQQQATALSTLYQTFLSRYEEASQQRSFPIAKVRVISEATMPRGPSSPRTSMVFGLALVLGVV
IGAAFGALNEFNERFFRTAEDVRERLGVKFLGYLPLLGSNDDKKEAPKTETGKMGTPPPQPPTRAAEAAKRRAKMRIAVD
APASMFAETLRSTKIAGDVVLQDTGCKVIGVISMLPGEGKSTVAANLAGLIASNGAKTLLIDADLRNPGLSRSLGIDAEQ
GLVEAVVNDQGWQSVIKVDRQTKMAIVPAVVRGRFSHTSELLSSAGMRRFIDDAKATFDYIIVDLPPLGPVVDAKAFAPL
ADGFVLVAEWGATPRPLVRSALNAEPQIASKILGLVLNKVDLKKLPRYGAYGGSEQFLERYSSYYVDKSEPKVKVAG
>gnl|bykdb|A0A0Q6MUB2 [Bacteria] Bacterial tyrosine kinase [Proteobacteria][Variovorax sp. Root318D1] (length=764 residues).
MNAHWQPLIPAPSEPVAADRPPSRLREHMDLLLDSRWRIAKITAVALLIGAAYTMFGPRMYESNVLIQVEDSDRSGGTLV
GDSASSALNAKTPTAGEAEILKSRLVLEQAIEDTKLYIEAEPHYIPVVGAWLARHSKTLSEPGFAGLSGYVSGTEKIVVA
QMDVPADLEGTRFLLTAKADGAYTLTHPKLDAALEGKVGTPLEATTPHGPIRLLVGSIAGRPGAAFELVRQSKQLTLLEL
QKDLRVVEKGKQSSIMDVSWRDGNQQQLANLLNEVARLYVRTNIDQKTGQAQRALNFLGTELPKLKQQLEHSEETYNEYR
NQNGTISLDDEARNALSQNVELQAKLFDATQKRLELTERFTARDPSVQTIDAQIASLKKALGSVEQRIRRMPQLQQNALR
MQRDIKVNTDLYVSLLNSSLQMRLAKEGKIGNVRVLDQAVVPEKPIRPKAVITMALALLAGLFAGAASAFMRRSWRNTIA
SPAEIEAYTGLTVYSTVPLSPRQRLLDRAVHSGEPGVHLLAAIQPDDPALEGLRRLRTALKFAVPAAPNNRIMISSATPG
AGKTFVSANLAAVLASSGRRVLLVDADLRRSSLAPHFGLKRRGGLSELILGSVELDEAIHRSVLPNLDVITTGALHLDPT
ALLTCNAF