BYKdb

Dataset for cluster orphancd of phylum rhodothermaeota

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bykdb|A0A259U0G8 [Bacteria] Bacterial tyrosine kinase [Rhodothermaeota][Rubricoccus marinus] (length=679 residues).
MANELYLLQYAQDLADDAARALLVEAETAGGELPITQTNDGDLAPVETVANRVGNAIRVDGAQDGVEGIQISAVSQSPVE
AARVANLYADLYVARTQSSSRSSVSASRSFLKRQVDSVAVELRAREEATEAYMNREGAVRLDQEASNLVGQLSQLEAERD
QARVEVGIRSNQIATLRNQIESLEQNVETRLRATADRELSESQARVASLRAQLNQEYLSNPEFRNGGADVPARVLNAQRE
VATLERRIEQLSGQIAREAMAAGGVDGNTSGLSRIANLRDQLGQAQVELSGLRERINILNSRISEYQGDLDQVPAQTVDL
ARLIRDRESTEQLLRNLTAKLQEVSVRESAELGYAEVLRPAPVPSTPAAPNRTRIMMLGLAIGLGLGVVLAVGRDQLDQR
IRRPIDLRDMGYPVLGVIPSIDRLIEDDFGGAETVRVQDRDVDTRLVTLLVPVAQASEAFRGLRTSIQFSRPDTVIQTIL
VTSGSPGEGKTTMSSNLAAVMAQSGRRTLLVDCDLRRSRAHKLFGLNREPGLTDLLSRGANGPASGAAIGAVEVADDLFV
LPAGSHVPNPSEHLGSLALRQQLDQFKKEFDIIILDAPPVMAATDAVLLSTQVDASMLVAAAGKTKDYELEFAVTELTNV
GAHIIGVVLNRFDITKEYAYRAQYRYQYGKKYTYGASST
>gnl|bykdb|A0A271IXI4 [Bacteria] Bacterial tyrosine kinase [Rhodothermaeota][Rubrivirga marina] (length=755 residues).
MSITPTSSSRDPLLYAPAPGGGLRSGLQSLSRLLRRHWLIVAGSIALALAIAGAYLYFTPDMYRAESVLLSEESDPNDPD
DALSLGFVPGPTEEGPDEQLLMLRESSALAQEVAAQLLGGSGTAAGPAGAESPEALARQLRATVEFTAYEPNAIGIAATS
TDPREAARIADVYAEVAIAHARNESKRRLAESRAFAEERLASAEADLRDAEGALAGFMSREGTAGLDAEAAAVVNDGARL
ASSVREAAAALQARRASVRATETELGRIRPGLARRVASGVDREIEAAQTQIATLETRLEQFYQNTPEARSDPSDPRARPL
RDEIAQWRQRVDDLSAQYVQETLAAGGSNAGDASSGISYATELERRLIDDRIAITGLEAQIAAQRGQLGSYAARRQSIPR
QSVAVGQLERKRASAEQLYLYLANTLQEITIAENSEIGSLQLLRRATTPDAPLNRGPVQVLGLAALLGLLLGFGTALARS
RIDARVHTPEDIEALGMPLLGVIPKVEDHAAAAEGGPMGNVVAVLDAQSAAAEAYRHLYSRIQFSRPDRVVEVVLVTSPE
VGAGKSTTALNLAATMARANRRTLVIDADLRRPSVGRYLGVDGGPSLQSLIDRDGSLEDAEALVEGAFTPVWNLYALATS
TPVEVPMELLTSERLRELLGAFRSRFDTIVIDTPPMMVASDAALLASQSDACLLVVSSGQTDTEALAQSRRELEDAGGHV
IGVVLNQFDPAEARYKSTYGYRERHYASYHDLRVN
© 1998-2019